Basic Information | |
---|---|
Family ID | F100011 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 103 |
Average Sequence Length | 42 residues |
Representative Sequence | MPVFRDCSQSEGEAEPASAFLSPVARDYPSRALRRFFMPATLR |
Number of Associated Samples | 59 |
Number of Associated Scaffolds | 103 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Unclassified |
% of genes with valid RBS motifs | 100.00 % |
% of genes near scaffold ends (potentially truncated) | 99.03 % |
% of genes from short scaffolds (< 2000 bps) | 99.03 % |
Associated GOLD sequencing projects | 57 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.29 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Unclassified (55.340 % of family members) |
NCBI Taxonomy ID | N/A |
Taxonomy | N/A |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds (30.097 % of family members) |
Environment Ontology (ENVO) | Unclassified (40.777 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (52.427 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 16.90% β-sheet: 0.00% Coil/Unstructured: 83.10% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.29 |
Powered by PDBe Molstar |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
Unclassified | root | N/A | 55.34 % |
All Organisms | root | All Organisms | 44.66 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300001448|JGI20219J14954_1009396 | Not Available | 592 | Open in IMG/M |
3300001804|JGI20219J20330_103534 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 808 | Open in IMG/M |
3300001806|JGI20216J20342_1005278 | Not Available | 716 | Open in IMG/M |
3300001806|JGI20216J20342_1009910 | Not Available | 501 | Open in IMG/M |
3300002862|Ga0004695J43176_100324 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 810 | Open in IMG/M |
3300003938|Ga0063230_11915736 | Not Available | 510 | Open in IMG/M |
3300007327|Ga0075016_1076203 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 812 | Open in IMG/M |
3300007327|Ga0075016_1077486 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 601 | Open in IMG/M |
3300007327|Ga0075016_1088021 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 788 | Open in IMG/M |
3300008787|Ga0103640_1002834 | Not Available | 556 | Open in IMG/M |
3300009580|Ga0115596_1000218 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 747 | Open in IMG/M |
3300009581|Ga0115600_1178625 | Not Available | 675 | Open in IMG/M |
3300009581|Ga0115600_1191244 | Not Available | 614 | Open in IMG/M |
3300009583|Ga0115598_1088022 | Not Available | 559 | Open in IMG/M |
3300009587|Ga0115602_1225518 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 820 | Open in IMG/M |
3300010138|Ga0115595_1196620 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 577 | Open in IMG/M |
3300010143|Ga0126322_1088874 | Not Available | 652 | Open in IMG/M |
3300011057|Ga0138544_1081303 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 736 | Open in IMG/M |
3300011087|Ga0138570_1214258 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 781 | Open in IMG/M |
3300011090|Ga0138579_1050587 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 518 | Open in IMG/M |
3300011282|Ga0138293_141413 | Not Available | 607 | Open in IMG/M |
3300011340|Ga0151652_10241021 | Not Available | 520 | Open in IMG/M |
3300011340|Ga0151652_12084603 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei | 628 | Open in IMG/M |
3300011340|Ga0151652_13388358 | Not Available | 516 | Open in IMG/M |
3300012411|Ga0153880_1041042 | Not Available | 698 | Open in IMG/M |
3300012411|Ga0153880_1322846 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 589 | Open in IMG/M |
