NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F099779

Metagenome / Metatranscriptome Family F099779

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F099779
Family Type Metagenome / Metatranscriptome
Number of Sequences 103
Average Sequence Length 42 residues
Representative Sequence RTFLVDPADPDNPTVTFGAFDASGRPGVLYEMLWGLPRVS
Number of Associated Samples 92
Number of Associated Scaffolds 103

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Unclassified
% of genes with valid RBS motifs 0.00 %
% of genes near scaffold ends (potentially truncated) 0.00 %
% of genes from short scaffolds (< 2000 bps) 0.00 %
Associated GOLD sequencing projects 88
AlphaFold2 3D model prediction Yes
3D model pTM-score0.41

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Unclassified (100.000 % of family members)
NCBI Taxonomy ID N/A
Taxonomy N/A

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil
(18.447 % of family members)
Environment Ontology (ENVO) Unclassified
(38.835 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(52.427 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 4.41%    β-sheet: 23.53%    Coil/Unstructured: 72.06%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.41
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 103 Family Scaffolds
PF00561Abhydrolase_1 17.48
PF12697Abhydrolase_6 5.83
PF01584CheW 5.83
PF07676PD40 2.91
PF13561adh_short_C2 1.94
PF00211Guanylate_cyc 1.94
PF03992ABM 1.94
PF01638HxlR 1.94
PF07077DUF1345 1.94
PF11716MDMPI_N 1.94
PF08386Abhydrolase_4 1.94
PF02627CMD 0.97
PF13458Peripla_BP_6 0.97
PF04993TfoX_N 0.97
PF02909TetR_C_1 0.97
PF13474SnoaL_3 0.97
PF13489Methyltransf_23 0.97
PF00583Acetyltransf_1 0.97
PF13545HTH_Crp_2 0.97
PF04954SIP 0.97
PF00027cNMP_binding 0.97
PF00117GATase 0.97
PF00557Peptidase_M24 0.97
PF00266Aminotran_5 0.97
PF12146Hydrolase_4 0.97
PF00005ABC_tran 0.97
PF14742GDE_N_bis 0.97
PF12679ABC2_membrane_2 0.97
PF05988DUF899 0.97
PF00313CSD 0.97
PF13673Acetyltransf_10 0.97
PF00593TonB_dep_Rec 0.97
PF01872RibD_C 0.97
PF02518HATPase_c 0.97
PF01266DAO 0.97
PF08734GYD 0.97
PF00009GTP_EFTU 0.97
PF01244Peptidase_M19 0.97

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 103 Family Scaffolds
COG1733DNA-binding transcriptional regulator, HxlR familyTranscription [K] 1.94
COG2114Adenylate cyclase, class 3Signal transduction mechanisms [T] 1.94
COG4291Uncharacterized membrane proteinFunction unknown [S] 1.94
COG0262Dihydrofolate reductaseCoenzyme transport and metabolism [H] 0.97
COG0599Uncharacterized conserved protein YurZ, alkylhydroperoxidase/carboxymuconolactone decarboxylase familyGeneral function prediction only [R] 0.97
COG1309DNA-binding protein, AcrR family, includes nucleoid occlusion protein SlmATranscription [K] 0.97
COG1985Pyrimidine reductase, riboflavin biosynthesisCoenzyme transport and metabolism [H] 0.97
COG2128Alkylhydroperoxidase family enzyme, contains CxxC motifInorganic ion transport and metabolism [P] 0.97
COG2355Zn-dependent dipeptidase, microsomal dipeptidase homologPosttranslational modification, protein turnover, chaperones [O] 0.97
COG2375NADPH-dependent ferric siderophore reductase, contains FAD-binding and SIP domainsInorganic ion transport and metabolism [P] 0.97
COG3070Transcriptional regulator of competence genes, TfoX/Sxy familyTranscription [K] 0.97
COG4274Uncharacterized conserved protein, contains GYD domainFunction unknown [S] 0.97
COG4312Predicted dithiol-disulfide oxidoreductase, DUF899 familyGeneral function prediction only [R] 0.97


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

NameRankTaxonomyDistribution
