Basic Information | |
---|---|
Family ID | F099779 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 103 |
Average Sequence Length | 42 residues |
Representative Sequence | RTFLVDPADPDNPTVTFGAFDASGRPGVLYEMLWGLPRVS |
Number of Associated Samples | 92 |
Number of Associated Scaffolds | 103 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Unclassified |
% of genes with valid RBS motifs | 0.00 % |
% of genes near scaffold ends (potentially truncated) | 0.00 % |
% of genes from short scaffolds (< 2000 bps) | 0.00 % |
Associated GOLD sequencing projects | 88 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.41 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Unclassified (100.000 % of family members) |
NCBI Taxonomy ID | N/A |
Taxonomy | N/A |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (18.447 % of family members) |
Environment Ontology (ENVO) | Unclassified (38.835 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (52.427 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 4.41% β-sheet: 23.53% Coil/Unstructured: 72.06% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.41 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 103 Family Scaffolds |
---|---|---|
PF00561 | Abhydrolase_1 | 17.48 |
PF12697 | Abhydrolase_6 | 5.83 |
PF01584 | CheW | 5.83 |
PF07676 | PD40 | 2.91 |
PF13561 | adh_short_C2 | 1.94 |
PF00211 | Guanylate_cyc | 1.94 |
PF03992 | ABM | 1.94 |
PF01638 | HxlR | 1.94 |
PF07077 | DUF1345 | 1.94 |
PF11716 | MDMPI_N | 1.94 |
PF08386 | Abhydrolase_4 | 1.94 |
PF02627 | CMD | 0.97 |
PF13458 | Peripla_BP_6 | 0.97 |
PF04993 | TfoX_N | 0.97 |
PF02909 | TetR_C_1 | 0.97 |
PF13474 | SnoaL_3 | 0.97 |
PF13489 | Methyltransf_23 | 0.97 |
PF00583 | Acetyltransf_1 | 0.97 |
PF13545 | HTH_Crp_2 | 0.97 |
PF04954 | SIP | 0.97 |
PF00027 | cNMP_binding | 0.97 |
PF00117 | GATase | 0.97 |
PF00557 | Peptidase_M24 | 0.97 |
PF00266 | Aminotran_5 | 0.97 |
PF12146 | Hydrolase_4 | 0.97 |
PF00005 | ABC_tran | 0.97 |
PF14742 | GDE_N_bis | 0.97 |
PF12679 | ABC2_membrane_2 | 0.97 |
PF05988 | DUF899 | 0.97 |
PF00313 | CSD | 0.97 |
PF13673 | Acetyltransf_10 | 0.97 |
PF00593 | TonB_dep_Rec | 0.97 |
PF01872 | RibD_C | 0.97 |
PF02518 | HATPase_c | 0.97 |
PF01266 | DAO | 0.97 |
PF08734 | GYD | 0.97 |
PF00009 | GTP_EFTU | 0.97 |
PF01244 | Peptidase_M19 | 0.97 |
COG ID | Name | Functional Category | % Frequency in 103 Family Scaffolds |
---|---|---|---|
COG1733 | DNA-binding transcriptional regulator, HxlR family | Transcription [K] | 1.94 |
COG2114 | Adenylate cyclase, class 3 | Signal transduction mechanisms [T] | 1.94 |
COG4291 | Uncharacterized membrane protein | Function unknown [S] | 1.94 |
COG0262 | Dihydrofolate reductase | Coenzyme transport and metabolism [H] | 0.97 |
COG0599 | Uncharacterized conserved protein YurZ, alkylhydroperoxidase/carboxymuconolactone decarboxylase family | General function prediction only [R] | 0.97 |
COG1309 | DNA-binding protein, AcrR family, includes nucleoid occlusion protein SlmA | Transcription [K] | 0.97 |
COG1985 | Pyrimidine reductase, riboflavin biosynthesis | Coenzyme transport and metabolism [H] | 0.97 |
COG2128 | Alkylhydroperoxidase family enzyme, contains CxxC motif | Inorganic ion transport and metabolism [P] | 0.97 |
COG2355 | Zn-dependent dipeptidase, microsomal dipeptidase homolog | Posttranslational modification, protein turnover, chaperones [O] | 0.97 |
COG2375 | NADPH-dependent ferric siderophore reductase, contains FAD-binding and SIP domains | Inorganic ion transport and metabolism [P] | 0.97 |
COG3070 | Transcriptional regulator of competence genes, TfoX/Sxy family | Transcription [K] | 0.97 |
COG4274 | Uncharacterized conserved protein, contains GYD domain | Function unknown [S] | 0.97 |