3300012774|Ga0138283_1199975 | Not Available | 506 | Open in IMG/M |
3300013295|Ga0170791_10620251 | Not Available | 544 | Open in IMG/M |
3300014490|Ga0182010_10238205 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 963 | Open in IMG/M |
3300016750|Ga0181505_10325151 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 805 | Open in IMG/M |
3300019199|Ga0187789_1226807 | Not Available | 730 | Open in IMG/M |
3300019199|Ga0187789_1258714 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 604 | Open in IMG/M |
3300019211|Ga0187799_1260148 | Not Available | 754 | Open in IMG/M |
3300019234|Ga0172288_1252355 | Not Available | 512 | Open in IMG/M |
3300019234|Ga0172288_1412962 | Not Available | 598 | Open in IMG/M |
3300019241|Ga0187793_1087235 | Not Available | 779 | Open in IMG/M |
3300019241|Ga0187793_1117045 | Not Available | 503 | Open in IMG/M |
3300019241|Ga0187793_1169719 | Not Available | 502 | Open in IMG/M |
3300019241|Ga0187793_1283392 | Not Available | 554 | Open in IMG/M |
3300019244|Ga0180111_1423554 | Not Available | 721 | Open in IMG/M |
3300019245|Ga0187791_1009060 | Not Available | 502 | Open in IMG/M |
3300019245|Ga0187791_1023442 | Not Available | 775 | Open in IMG/M |
3300019245|Ga0187791_1059370 | Not Available | 543 | Open in IMG/M |
3300019245|Ga0187791_1084848 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 609 | Open in IMG/M |
3300019245|Ga0187791_1182750 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 578 | Open in IMG/M |
3300019246|Ga0172287_1388397 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 751 | Open in IMG/M |
3300019246|Ga0172287_1440634 | Not Available | 541 | Open in IMG/M |
3300019250|Ga0187790_1210833 | Not Available | 561 | Open in IMG/M |
3300019250|Ga0187790_1417116 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 608 | Open in IMG/M |
3300019251|Ga0187795_1125814 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 752 | Open in IMG/M |
3300019251|Ga0187795_1359536 | Not Available | 501 | Open in IMG/M |
3300019251|Ga0187795_1514808 | Not Available | 502 | Open in IMG/M |
3300019252|Ga0172286_1114131 | Not Available | 593 | Open in IMG/M |
3300019264|Ga0187796_1184837 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 582 | Open in IMG/M |
3300019264|Ga0187796_1252495 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 729 | Open in IMG/M |
3300019264|Ga0187796_1268810 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 768 | Open in IMG/M |
3300019264|Ga0187796_1328353 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 592 | Open in IMG/M |
3300019264|Ga0187796_1489997 | Not Available | 501 | Open in IMG/M |
3300019265|Ga0187792_1265693 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 602 | Open in IMG/M |
3300019273|Ga0187794_1609589 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 666 | Open in IMG/M |
3300019275|Ga0187798_1090130 | Not Available | 784 | Open in IMG/M |
3300019278|Ga0187800_1210166 | Not Available | 793 | Open in IMG/M |
3300019284|Ga0187797_1451708 | Not Available | 510 | Open in IMG/M |
3300019284|Ga0187797_1452103 | Not Available | 508 | Open in IMG/M |
3300021273|Ga0210340_1103057 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 575 | Open in IMG/M |
3300021855|Ga0213854_1113363 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 806 | Open in IMG/M |
3300021855|Ga0213854_1249157 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 646 | Open in IMG/M |
3300021855|Ga0213854_1397358 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 579 | Open in IMG/M |