UnclassifiedrootN/A100.00 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil18.45%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere8.74%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere5.83%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil4.85%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil4.85%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere4.85%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere4.85%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil2.91%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil2.91%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere2.91%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment1.94%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil1.94%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil1.94%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere1.94%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil1.94%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil1.94%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere1.94%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere1.94%
Miscanthus RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere1.94%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere1.94%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere1.94%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment0.97%
SoilEnvironmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil0.97%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds0.97%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.97%
Glacier Forefield SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil0.97%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil0.97%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil0.97%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil0.97%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland0.97%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere0.97%
Groundwater SandEnvironmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand0.97%
Switchgrass RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere0.97%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere0.97%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.97%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.97%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.97%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere0.97%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere0.97%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000956Soil microbial communities from Great Prairies - Kansas, Native Prairie soilEnvironmentalOpen in IMG/M
3300004156Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1EnvironmentalOpen in IMG/M
3300004479Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAsEnvironmentalOpen in IMG/M
3300005434Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaGEnvironmentalOpen in IMG/M
3300005535Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaGEnvironmentalOpen in IMG/M
3300005544Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaGEnvironmentalOpen in IMG/M
3300005547Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaGEnvironmentalOpen in IMG/M
3300005561Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148EnvironmentalOpen in IMG/M
3300005578Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2Host-AssociatedOpen in IMG/M
3300005614Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2Host-AssociatedOpen in IMG/M
3300005718Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2Host-AssociatedOpen in IMG/M
3300006049Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1Host-AssociatedOpen in IMG/M
3300006172Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014EnvironmentalOpen in IMG/M
3300006237Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2)Host-AssociatedOpen in IMG/M
3300006358Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2Host-AssociatedOpen in IMG/M
3300006572Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHPB (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006580Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLPC (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006755Agricultural soil microbial communities from Georgia to study Nitrogen management - GA PlitterEnvironmentalOpen in IMG/M