COG4312 | Predicted dithiol-disulfide oxidoreductase, DUF899 family | General function prediction only [R] | 0.97 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
Unclassified | root | N/A | 100.00 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 18.45% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 8.74% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 5.83% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 4.85% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 4.85% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 4.85% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 4.85% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 2.91% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 2.91% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 2.91% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.94% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.94% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.94% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 1.94% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.94% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.94% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.94% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.94% |
Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 1.94% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.94% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 1.94% |
Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.97% |
Soil | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil | 0.97% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.97% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.97% |
Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 0.97% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.97% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil | 0.97% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.97% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.97% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.97% |
Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 0.97% |
Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.97% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.97% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.97% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.97% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.97% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.97% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.97% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
3300004156 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1 | Environmental | Open in IMG/M |
3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Environmental | Open in IMG/M |
3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Environmental | Open in IMG/M |
3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Environmental | Open in IMG/M |
3300005561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 | Environmental | Open in IMG/M |
3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Host-Associated | Open in IMG/M |
3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Host-Associated | Open in IMG/M |
3300006049 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 | Host-Associated | Open in IMG/M |
3300006172 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014 | Environmental | Open in IMG/M |
3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Host-Associated | Open in IMG/M |
3300006572 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHPB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300006580 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLPC (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
3300006846 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Host-Associated | Open in IMG/M |