3300021856|Ga0213850_1171067 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 806 | Open in IMG/M |
3300021856|Ga0213850_1323376 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 576 | Open in IMG/M |
3300021857|Ga0213849_1013638 | Not Available | 657 | Open in IMG/M |
3300021858|Ga0213852_1089118 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 805 | Open in IMG/M |
3300021858|Ga0213852_1090189 | Not Available | 633 | Open in IMG/M |
3300021858|Ga0213852_1090981 | Not Available | 577 | Open in IMG/M |
3300021858|Ga0213852_1357753 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 608 | Open in IMG/M |
3300021860|Ga0213851_1170451 | Not Available | 500 | Open in IMG/M |
3300021860|Ga0213851_1715153 | Not Available | 648 | Open in IMG/M |
3300021860|Ga0213851_1732336 | Not Available | 715 | Open in IMG/M |
3300021860|Ga0213851_1855165 | Not Available | 511 | Open in IMG/M |
3300021860|Ga0213851_1901196 | Not Available | 611 | Open in IMG/M |
3300021861|Ga0213853_10098854 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 672 | Open in IMG/M |
3300021861|Ga0213853_10309567 | Not Available | 519 | Open in IMG/M |
3300021861|Ga0213853_10460842 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 596 | Open in IMG/M |
3300021861|Ga0213853_10461759 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 608 | Open in IMG/M |
3300021861|Ga0213853_10624919 | Not Available | 638 | Open in IMG/M |
3300021861|Ga0213853_10629167 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 601 | Open in IMG/M |
3300021861|Ga0213853_10917335 | Not Available | 530 | Open in IMG/M |
3300021909|Ga0213846_1105168 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 780 | Open in IMG/M |
3300021929|Ga0213845_1035180 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 517 | Open in IMG/M |
3300021929|Ga0213845_1062213 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 571 | Open in IMG/M |
3300021929|Ga0213845_1148828 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 634 | Open in IMG/M |
3300022154|Ga0213929_1011430 | Not Available | 793 | Open in IMG/M |
3300022154|Ga0213929_1011919 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 781 | Open in IMG/M |
3300022161|Ga0213931_1038998 | Not Available | 569 | Open in IMG/M |
3300022166|Ga0213932_1070124 | Not Available | 520 | Open in IMG/M |
3300022171|Ga0213857_1013044 | Not Available | 827 | Open in IMG/M |
3300022185|Ga0079039_1142440 | Not Available | 592 | Open in IMG/M |
3300023691|Ga0228704_123010 | Not Available | 516 | Open in IMG/M |
3300023703|Ga0228708_1079176 | Not Available | 500 | Open in IMG/M |
3300028558|Ga0265326_10096905 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 837 | Open in IMG/M |
3300033433|Ga0326726_12477158 | Not Available | 503 | Open in IMG/M |
3300033821|Ga0334818_021642 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila | 865 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Watersheds | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds | 30.10% |
Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 27.18% |
Wetland | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland | 10.68% |
Wetland | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Wetland | 7.77% |
Freshwater | Environmental → Aquatic → Freshwater → Creek → Unclassified → Freshwater | 5.83% |
Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 2.91% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 1.94% |
Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 1.94% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 0.97% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 0.97% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 0.97% |
Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 0.97% |
Soil | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil | 0.97% |
Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 0.97% |
Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 0.97% |
Fen | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Fen | 0.97% |
Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 0.97% |
Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.97% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.97% |
Wetland Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Wetland Soil | 0.97% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300001448 | Wetland microbial communities from Twitchell Island in the Sacramento Delta, sample from surface sediment Aug2011 Site A1 Bulk Metatranscriptome | Environmental | Open in IMG/M |
3300001804 | Wetland microbial communities from Twitchell Island in the Sacramento Delta, sample from surface sediment Aug2011 Site A1 Bulk Metatranscriptome (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300001806 | Wetland microbial communities from Twitchell Island in the Sacramento Delta, sample from surface sediment Feb2011 Site A1 Bulk Metatranscriptome (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300002862 | Arctic peat soil from Barrow, Alaska - Barrow Graham LP Incubations RNA 2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300003938 | Wetland microbial communities from Twitchell Island in the Sacramento Delta, California, USA - surface sediment Aug2011 Site C1 Bulk Metatranscriptome (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
3300007327 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaT_ABR_2013 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300008787 | Microbial communities from wetland soil in Czech Republic - R3_cDNA | Environmental | Open in IMG/M |
3300009580 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Mud_11_14_C (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300009581 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Mud_9_15_A (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300009583 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Plant_9_15_B (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300009587 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Mud_9_15_C (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300010138 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Mud_11_14_B (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300010143 | Soil microbial communities from Mekong Delta, Cambodia to study soil gas exchange rates - MK-CA-DRY metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300011057 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 25 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
3300011087 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 55 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
3300011090 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 69 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
3300011282 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaT_SC_2012 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
3300011340 | Combined Assembly of Wetland Metatranscriptomes | Environmental | Open in IMG/M |
3300012411 | Freshwater microbial communities from Lake Alinen Mustaj?rvi, Finland - AM7a metatranscriptome (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012774 | Freshwater microbial communities from Lake Simoncouche, Canada - S_130109_E_mt (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300013295 | northern Canada Lakes metatranscriptome co-assembly | Environmental | Open in IMG/M |