3300006846Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4Host-AssociatedOpen in IMG/M
3300006847Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5Host-AssociatedOpen in IMG/M
3300006881Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2Host-AssociatedOpen in IMG/M
3300006969Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3Host-AssociatedOpen in IMG/M
3300007076Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4Host-AssociatedOpen in IMG/M
3300009094Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009098Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaGHost-AssociatedOpen in IMG/M
3300009148Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaGHost-AssociatedOpen in IMG/M
3300009553Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaGHost-AssociatedOpen in IMG/M
3300010043Tropical forest soil microbial communities from Panama - MetaG Plot_26EnvironmentalOpen in IMG/M
3300010143Soil microbial communities from Mekong Delta, Cambodia to study soil gas exchange rates - MK-CA-DRY metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010362Tropical forest soil microbial communities from Panama - MetaG Plot_22EnvironmentalOpen in IMG/M
3300010399Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3EnvironmentalOpen in IMG/M
3300011119Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaGHost-AssociatedOpen in IMG/M
3300012207Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaGEnvironmentalOpen in IMG/M
3300012210Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaGEnvironmentalOpen in IMG/M
3300012353Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaGEnvironmentalOpen in IMG/M
3300012897Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S074-202C-1EnvironmentalOpen in IMG/M
3300012910Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S198-509B-2EnvironmentalOpen in IMG/M
3300012911Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S088-202R-2EnvironmentalOpen in IMG/M
3300012915Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S103-311B-2EnvironmentalOpen in IMG/M
3300012957Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MGEnvironmentalOpen in IMG/M
3300012971Tropical forest soil microbial communities from Panama - MetaG Plot_1EnvironmentalOpen in IMG/M
3300012987Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MGEnvironmentalOpen in IMG/M
3300013102Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaGHost-AssociatedOpen in IMG/M
3300013105Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaGHost-AssociatedOpen in IMG/M
3300014325Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaGHost-AssociatedOpen in IMG/M
3300014745Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaGHost-AssociatedOpen in IMG/M
3300015164Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-4b, rock/ice/stream interface)EnvironmentalOpen in IMG/M
3300015200Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S209-509C-1 (version 2)EnvironmentalOpen in IMG/M
3300017947Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_4_20_MGEnvironmentalOpen in IMG/M
3300017997Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_coexEnvironmentalOpen in IMG/M
3300018075Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b1EnvironmentalOpen in IMG/M
3300018422Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 TEnvironmentalOpen in IMG/M
3300018429Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 TEnvironmentalOpen in IMG/M
3300020081Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300021073Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_b1 redoEnvironmentalOpen in IMG/M
3300022467Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022756Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1EnvironmentalOpen in IMG/M