3300006847 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Host-Associated | Open in IMG/M |
3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Host-Associated | Open in IMG/M |
3300006969 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 | Host-Associated | Open in IMG/M |
3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
3300010143 | Soil microbial communities from Mekong Delta, Cambodia to study soil gas exchange rates - MK-CA-DRY metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Host-Associated | Open in IMG/M |
3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
3300012353 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaG | Environmental | Open in IMG/M |
3300012897 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S074-202C-1 | Environmental | Open in IMG/M |
3300012910 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S198-509B-2 | Environmental | Open in IMG/M |
3300012911 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S088-202R-2 | Environmental | Open in IMG/M |
3300012915 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S103-311B-2 | Environmental | Open in IMG/M |
3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
3300012987 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MG | Environmental | Open in IMG/M |
3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Host-Associated | Open in IMG/M |
3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Host-Associated | Open in IMG/M |
3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Host-Associated | Open in IMG/M |
3300015164 | Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-4b, rock/ice/stream interface) | Environmental | Open in IMG/M |
3300015200 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S209-509C-1 (version 2) | Environmental | Open in IMG/M |
3300017947 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_4_20_MG | Environmental | Open in IMG/M |
3300017997 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_coex | Environmental | Open in IMG/M |
3300018075 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b1 | Environmental | Open in IMG/M |
3300018422 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 T | Environmental | Open in IMG/M |
3300018429 | Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 T | Environmental | Open in IMG/M |
3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300021073 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_b1 redo | Environmental | Open in IMG/M |
3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022756 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1 | Environmental | Open in IMG/M |
3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) | Environmental | Open in IMG/M |
3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026331 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 (SPAdes) | Environmental | Open in IMG/M |
3300026552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes) | Environmental | Open in IMG/M |
3300027511 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_20_30 (SPAdes) | Environmental | Open in IMG/M |
3300027748 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 (SPAdes) | Environmental | Open in IMG/M |
3300027775 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control (SPAdes) | Environmental | Open in IMG/M |
3300027907 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) | Host-Associated | Open in IMG/M |
3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300028722 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_368 | Environmental | Open in IMG/M |
3300028755 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_356 | Environmental | Open in IMG/M |
3300028778 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_142 | Environmental | Open in IMG/M |