3300014490 | Permafrost microbial communities from Stordalen Mire, Sweden - 611E1M metaG | Environmental | Open in IMG/M |
3300016750 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_30_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300019199 | Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300019211 | Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_10_MT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300019234 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Plant_deep_8_15_core_3 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300019241 | Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300019244 | Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLT293_16_1Ra (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300019245 | Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP10_10_MT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300019246 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Plant_deep_8_15_core_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300019250 | Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300019251 | Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300019252 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Plant_deep_8_15_core_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300019254 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300019264 | Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300019265 | Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP10_20_MT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300019273 | Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300019275 | Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_20_MT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300019278 | Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300019284 | Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_10_MT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300021273 | Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Oregon, United States ? S.386 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300021855 | Metatranscriptome of freshwater sediment microbial communities from pre-fracked creek in Pennsylvania, United States - G-2016_18 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300021856 | Metatranscriptome of freshwater microbial communities from post-fracked creek in Pennsylvania, United States - LL:C (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300021857 | Metatranscriptome of freshwater microbial communities from pre-fracked creek in Pennsylvania, United States - WE:C (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300021858 | Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2015 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300021860 | Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2014 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300021861 | Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2016 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300021909 | Metatranscriptome of freshwater microbial communities from post-fracked creek in Pennsylvania, United States - NH:C (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300021929 | Metatranscriptome of freshwater microbial communities from pre-fracked creek in Pennsylvania, United States - DR:C (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300022154 | Metatranscriptome of freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 