3300025906Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025909Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025911Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025915Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025916Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025927Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025928Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025931Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025932Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025936Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025937Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026095Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026142Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026331Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 (SPAdes)EnvironmentalOpen in IMG/M
3300026552Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes)EnvironmentalOpen in IMG/M
3300027511Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_20_30 (SPAdes)EnvironmentalOpen in IMG/M
3300027748Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 (SPAdes)EnvironmentalOpen in IMG/M
3300027775Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control (SPAdes)EnvironmentalOpen in IMG/M
3300027907Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes)Host-AssociatedOpen in IMG/M
3300028380Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300028722Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_368EnvironmentalOpen in IMG/M
3300028755Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_356EnvironmentalOpen in IMG/M
3300028778Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_142EnvironmentalOpen in IMG/M
3300028784Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121EnvironmentalOpen in IMG/M
3300028793Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_159EnvironmentalOpen in IMG/M
3300028796Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_141EnvironmentalOpen in IMG/M
3300028814Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_183EnvironmentalOpen in IMG/M
3300028876Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_140EnvironmentalOpen in IMG/M
3300028878Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_117EnvironmentalOpen in IMG/M
3300031228Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT153D57EnvironmentalOpen in IMG/M
3300031747Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22EnvironmentalOpen in IMG/M
3300032067Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f22EnvironmentalOpen in IMG/M
3300032126Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2Host-AssociatedOpen in IMG/M
3300032892Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5EnvironmentalOpen in IMG/M
3300033550Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day4EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI10216J12902_10180768613300000956SoilPIDERTFLVDAEDPDNPTVTFGSFDSEGRPGALYRMLWGYPRA*
Ga0062589_10228335823300004156SoilTFLVDPADPDAPTLTFGAFDAAGRPHVLYEMLWGLPRAEG*
Ga0062595_10071718113300004479SoilFLVDAADPDTPTVTFGRFDSAGRPHVLYLMLWGLPRQGE*
Ga0070709_1075594923300005434Corn, Switchgrass And Miscanthus RhizosphereRTFLVDPADPDNPTVTFGAFDASGRPGVLYEMLWGLPRVS*
Ga0070684_10048697013300005535Corn RhizosphereDPDNPTVTFADPDAGGRPRLLYDMLWGLPRTGEDDRWTGR*
Ga0070686_10062446113300005544Switchgrass RhizosphereFLVDPADPDTPTVTFGAFDAAGRPHVLYEMLWGLPRAEG*
Ga0070686_10196832933300005544Switchgrass RhizosphereDERTFLVDAADPDTPTVTFGAFDPGGRPQVLYSMLWGLPRLP*
Ga0070693_10014982433300005547Corn, Switchgrass And Miscanthus RhizosphereDALPVGERTFLVDQADPDAPTLTFGAFDAASRPHVLYEMLWGLPRAEG*
Ga0066699_1121714423300005561SoilARPVDDRTFVVDASDPDTPTVTFGAFDERGRPHALYLMLWALPRV*
Ga0068854_10096648023300005578Corn RhizosphereDSRTFLVDAKDPDSPTMTFGAFDSDGRPRVVYEMLWGLPRQE*
Ga0068854_10116378523300005578Corn RhizospherePLDHRTFVVDALDPDDPTVTFGEFDPTGRPTVLYDMLWGLPRVDA*
Ga0068854_10131124923300005578Corn RhizosphereFLVDAADPDGPTVMFGAFDATGRPQMLYDMLWGLPRVGR*
Ga0068856_10041482343300005614Corn RhizosphereTALPIDGRAFLVDSADPDGPTVMFGAFDSAGRPHVLYDMLWGLPRVGG*
Ga0068866_1062612113300005718Miscanthus RhizosphereEAEALPVDERTFLVDPADPDTPTVTFGAFDAADRPRVLYEMLWGLPRVEA*