3300028784 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121 | Environmental | Open in IMG/M |
3300028793 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_159 | Environmental | Open in IMG/M |
3300028796 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_141 | Environmental | Open in IMG/M |
3300028814 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_183 | Environmental | Open in IMG/M |
3300028876 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_140 | Environmental | Open in IMG/M |
3300028878 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_117 | Environmental | Open in IMG/M |
3300031228 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT153D57 | Environmental | Open in IMG/M |
3300031747 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22 | Environmental | Open in IMG/M |
3300032067 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f22 | Environmental | Open in IMG/M |
3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Host-Associated | Open in IMG/M |
3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
3300033550 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day4 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
JGI10216J12902_1018076861 | 3300000956 | Soil | PIDERTFLVDAEDPDNPTVTFGSFDSEGRPGALYRMLWGYPRA* |
Ga0062589_1022833582 | 3300004156 | Soil | TFLVDPADPDAPTLTFGAFDAAGRPHVLYEMLWGLPRAEG* |
Ga0062595_1007171811 | 3300004479 | Soil | FLVDAADPDTPTVTFGRFDSAGRPHVLYLMLWGLPRQGE* |
Ga0070709_107559492 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | RTFLVDPADPDNPTVTFGAFDASGRPGVLYEMLWGLPRVS* |
Ga0070684_1004869701 | 3300005535 | Corn Rhizosphere | DPDNPTVTFADPDAGGRPRLLYDMLWGLPRTGEDDRWTGR* |
Ga0070686_1006244611 | 3300005544 | Switchgrass Rhizosphere | FLVDPADPDTPTVTFGAFDAAGRPHVLYEMLWGLPRAEG* |
Ga0070686_1019683293 | 3300005544 | Switchgrass Rhizosphere | DERTFLVDAADPDTPTVTFGAFDPGGRPQVLYSMLWGLPRLP* |
Ga0070693_1001498243 | 3300005547 | Corn, Switchgrass And Miscanthus Rhizosphere | DALPVGERTFLVDQADPDAPTLTFGAFDAASRPHVLYEMLWGLPRAEG* |
Ga0066699_112171442 | 3300005561 | Soil | ARPVDDRTFVVDASDPDTPTVTFGAFDERGRPHALYLMLWALPRV* |
Ga0068854_1009664802 | 3300005578 | Corn Rhizosphere | DSRTFLVDAKDPDSPTMTFGAFDSDGRPRVVYEMLWGLPRQE* |
Ga0068854_1011637852 | 3300005578 | Corn Rhizosphere | PLDHRTFVVDALDPDDPTVTFGEFDPTGRPTVLYDMLWGLPRVDA* |
Ga0068854_1013112492 | 3300005578 | Corn Rhizosphere | FLVDAADPDGPTVMFGAFDATGRPQMLYDMLWGLPRVGR* |
Ga0068856_1004148234 | 3300005614 | Corn Rhizosphere | TALPIDGRAFLVDSADPDGPTVMFGAFDSAGRPHVLYDMLWGLPRVGG* |
Ga0068866_106261211 | 3300005718 | Miscanthus Rhizosphere | EAEALPVDERTFLVDPADPDTPTVTFGAFDAADRPRVLYEMLWGLPRVEA* |
Ga0075417_107208211 | 3300006049 | Populus Rhizosphere | PIDDRTFLVDARDPDNPTVTFGAFDDSGRPGALYQMLWAFPRV* |
Ga0075018_107785262 | 3300006172 | Watersheds | DRTFLIDAADPDNPTVTFANFDEAGRPHVLYLMLWALPRQTGGRA* |
Ga0097621_1018002361 | 3300006237 | Miscanthus Rhizosphere | ERTFLVDPADPDTPTVTFGAFDAADRPRVLYEMLWGLPRVEA* |
Ga0068871_1014593822 | 3300006358 | Miscanthus Rhizosphere | TFLVDAADPDTPTITFGAFDSTGRPRVLYSMLWGLPRIS* |
Ga0074051_117768302 | 3300006572 | Soil | PLDERTFLVDPADPDNPTVTFGAFDTAGRPQVLYDMLWGLPRLGE* |
Ga0074049_125249082 | 3300006580 | Soil | IDRGDPDNPTATFAGFDDKGRPAVVYDMLWGLPRT* |
Ga0079222_100349423 | 3300006755 | Agricultural Soil | FLTDPADPDNPAVTFGAFDAAGRPRVLYDMLWGLPRADG* |
Ga0079222_114335682 | 3300006755 | Agricultural Soil | VDASDPDTPTVTFGAFGERGRPHALYLMLWALPRT* |
Ga0075430_1015172941 | 3300006846 | Populus Rhizosphere | LIDAADPDNPTVTFGAFDARGRPQVLYNMLWGLPRIDR* |
Ga0075431_1005645083 | 3300006847 | Populus Rhizosphere | TFLVDARDPDNPTVTFGAFDDSGRPGALYQMLWAFPRV* |
Ga0075431_1020767821 | 3300006847 | Populus Rhizosphere | LIDPADPDNPTVTFGDFDAAGRPRVLYLMLWGLPRLDG* |
Ga0068865_1006984311 | 3300006881 | Miscanthus Rhizosphere | ALPVGERTFLVDPADPDAPTLTFGAFDAAGRPHVLYEMLWGLPRAEG* |