1-17 MT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300022161 | Metatranscriptome of freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 3-17 MT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300022166 | Metatranscriptome of freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 11-17 MT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300022171 | Metatranscriptome of freshwater sediment microbial communities from pre-fracked creek in Pennsylvania, United States - G-2016_45 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300022185 | Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 4 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300023691 | Metatranscriptome of freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 1-17_Aug_MT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300023703 | Metatranscriptome of freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 20-17_Aug_MT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Host-Associated | Open in IMG/M |
3300033433 | Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MN | Environmental | Open in IMG/M |
3300033821 | Peat soil microbial communities from Stordalen Mire, Sweden - 713 E-2-X0 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
JGI20219J14954_10093961 | 3300001448 | Wetland | MPVADDCSPSEGDAEPASAFLSPVARDYPSRALRGFFMPGDASTV |
JGI20219J20330_1035341 | 3300001804 | Wetland | MPVAGDCSPAEGEGEPASTYLSPVARDYPSRALRGFFMPGDAST |
JGI20216J20342_10052781 | 3300001806 | Wetland | MPVADDCSPSEGDAEPASAFLSPVARDYPSRALRGFFMPGDAST |
JGI20216J20342_10099101 | 3300001806 | Wetland | MPADDDCSPSEGEAEPASTFLSPVARDYPSRALRGSFHTRSAST |
Ga0004695J43176_1003241 | 3300002862 | Arctic Peat Soil | MPFIHDCSQTKGQAEPASAYLSPVARDYPNRALRGFFMPTALRL |
Ga0063230_119157362 | 3300003938 | Wetland | MPVASDCSLSEGEAEPASAFLSPVTRDYPSRALRGFFMPAA |
Ga0075016_10762031 | 3300007327 | Watersheds | MPDFRDCSQSEGRAEPASAHLSPVARDYPSRALRRFFMPATL |
Ga0075016_10774861 | 3300007327 | Watersheds | MPCTRDCSPMKGRAEPASACLSPVARDYPNRALRRFFMPAALR |
Ga0075016_10880211 | 3300007327 | Watersheds | MPRSRDCSRSEGEVEPASTFLSPVARDYPSRALRRFFMPATL |
Ga0103640_10028341 | 3300008787 | Wetland Soil | MPVFRDCSQSEGEAEPASAFLSPVARDYPSRALRRFFMPN |
Ga0115596_10002181 | 3300009580 | Wetland | MPFSRDCSRLKGMAEPASATLSPVARDYPSRALRGFFMPVTPR |
Ga0115600_11786251 | 3300009581 | Wetland | MPAARDCSQSEGKPEPASVFLSPVARDYPSRALRG |
Ga0115600_11912441 | 3300009581 | Wetland | MPVADDCSPSEGEAEPASTFLSPVARDYPSRALRGFFMPGDAST |
Ga0115598_10880222 | 3300009583 | Wetland | MPAVDDCSPSEGEAEPASTFLSPVARDYPSRALRGSFHTR |
Ga0115602_12255182 | 3300009587 | Wetland | MPADDDCSPSEGEAEPASTFLSPVARDYPSRALRGSFHTRSAS |
Ga0115595_11966201 | 3300010138 | Wetland | MPAVNDCSPSEGEAEPASTFLSPVARDYPSRALRGLFHARDTST |
Ga0126322_10888741 | 3300010143 | Soil | MPATRDCSRSEGRAEPASANLSPVARDYPSRALRGFFRPAMPR |
Ga0138544_10813031 | 3300011057 | Peatlands Soil | MPVFRDCSQSEGEAEPASAFLSPVARDYPSRALRRFFMPSA |
Ga0138570_12142582 | 3300011087 | Peatlands Soil | MPVFRDCSQSEGEAEPASAFLSPVARDYPSRALRRFFMPSAPRLF |
Ga0138579_10505871 | 3300011090 | Peatlands Soil | MPVFRDCSQSEGEAEPASAFLSPVARDYPSRALRRFFMPSAPRL |
Ga0138293_1414132 | 3300011282 | Watersheds | MPVADDCSPSEGEAEPASTFLSPVTRDYPSRALRGFFMPGAAS |
Ga0151652_102410211 | 3300011340 | Wetland | MPVASDCSLSEGEAEPASAFLSPVTRDYPSRALRRF |
Ga0151652_120846031 | 3300011340 | Wetland | MPFLRDCSRSKGKTEPASVFLSPVARDYPSRAFRKF |
Ga0151652_133883581 | 3300011340 | Wetland | MPVFRDYSRSEGEAEPASAFLSPVTRDYPSRALRRF |
Ga0153880_10410421 | 3300012411 | Freshwater Sediment | MPVFRDYSQSEGEAEPASAFLSPVARDYPSRALRRFFMPATLR |