Ga0075417_1072082113300006049Populus RhizospherePIDDRTFLVDARDPDNPTVTFGAFDDSGRPGALYQMLWAFPRV*
Ga0075018_1077852623300006172WatershedsDRTFLIDAADPDNPTVTFANFDEAGRPHVLYLMLWALPRQTGGRA*
Ga0097621_10180023613300006237Miscanthus RhizosphereERTFLVDPADPDTPTVTFGAFDAADRPRVLYEMLWGLPRVEA*
Ga0068871_10145938223300006358Miscanthus RhizosphereTFLVDAADPDTPTITFGAFDSTGRPRVLYSMLWGLPRIS*
Ga0074051_1177683023300006572SoilPLDERTFLVDPADPDNPTVTFGAFDTAGRPQVLYDMLWGLPRLGE*
Ga0074049_1252490823300006580SoilIDRGDPDNPTATFAGFDDKGRPAVVYDMLWGLPRT*
Ga0079222_1003494233300006755Agricultural SoilFLTDPADPDNPAVTFGAFDAAGRPRVLYDMLWGLPRADG*
Ga0079222_1143356823300006755Agricultural SoilVDASDPDTPTVTFGAFGERGRPHALYLMLWALPRT*
Ga0075430_10151729413300006846Populus RhizosphereLIDAADPDNPTVTFGAFDARGRPQVLYNMLWGLPRIDR*
Ga0075431_10056450833300006847Populus RhizosphereTFLVDARDPDNPTVTFGAFDDSGRPGALYQMLWAFPRV*
Ga0075431_10207678213300006847Populus RhizosphereLIDPADPDNPTVTFGDFDAAGRPRVLYLMLWGLPRLDG*
Ga0068865_10069843113300006881Miscanthus RhizosphereALPVGERTFLVDPADPDAPTLTFGAFDAAGRPHVLYEMLWGLPRAEG*
Ga0075419_1072751513300006969Populus RhizosphereDRTFLVDARDPDNPTVAFGAFDDSGRPGALYQMLWAFPRV*
Ga0075419_1141828323300006969Populus RhizosphereGDGRTLHGLQLDERTFVVDPVDPDEPAVTFDRFDECGFPGVLYSMLWGLPRV*
Ga0075435_10150030523300007076Populus RhizosphereLVDPADPDTPTVTFGAFDAADRPRVLYEMLWGLPRVEG*
Ga0111539_1210647013300009094Populus RhizosphereTFVVDADSPDNPTVTFGNFGVDGRACVLYQMLWGLPRVAP*
Ga0105245_1166478713300009098Miscanthus RhizosphereLPVGARTFVVDALDPDDPTVTFGEFDPTGRPSVLYDMLWGLPRVDA*
Ga0105243_1093151923300009148Miscanthus RhizosphereFLVDPADPDAPTLTFGAFDAAGRPHVLYEMLWGLPRAEG*
Ga0105243_1147389523300009148Miscanthus RhizosphereVDALDPDDPTVTFGEFDPTGRPSVLYDMLWGLPRVDA*
Ga0105249_1010165913300009553Switchgrass RhizosphereERTFLVDAGDPDTPTVTFAGFDDDGRPGVLYDMIWGLTRKET*
Ga0126380_1224208123300010043Tropical Forest SoilLVDPADPDNPTVTFGAFDASGRPHVLYSMLWGLPRLDT*
Ga0126322_114155823300010143SoilLVDLADPDNPTVTFGAFDASGRPGVLYEMLWGLPRVG*
Ga0126377_1089584133300010362Tropical Forest SoilEAIPIDGRTFLVDPADPDNPTVTFGEFDAAGRPRVLYLMLWGFPRVEA*
Ga0134127_1010305513300010399Terrestrial SoilALPIDGRAFLVDAADPDGPTVMFGAFDATGRPQMLYDMLWGLPRVER*
Ga0134127_1200468113300010399Terrestrial SoilLPVDERTFLVDPADPDTPTVTFGAFDAADRPRVLYEMLWGLPRVEA*
Ga0105246_1013546913300011119Miscanthus RhizosphereDPSDPDNPTVTFAGSDAARRPQVLYVMLWGLPRLSETPEGR*
Ga0137381_1037160313300012207Vadose Zone SoilDRVFLLDPKDPDNPTVTFGRFDAAGRPHVLYLMLWGLPRLDDVTR*
Ga0137381_1098103813300012207Vadose Zone SoilLPLDERTFVANPADPDNPAVTFGAFDAAGRPRVLYDMLWGLPRLGR*
Ga0137381_1116965813300012207Vadose Zone SoilLPLDERTFVANPADPDNPAVTFGAFDAAGRPRVLYDMLWGLPRLGG*
Ga0137378_1080551813300012210Vadose Zone SoilRTFVADRADPDNPAVTFGAFDAAGRPRVLYDMLWGLPRVGG*
Ga0137367_1082457523300012353Vadose Zone SoilLPLDERTFLVDVMNPDNPTVTFGAFDATGRPRVLYVMLWGLPRIDE*
Ga0157285_1025379413300012897SoilRRLDDRVFLVDPSDADNPTVTFGEFDPAGRPQVLYLMLWGLPRVQG*
Ga0157308_1005343733300012910SoilTFLVDADDPDTPTVTFGAFDDSGRPGVLYEMLWGLPRV*
Ga0157301_1036516713300012911SoilTFLIDARDPDSPTMTLGANGDDGRPRVLYSMLWGFPRTAG*
Ga0157302_1035102823300012915SoilPINRSTFVTNPEDPDTPTVTFAAFDADERPGVLYRMIWGSPRV*
Ga0164303_1024608513300012957SoilDNPTVTFAGSDAARRPQVLYLMLWGLPRLSETPEGR*
Ga0126369_1225130613300012971Tropical Forest SoilPISERVFLVDADDPDNPTVTFQDGVLYVMLWGLPRLFRR*
Ga0164307_1039162713300012987SoilTFLVDAADPDTPTITFGAFDPTGRPRVLYSMLWGLPRIS*
Ga0157371_1090453513300013102Corn RhizosphereFLVDPADPDNPTVTFGAFDDAGRPGVLYDMLWGLPRMG*
Ga0157369_1171686413300013105Corn RhizosphereRTFLVDPADPDTPTLTFGAFDAADRPRVLYEMLWGLPRVEA*
Ga0163163_1295775923300014325Switchgrass RhizosphereALPLDHRTFVVDALDPDDPTVTFGEFDPTGRPTVLYDMLWGLPRVDA*
Ga0157377_1098457723300014745Miscanthus RhizosphereGERTFLVDQADPDAPTLTFGAFDAAGRPHVLYEMLWGLPRAEG*
Ga0167652_106175023300015164Glacier Forefield SoilLVDPNDPDNPTMTFGAFDAEGRPQLLYVMLWGLPRG*
Ga0173480_1015142833300015200SoilDPDDPDNPTVTFGSFDAAGRPAVLYEMLWGLPRLA*
Ga0173480_1065009823300015200SoilLDADDPDTPTMTFGAFDADGRPRVVYEMLWGLPRQE*