Ga0075419_107275151 | 3300006969 | Populus Rhizosphere | DRTFLVDARDPDNPTVAFGAFDDSGRPGALYQMLWAFPRV* |
Ga0075419_114182832 | 3300006969 | Populus Rhizosphere | GDGRTLHGLQLDERTFVVDPVDPDEPAVTFDRFDECGFPGVLYSMLWGLPRV* |
Ga0075435_1015003052 | 3300007076 | Populus Rhizosphere | LVDPADPDTPTVTFGAFDAADRPRVLYEMLWGLPRVEG* |
Ga0111539_121064701 | 3300009094 | Populus Rhizosphere | TFVVDADSPDNPTVTFGNFGVDGRACVLYQMLWGLPRVAP* |
Ga0105245_116647871 | 3300009098 | Miscanthus Rhizosphere | LPVGARTFVVDALDPDDPTVTFGEFDPTGRPSVLYDMLWGLPRVDA* |
Ga0105243_109315192 | 3300009148 | Miscanthus Rhizosphere | FLVDPADPDAPTLTFGAFDAAGRPHVLYEMLWGLPRAEG* |
Ga0105243_114738952 | 3300009148 | Miscanthus Rhizosphere | VDALDPDDPTVTFGEFDPTGRPSVLYDMLWGLPRVDA* |
Ga0105249_101016591 | 3300009553 | Switchgrass Rhizosphere | ERTFLVDAGDPDTPTVTFAGFDDDGRPGVLYDMIWGLTRKET* |
Ga0126380_122420812 | 3300010043 | Tropical Forest Soil | LVDPADPDNPTVTFGAFDASGRPHVLYSMLWGLPRLDT* |
Ga0126322_11415582 | 3300010143 | Soil | LVDLADPDNPTVTFGAFDASGRPGVLYEMLWGLPRVG* |
Ga0126377_108958413 | 3300010362 | Tropical Forest Soil | EAIPIDGRTFLVDPADPDNPTVTFGEFDAAGRPRVLYLMLWGFPRVEA* |
Ga0134127_101030551 | 3300010399 | Terrestrial Soil | ALPIDGRAFLVDAADPDGPTVMFGAFDATGRPQMLYDMLWGLPRVER* |
Ga0134127_120046811 | 3300010399 | Terrestrial Soil | LPVDERTFLVDPADPDTPTVTFGAFDAADRPRVLYEMLWGLPRVEA* |
Ga0105246_101354691 | 3300011119 | Miscanthus Rhizosphere | DPSDPDNPTVTFAGSDAARRPQVLYVMLWGLPRLSETPEGR* |
Ga0137381_103716031 | 3300012207 | Vadose Zone Soil | DRVFLLDPKDPDNPTVTFGRFDAAGRPHVLYLMLWGLPRLDDVTR* |
Ga0137381_109810381 | 3300012207 | Vadose Zone Soil | LPLDERTFVANPADPDNPAVTFGAFDAAGRPRVLYDMLWGLPRLGR* |
Ga0137381_111696581 | 3300012207 | Vadose Zone Soil | LPLDERTFVANPADPDNPAVTFGAFDAAGRPRVLYDMLWGLPRLGG* |
Ga0137378_108055181 | 3300012210 | Vadose Zone Soil | RTFVADRADPDNPAVTFGAFDAAGRPRVLYDMLWGLPRVGG* |
Ga0137367_108245752 | 3300012353 | Vadose Zone Soil | LPLDERTFLVDVMNPDNPTVTFGAFDATGRPRVLYVMLWGLPRIDE* |
Ga0157285_102537941 | 3300012897 | Soil | RRLDDRVFLVDPSDADNPTVTFGEFDPAGRPQVLYLMLWGLPRVQG* |
Ga0157308_100534373 | 3300012910 | Soil | TFLVDADDPDTPTVTFGAFDDSGRPGVLYEMLWGLPRV* |
Ga0157301_103651671 | 3300012911 | Soil | TFLIDARDPDSPTMTLGANGDDGRPRVLYSMLWGFPRTAG* |
Ga0157302_103510282 | 3300012915 | Soil | PINRSTFVTNPEDPDTPTVTFAAFDADERPGVLYRMIWGSPRV* |
Ga0164303_102460851 | 3300012957 | Soil | DNPTVTFAGSDAARRPQVLYLMLWGLPRLSETPEGR* |
Ga0126369_122513061 | 3300012971 | Tropical Forest Soil | PISERVFLVDADDPDNPTVTFQDGVLYVMLWGLPRLFRR* |
Ga0164307_103916271 | 3300012987 | Soil | TFLVDAADPDTPTITFGAFDPTGRPRVLYSMLWGLPRIS* |
Ga0157371_109045351 | 3300013102 | Corn Rhizosphere | FLVDPADPDNPTVTFGAFDDAGRPGVLYDMLWGLPRMG* |
Ga0157369_117168641 | 3300013105 | Corn Rhizosphere | RTFLVDPADPDTPTLTFGAFDAADRPRVLYEMLWGLPRVEA* |
Ga0163163_129577592 | 3300014325 | Switchgrass Rhizosphere | ALPLDHRTFVVDALDPDDPTVTFGEFDPTGRPTVLYDMLWGLPRVDA* |
Ga0157377_109845772 | 3300014745 | Miscanthus Rhizosphere | GERTFLVDQADPDAPTLTFGAFDAAGRPHVLYEMLWGLPRAEG* |
Ga0167652_10617502 | 3300015164 | Glacier Forefield Soil | LVDPNDPDNPTMTFGAFDAEGRPQLLYVMLWGLPRG* |
Ga0173480_101514283 | 3300015200 | Soil | DPDDPDNPTVTFGSFDAAGRPAVLYEMLWGLPRLA* |
Ga0173480_106500982 | 3300015200 | Soil | LDADDPDTPTMTFGAFDADGRPRVVYEMLWGLPRQE* |
Ga0187785_107449701 | 3300017947 | Tropical Peatland | TFLVDRADPDNPTVSFGAFDADGKPGVVYRMLWGLPRLD |
Ga0184610_11024411 | 3300017997 | Groundwater Sediment | EGVALEALPVDAATFLVDADNPDTPTVTFGAFDDSGRPGALYQMLWGLPRV |
Ga0184632_100021381 | 3300018075 | Groundwater Sediment | MREPSFVDTVDPDNPTVTFGAFDAAGRPRVLYLMLWGLPRLDD |
Ga0190265_126109912 | 3300018422 | Soil | VVDAADPDNPTVTFGDFDVATGRPGELYDMLWELPRLDE |
Ga0190272_130644383 | 3300018429 | Soil | DERTFVVDAADPDTPTVTFGAFDAGGRPGVLYLMLWALPRLAD |