Ga0153880_13228461 | 3300012411 | Freshwater Sediment | MPFARDCSLTKGEAEPASAFLSPVARDYPNRALGGVFRPPRCDCS |
Ga0138283_11999751 | 3300012774 | Freshwater Lake | MPVFRDYSQSEGEAEPASAFLSPVARDYHSRALRRFFMPATL |
Ga0170791_106202511 | 3300013295 | Freshwater | MPVFRDYSQSEGEAEPASAFLSPVARDYPSRALRRFFMPATLRLF |
Ga0182010_102382051 | 3300014490 | Fen | MPVAGDCSPSEGKAEPASTFLSPVARDYPSRTLRGFFMPGG |
Ga0181505_103251511 | 3300016750 | Peatland | MPFIRDCSPTKGKTEPASAFLSPVARDYPSRAFHRFFMAAVPR |
Ga0187789_12268071 | 3300019199 | Peatland | MPFLRDCSRSKGKTEPASVFLSPVARDYPSRAFRKFFMPAAPRL |
Ga0187789_12587141 | 3300019199 | Peatland | MPAFRDCSRPEGEAEPASAFLSPVTRDYPSRALRRFFIPATLRL |
Ga0187799_12601482 | 3300019211 | Peatland | MPASRDCSRSEGMAEPASTVLSPVARDYPSRALRGFFMPTA |
Ga0172288_12523551 | 3300019234 | Wetland | MPAVSDCSPSEGEAEPASTFLSPVARDYPSRALRG |
Ga0172288_14129621 | 3300019234 | Wetland | MPASRDCSRSEGKTEPASAHLSPVARDYPSRALRGFFMPATPRLF |
Ga0187793_10872352 | 3300019241 | Peatland | MPPFRDCSLQEGQTEPASACLSPVARDYPSRALRRFFM |
Ga0187793_11170452 | 3300019241 | Peatland | MPVACDCSQSEGKPEPASVFLSPVARDYPSRDLRGFFMPTA |
Ga0187793_11697191 | 3300019241 | Peatland | VTYASARDCSLLEGEAEPASTFLSPVAREYPSRAFRRFFMPAALRL |
Ga0187793_12833921 | 3300019241 | Peatland | MPATGDFSPLQGKAEPASTVLSPVARDYPSRTLRGFFMPAAPR |
Ga0180111_14235541 | 3300019244 | Groundwater Sediment | MPLFRDCSRLEGEAEPASAFLSPVARDYPSRALRRFFMPATLRLF |
Ga0187791_10090601 | 3300019245 | Peatland | VIYASFHDCSCLEGEGEPASTFLSPVAREYPSRAFHRFFMPAALRLF |
Ga0187791_10234421 | 3300019245 | Peatland | MPFLRDCSRSKGKTEPASVFLSPVARDYPSRAFRKFFMPAA |
Ga0187791_10593701 | 3300019245 | Peatland | MPVACDCSPAKGMVEPASATLSPVARDYPSRALRGFFRPATPRL |
Ga0187791_10848481 | 3300019245 | Peatland | MPAFRDCSRPEGEAEPASAFLSPVTRDYPSRALRRFFIPATLRLF |
Ga0187791_11827501 | 3300019245 | Peatland | MPFIRDCSQTKGKTEPASAFLSPVARDYPSHALRRFFMPAAL |
Ga0172287_13883971 | 3300019246 | Wetland | MPVFDDCSPSEGKAEPASTFLSPVARDYPSRTLSGFFIPAAPRLF |
Ga0172287_14406341 | 3300019246 | Wetland | MPADDDCSPSEGEAEPASTFLSPVARDYPSRALRGSFHTRSASTV |
Ga0187790_12108331 | 3300019250 | Peatland | MPFLRDCSRPKGMAEPASFTLSPVARDYPSRALRRFFMPGGAS |
Ga0187790_14171161 | 3300019250 | Peatland | MPAFRDCSRPEGEAEPASAFLSPVTRDYPSRALRGFFMPAAP |
Ga0187795_11258142 | 3300019251 | Peatland | MPASRDCSRSEGRTEPASVFLSPVARDYPSRALRGFFMPA |
Ga0187795_13595361 | 3300019251 | Peatland | VIYASFHDCSCLEGEGEPASTFLSPVAREYPSRAFRRFFMPAAL |
Ga0187795_15148081 | 3300019251 | Peatland | VTYASARDCSLLEGEAEPASTFLSPVAREYPSRAFRRFFMPAAL |
Ga0172286_11141311 | 3300019252 | Wetland | MPAARDCSQSEGKPEPASVFLSPVARDYPSRALRGFFMPAALRL |
Ga0184641_10873661 | 3300019254 | Groundwater Sediment | MSACRGDCSCAEGMAEPASAALSPVARDYPSPRFRLFFNSRCAWLF |
Ga0187796_11848372 | 3300019264 | Peatland | MPVFRDCSRSEGEAEPASAFLSPVARDYPSRALRRFFMPATLRLF |
Ga0187796_12524951 | 3300019264 | Peatland | MPFLRDCSRPKGKAEPASAFLSPVTRDYPSRAYRRFFM |
Ga0187796_12688101 | 3300019264 | Peatland | MPFISDCSPTKGETEPASAFLSPVARDYPSRARHRFFMPEALRL |
Ga0187796_13283531 | 3300019264 | Peatland | MPIIRDCSPMKGRVEPASAFLSPVARDYPSRALRWFFMPAAPRL |
Ga0187796_14899972 | 3300019264 | Peatland | VIYASFHDCSCLEGEGEPASTFLSPVAREYPSRAFRRFFMPAALRLF |
Ga0187792_12656931 | 3300019265 | Peatland | MPASHDCSRSEGRAEPASANLSPVARDYPSRALRGFFMPATPRL |
Ga0187794_16095892 | 3300019273 | Peatland | MPCASDCSPAEGEAEPASACLSPVARDYPSRALRRFFMPAT |
Ga0187798_10901301 | 3300019275 | Peatland | MPVAGDCSPTEGNAEPASTFLSPVARDYPSRALHGFFMPGGAS |
Ga0187800_12101662 | 3300019278 | Peatland | MPFIRDCSPTKGKTEPASAFLSPVARDYPSRALHRFFMPAAPRLF |
Ga0187797_14517081 | 3300019284 | Peatland | MPFIRDCSPTKGKTEPASAFLSPVARDYPSRALHRFFMPAAPRL |