Ga0187785_1074497013300017947Tropical PeatlandTFLVDRADPDNPTVSFGAFDADGKPGVVYRMLWGLPRLD
Ga0184610_110244113300017997Groundwater SedimentEGVALEALPVDAATFLVDADNPDTPTVTFGAFDDSGRPGALYQMLWGLPRV
Ga0184632_1000213813300018075Groundwater SedimentMREPSFVDTVDPDNPTVTFGAFDAAGRPRVLYLMLWGLPRLDD
Ga0190265_1261099123300018422SoilVVDAADPDNPTVTFGDFDVATGRPGELYDMLWELPRLDE
Ga0190272_1306443833300018429SoilDERTFVVDAADPDTPTVTFGAFDAGGRPGVLYLMLWALPRLAD
Ga0206354_1170167023300020081Corn, Switchgrass And Miscanthus RhizosphereVDSADPDGPTVMFGAFDSAGRPHVLYDMLWGLPRVGG
Ga0210378_1032793523300021073Groundwater SedimentRTFLVDPTDPDNPTVTFGAFDASGRPQVLYIMLWGLPRLDA
Ga0224712_1038494933300022467Corn, Switchgrass And Miscanthus RhizosphereVDPADPDNPTVTFGAFDASGRPGVLYEMLWGLPRVV
Ga0222622_1130896913300022756Groundwater SedimentAADPDTPTVTFGEFDDSGRPGVVYDMLWALPRDRS
Ga0207699_1098358623300025906Corn, Switchgrass And Miscanthus RhizosphereVGERTFLVDQADPDAPTLTFGAFDAAGRPHVLYEMLWGLPRAEG
Ga0207705_1070984013300025909Corn RhizosphereDRTFLLDPRDSDAPTVTFGAFDPAGRPQVLYNMLWGLPRQD
Ga0207654_1038712413300025911Corn RhizosphereEALPVGERTFLVDPADPDTPTVTFGAFDAADRPRVLYEMLWGLPRVEA
Ga0207693_1024515513300025915Corn, Switchgrass And Miscanthus RhizosphereFLVDPADPDNPTVTFGAFDTAGRPQVLYEMLWGLPRLGG
Ga0207663_1137724213300025916Corn, Switchgrass And Miscanthus RhizosphereAFLVDPADPDGPTVTFGAFDPAGRPHVLYDMLWGLPRVGP
Ga0207687_1124032923300025927Miscanthus RhizosphereMPIDGRAFLVDPADPDGPTVTFGAFDPAGRPHVLYDMLWGLPRVGP
Ga0207700_1117879123300025928Corn, Switchgrass And Miscanthus RhizosphereDDRTFLIDAADPDNPTITFADFDESGRPHVLYLMLWALPRQAYSVR
Ga0207644_1068725113300025931Switchgrass RhizosphereFLVDAADPDGPTVMFGAFDATGRPQMLYDMLWGLPRVGR
Ga0207690_1170549813300025932Corn RhizosphereIDGRAFLVDSADPDGPTVMFGAFDSAGRPHVLYDMLWGLPRVGG
Ga0207670_1137352223300025936Switchgrass RhizosphereRTFLVDAADPDTPTVTFGAFDPGGRPQVLYSMLWGLPRLP
Ga0207669_1063299113300025937Miscanthus RhizosphereTFLVDAGDPDTPTVTFAGFDDGGRPGVLYDMIWGLTRRGT
Ga0207676_1163495023300026095Switchgrass RhizosphereVDADDPDTPTVTFGGFDATGRPGVLYTMLWGLPRLDE
Ga0207698_1044639833300026142Corn RhizosphereVDRRTFLVDPADPDTPTVTFGAFDAADRPRVLYEMLWGLPRAEG
Ga0209267_111794213300026331SoilEALPVDDRTFLVDAANPDNPTVTFGAFDGSGRPGALYVMLWGLPRVE
Ga0209577_1065871313300026552SoilLDDRTFVVDASDPDNPTVTFGAFDERGRPHALYLMLWGLPRV
Ga0209843_104139813300027511Groundwater SandTFVVDAQDPDVPTVTFGGFGASGRPAVLYQMLWGLPRV
Ga0209689_140939523300027748SoilFLVDTSDPDNPTVTFGAFDAARRPHVLYVMLWGLPRVDE
Ga0209177_1018499913300027775Agricultural SoilLPIDERTFLLDAEDEDWPTIAFGAFHDSGQPGVLYRMLWGLPRRTA
Ga0207428_1036952213300027907Populus RhizosphereTFVVDALDPDDPTVTFGEFDPTGRPTVLYDMLWGLSRVDA
Ga0268265_1098250013300028380Switchgrass RhizosphereRTFVVDPADPDCPSITFDAFDFAGRPNVVYLMLWGLSRLTAK
Ga0307319_1033797623300028722SoilVDAADPDTPTVTFGEFDDSGRPGVVYDMLWALPRDRS
Ga0307316_1030552423300028755SoilTLVVDVDDPDNPTVTFGEFDASGRPALLYDMLWGLPRM
Ga0307288_1011822133300028778SoilDERAFLVDAVDPDNPTVSFGAFDASGRPGVIYQMLWGLPRLDE
Ga0307282_1061046113300028784SoilLVDPVDPDNPTVTFGAFDAAGRPRVLYLMLWGLPRLDE
Ga0307299_1009145423300028793SoilALPLDGRTFLVDAADPDNPTVTFGAYDAAGRPQILYLMLWGLPRLQK
Ga0307287_1028997913300028796SoilLPLNNSTFLVDADDPDNPTVTFGGFDASGRPAVLYDMLWGLPRV
Ga0307302_1050497423300028814SoilTFVVDAEDPDVPTVTFGGFGASGRPAVLYQMLWGLPRV
Ga0307286_1022294623300028876SoilLDEQTVLVDAVDPDNPTVSFGAFDASGRPGVIYQMLWGLPRLDE
Ga0307278_1030785223300028878SoilAFPIDGRTFLVDAADPDNPTVTFGEFDAAGRPQILYLMLWGLPRIDE
Ga0299914_1115976423300031228SoilETFVVDASDPDNPTLTFGELDAAGRPRVLYLMLWGLPRLGD
Ga0318502_1102881813300031747SoilPIDERTFVVDLAEPDTPTVTFGGFDRAGNPAALYLMLWALPRLAGV
Ga0318524_1019929723300032067SoilFVADPADPDNPKVTFGAFDPSGRPQVLYDMLWGLPRLDR
Ga0307415_10085187313300032126RhizospherePLDDRTFVVDANDPDTPTVTFGGFGASGRPAVLYQMLWGLPRV
Ga0335081_1244135313300032892SoilLNDRTFVVDPADPDTPTMTFGDFDAAGRPQVLYEMLWGLPRVSR
Ga0247829_1158966413300033550SoilVDPTDPDNPTVTFGAFDASGRPQVLYIMLWGLPRLDA


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.