Ga0206354_117016702 | 3300020081 | Corn, Switchgrass And Miscanthus Rhizosphere | VDSADPDGPTVMFGAFDSAGRPHVLYDMLWGLPRVGG |
Ga0210378_103279352 | 3300021073 | Groundwater Sediment | RTFLVDPTDPDNPTVTFGAFDASGRPQVLYIMLWGLPRLDA |
Ga0224712_103849493 | 3300022467 | Corn, Switchgrass And Miscanthus Rhizosphere | VDPADPDNPTVTFGAFDASGRPGVLYEMLWGLPRVV |
Ga0222622_113089691 | 3300022756 | Groundwater Sediment | AADPDTPTVTFGEFDDSGRPGVVYDMLWALPRDRS |
Ga0207699_109835862 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | VGERTFLVDQADPDAPTLTFGAFDAAGRPHVLYEMLWGLPRAEG |
Ga0207705_107098401 | 3300025909 | Corn Rhizosphere | DRTFLLDPRDSDAPTVTFGAFDPAGRPQVLYNMLWGLPRQD |
Ga0207654_103871241 | 3300025911 | Corn Rhizosphere | EALPVGERTFLVDPADPDTPTVTFGAFDAADRPRVLYEMLWGLPRVEA |
Ga0207693_102451551 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | FLVDPADPDNPTVTFGAFDTAGRPQVLYEMLWGLPRLGG |
Ga0207663_113772421 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | AFLVDPADPDGPTVTFGAFDPAGRPHVLYDMLWGLPRVGP |
Ga0207687_112403292 | 3300025927 | Miscanthus Rhizosphere | MPIDGRAFLVDPADPDGPTVTFGAFDPAGRPHVLYDMLWGLPRVGP |
Ga0207700_111787912 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | DDRTFLIDAADPDNPTITFADFDESGRPHVLYLMLWALPRQAYSVR |
Ga0207644_106872511 | 3300025931 | Switchgrass Rhizosphere | FLVDAADPDGPTVMFGAFDATGRPQMLYDMLWGLPRVGR |
Ga0207690_117054981 | 3300025932 | Corn Rhizosphere | IDGRAFLVDSADPDGPTVMFGAFDSAGRPHVLYDMLWGLPRVGG |
Ga0207670_113735222 | 3300025936 | Switchgrass Rhizosphere | RTFLVDAADPDTPTVTFGAFDPGGRPQVLYSMLWGLPRLP |
Ga0207669_106329911 | 3300025937 | Miscanthus Rhizosphere | TFLVDAGDPDTPTVTFAGFDDGGRPGVLYDMIWGLTRRGT |
Ga0207676_116349502 | 3300026095 | Switchgrass Rhizosphere | VDADDPDTPTVTFGGFDATGRPGVLYTMLWGLPRLDE |
Ga0207698_104463983 | 3300026142 | Corn Rhizosphere | VDRRTFLVDPADPDTPTVTFGAFDAADRPRVLYEMLWGLPRAEG |
Ga0209267_11179421 | 3300026331 | Soil | EALPVDDRTFLVDAANPDNPTVTFGAFDGSGRPGALYVMLWGLPRVE |
Ga0209577_106587131 | 3300026552 | Soil | LDDRTFVVDASDPDNPTVTFGAFDERGRPHALYLMLWGLPRV |
Ga0209843_10413981 | 3300027511 | Groundwater Sand | TFVVDAQDPDVPTVTFGGFGASGRPAVLYQMLWGLPRV |
Ga0209689_14093952 | 3300027748 | Soil | FLVDTSDPDNPTVTFGAFDAARRPHVLYVMLWGLPRVDE |
Ga0209177_101849991 | 3300027775 | Agricultural Soil | LPIDERTFLLDAEDEDWPTIAFGAFHDSGQPGVLYRMLWGLPRRTA |
Ga0207428_103695221 | 3300027907 | Populus Rhizosphere | TFVVDALDPDDPTVTFGEFDPTGRPTVLYDMLWGLSRVDA |
Ga0268265_109825001 | 3300028380 | Switchgrass Rhizosphere | RTFVVDPADPDCPSITFDAFDFAGRPNVVYLMLWGLSRLTAK |
Ga0307319_103379762 | 3300028722 | Soil | VDAADPDTPTVTFGEFDDSGRPGVVYDMLWALPRDRS |
Ga0307316_103055242 | 3300028755 | Soil | TLVVDVDDPDNPTVTFGEFDASGRPALLYDMLWGLPRM |
Ga0307288_101182213 | 3300028778 | Soil | DERAFLVDAVDPDNPTVSFGAFDASGRPGVIYQMLWGLPRLDE |
Ga0307282_106104611 | 3300028784 | Soil | LVDPVDPDNPTVTFGAFDAAGRPRVLYLMLWGLPRLDE |
Ga0307299_100914542 | 3300028793 | Soil | ALPLDGRTFLVDAADPDNPTVTFGAYDAAGRPQILYLMLWGLPRLQK |
Ga0307287_102899791 | 3300028796 | Soil | LPLNNSTFLVDADDPDNPTVTFGGFDASGRPAVLYDMLWGLPRV |
Ga0307302_105049742 | 3300028814 | Soil | TFVVDAEDPDVPTVTFGGFGASGRPAVLYQMLWGLPRV |
Ga0307286_102229462 | 3300028876 | Soil | LDEQTVLVDAVDPDNPTVSFGAFDASGRPGVIYQMLWGLPRLDE |
Ga0307278_103078522 | 3300028878 | Soil | AFPIDGRTFLVDAADPDNPTVTFGEFDAAGRPQILYLMLWGLPRIDE |
Ga0299914_111597642 | 3300031228 | Soil | ETFVVDASDPDNPTLTFGELDAAGRPRVLYLMLWGLPRLGD |
Ga0318502_110288181 | 3300031747 | Soil | PIDERTFVVDLAEPDTPTVTFGGFDRAGNPAALYLMLWALPRLAGV |
Ga0318524_101992972 | 3300032067 | Soil | FVADPADPDNPKVTFGAFDPSGRPQVLYDMLWGLPRLDR |
Ga0307415_1008518731 | 3300032126 | Rhizosphere | PLDDRTFVVDANDPDTPTVTFGGFGASGRPAVLYQMLWGLPRV |
Ga0335081_124413531 | 3300032892 | Soil | LNDRTFVVDPADPDTPTMTFGDFDAAGRPQVLYEMLWGLPRVSR |
Ga0247829_115896641 | 3300033550 | Soil | VDPTDPDNPTVTFGAFDASGRPQVLYIMLWGLPRLDA |
⦗Top⦘ |