Ga0187797_14521031 | 3300019284 | Peatland | MPGIRDCSPIQGKAEPASAVLSPVARDYPSRAFHRFFMPAAHR |
Ga0210340_11030572 | 3300021273 | Estuarine | MPVFHDCSQSEGEAEPASAFLSPVARDYPSRALRRFFMPATLRLF |
Ga0213854_11133631 | 3300021855 | Watersheds | MPAADDCSPPEGKAEPASVFLSPVTRDYPSRALRGFFMPAAPR |
Ga0213854_12491571 | 3300021855 | Watersheds | MPRSRDCSRSEGEVEPASTFLSPVARDYPSRALRRFFMPAT |
Ga0213854_13973582 | 3300021855 | Watersheds | MPDFRDCSQSEGRAEPASAHLSPVARDYPSRALRRFFMPATLR |
Ga0213850_11710671 | 3300021856 | Watersheds | MPLIRDCSPTKGKTEPASAVLSPVARDYPSRALHRFFMPAALR |
Ga0213850_13233761 | 3300021856 | Watersheds | MPVDRDCSPSEGRAEPASAFLSPVARDYPSRTLRGFFIPTATRL |
Ga0213849_10136381 | 3300021857 | Watersheds | MPVVRDCSQSEGKPEPASVFLSPVARDYPSRALRGFFIPATLRLF |
Ga0213852_10891181 | 3300021858 | Watersheds | MPRSRDCSRSEGEVEPASTFLSPVARDYPSRALRRFFM |
Ga0213852_10901892 | 3300021858 | Watersheds | MPRPHDCSRLEGEAEPASAFLSPVARDYPSRALRRFFM |
Ga0213852_10909812 | 3300021858 | Watersheds | MPRAGDCSPSEGKAEPASTILSPVARDYPSRALRGFFM |
Ga0213852_13577531 | 3300021858 | Watersheds | MPWIGDCSPTKGQTEPASACLSPVARDYPNRALRRFFMPAALRLF |
Ga0213851_11704511 | 3300021860 | Watersheds | MPASRDCSRSEGKTEPASANLSPVARDYPSRALRGFFMPAT |
Ga0213851_17151531 | 3300021860 | Watersheds | MPRPHDCSQLEGEAEPASAFLSPVARDYPSRALRRF |
Ga0213851_17323361 | 3300021860 | Watersheds | VIYASACDCSLLEGEAEPASTFLSPVARDYPSRAFHRFFMPAALRLF |
Ga0213851_18551651 | 3300021860 | Watersheds | MPLIRDCSPTKGKTEPASAVLSPVARDYPSRALHRFFMPAALRLF |
Ga0213851_19011962 | 3300021860 | Watersheds | MPRSRDCSRSEGEVEPASTFLSPVARDYPSRALRRFFMPATLRLF |
Ga0213853_100988541 | 3300021861 | Watersheds | MPDFRDCSQSEGRAEPASAHLSPVARDYPSRALRRFFMPATLRLF |
Ga0213853_103095671 | 3300021861 | Watersheds | MPVFRDCSRSEGEAEPASAFLSPVARDYPSRALRRFFMPA |
Ga0213853_104608421 | 3300021861 | Watersheds | MPWIGDCSPTKGQTEPASACLSPVARDYPNRALRRFFMPAA |
Ga0213853_104617591 | 3300021861 | Watersheds | MPCTRDCSPMKGRAEPASACLSPVARDYPNRALRRFFMPAALRLF |
Ga0213853_106249192 | 3300021861 | Watersheds | MPVVRDCSQSEGKPEPASVFLSPVARDYPSRALRGFFIP |
Ga0213853_106291671 | 3300021861 | Watersheds | MPWIGDCSPTKGRAEPASAVLSPVARDYPNRALRRFFMPAA |
Ga0213853_109173351 | 3300021861 | Watersheds | MPVVRDCSPTEGKAEPAPAYLSPVARDYPSRALLRFFMPETLRL |
Ga0213846_11051681 | 3300021909 | Watersheds | MPVFRDCSQSEGEAEPASAFLSPVARDYPSRALRRFFMPATLRL |
Ga0213845_10351801 | 3300021929 | Watersheds | MPVFRDCSRSEGEAEPASAFLSPVTRDYPSRALRRFFMPATLRL |
Ga0213845_10622132 | 3300021929 | Watersheds | MPVAGDCSPSEGKAEPASTFLSPVARDYPSRALRGFFMPGGASTVP |
Ga0213845_11488281 | 3300021929 | Watersheds | MPVFRDCSQSEGEAEPASAFLSPVARDYPSRALRRFFMPATLR |
Ga0213929_10114301 | 3300022154 | Freshwater | MPTARDCSQSEGKPEPASVFLSPVARDYPSRALRGFF |
Ga0213929_10119191 | 3300022154 | Freshwater | MPASRDCSRSEGMAEPASTVLSPVARDYPSRALRGFFMPTTL |
Ga0213931_10389981 | 3300022161 | Freshwater | MPVSCDCSQSEGEAEPASAYLSPVARDYPSRALRRFFMPATLR |
Ga0213932_10701241 | 3300022166 | Freshwater | MPAARDCSQSEGKPEPASVFLSPVARDYPSRALRGFFMPATLRL |
Ga0213857_10130442 | 3300022171 | Watersheds | MPVFRDCSQSEGEAEPASAFLSPVARDYPSRALRRFFMPATLRLF |
Ga0079039_11424401 | 3300022185 | Freshwater Wetlands | MPASRDCSQSEGKTEPASANLSPVARDYPSRALRGFFMPATPR |
Ga0228704_1230102 | 3300023691 | Freshwater | VIYASACDCSLLEGEAEPASTFLSPVARDYPSRAFRRFFMPAALRLF |
Ga0228708_10791761 | 3300023703 | Freshwater | MPASRDCSRSEGKAEPASANLSPVARDYPSRALRGFFMPATPR |
Ga0265326_100969052 | 3300028558 | Rhizosphere | MPVADDCSPSEGKAEPASTFLSPVTRDYPSRTLRGFFMPGG |
Ga0326726_124771581 | 3300033433 | Peat Soil | MPAARDCSQSEGKPEPASVFLSPVARDYPSRALRGFFMPA |
Ga0334818_021642_1_126 | 3300033821 | Soil | MPVFRDCSQSEGEAEPASAFLSPVARDYPSRALRRFFMPATL |
⦗Top⦘ |