


| Basic Information | |
|---|---|
| Family ID | F099720 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 103 |
| Average Sequence Length | 44 residues |
| Representative Sequence | MFIETYYDERAAVPGSTSEPMIPYPELSGEELAVWQEYLPMRRE |
| Number of Associated Samples | 84 |
| Number of Associated Scaffolds | 103 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 100.00 % |
| % of genes near scaffold ends (potentially truncated) | 93.20 % |
| % of genes from short scaffolds (< 2000 bps) | 95.15 % |
| Associated GOLD sequencing projects | 81 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.29 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (97.087 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil (23.301 % of family members) |
| Environment Ontology (ENVO) | Unclassified (38.835 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (48.544 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 12.50% β-sheet: 0.00% Coil/Unstructured: 87.50% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.29 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 103 Family Scaffolds |
|---|---|---|
| PF00199 | Catalase | 7.77 |
| PF07883 | Cupin_2 | 1.94 |
| PF00486 | Trans_reg_C | 1.94 |
| PF00582 | Usp | 1.94 |
| PF04392 | ABC_sub_bind | 1.94 |
| PF02586 | SRAP | 1.94 |
| PF12697 | Abhydrolase_6 | 0.97 |
| PF13518 | HTH_28 | 0.97 |
| PF02321 | OEP | 0.97 |
| PF13401 | AAA_22 | 0.97 |
| PF03992 | ABM | 0.97 |
| PF16656 | Pur_ac_phosph_N | 0.97 |
| COG ID | Name | Functional Category | % Frequency in 103 Family Scaffolds |
|---|---|---|---|
| COG0753 | Catalase | Inorganic ion transport and metabolism [P] | 7.77 |
| COG1538 | Outer membrane protein TolC | Cell wall/membrane/envelope biogenesis [M] | 1.94 |
| COG2135 | ssDNA abasic site-binding protein YedK/HMCES, SRAP family | Replication, recombination and repair [L] | 1.94 |
| COG2984 | ABC-type uncharacterized transport system, periplasmic component | General function prediction only [R] | 1.94 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 97.09 % |
| Unclassified | root | N/A | 2.91 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2170459016|G1P06HT01B0VY9 | All Organisms → cellular organisms → Bacteria | 699 | Open in IMG/M |
| 3300000364|INPhiseqgaiiFebDRAFT_100574213 | All Organisms → cellular organisms → Bacteria | 516 | Open in IMG/M |
| 3300000596|KanNP_Total_noBrdU_T14TCDRAFT_1001467 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2805 | Open in IMG/M |
| 3300000596|KanNP_Total_noBrdU_T14TCDRAFT_1004774 | All Organisms → cellular organisms → Bacteria | 1566 | Open in IMG/M |
| 3300000597|AF_2010_repII_A1DRAFT_10127359 | All Organisms → cellular organisms → Bacteria | 620 | Open in IMG/M |
| 3300000837|AP72_2010_repI_A100DRAFT_1032612 | All Organisms → cellular organisms → Bacteria | 730 | Open in IMG/M |
| 3300000955|JGI1027J12803_102581843 | All Organisms → cellular organisms → Bacteria | 793 | Open in IMG/M |
| 3300003987|Ga0055471_10084569 | All Organisms → cellular organisms → Bacteria | 911 | Open in IMG/M |
| 3300004268|Ga0066398_10163240 | All Organisms → cellular organisms → Bacteria | 567 | Open in IMG/M |
| 3300004633|Ga0066395_10730371 | All Organisms → cellular organisms → Bacteria | 590 | Open in IMG/M |
| 3300005168|Ga0066809_10240250 | All Organisms → cellular organisms → Bacteria | 502 | Open in IMG/M |
| 3300005294|Ga0065705_10957768 | All Organisms → cellular organisms → Bacteria | 559 | Open in IMG/M |
| 3300005332|Ga0066388_101847278 | All Organisms → cellular organisms → Bacteria | 1076 | Open in IMG/M |
| 3300005445|Ga0070708_100323598 | All Organisms → cellular organisms → Bacteria | 1452 | Open in IMG/M |
| 3300005447|Ga0066689_10900783 | All Organisms → cellular organisms → Bacteria | 547 | Open in IMG/M |
| 3300005561|Ga0066699_10299841 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → Geobacter → unclassified Geobacter → Geobacter sp. | 1144 | Open in IMG/M |
| 3300005713|Ga0066905_102099850 | All Organisms → cellular organisms → Bacteria | 525 | Open in IMG/M |
| 3300005764|Ga0066903_105629103 | All Organisms → cellular organisms → Bacteria | 659 | Open in IMG/M |
| 3300006173|Ga0070716_101356636 | All Organisms → cellular organisms → Bacteria | 577 | Open in IMG/M |
| 3300006175|Ga0070712_100610869 | All Organisms → cellular organisms → Bacteria | 924 | Open in IMG/M |
| 3300006194|Ga0075427_10076407 | All Organisms → cellular organisms → Bacteria | 601 | Open in IMG/M |
| 3300006573|Ga0074055_11231337 | All Organisms → cellular organisms → Bacteria | 911 | Open in IMG/M |
| 3300006846|Ga0075430_100697865 | All Organisms → cellular organisms → Bacteria | 837 | Open in IMG/M |
| 3300006852|Ga0075433_11226718 | All Organisms → cellular organisms → Bacteria | 650 | Open in IMG/M |
| 3300006852|Ga0075433_11928736 | All Organisms → cellular organisms → Bacteria | 506 | Open in IMG/M |
| 3300006854|Ga0075425_100857435 | All Organisms → cellular organisms → Bacteria | 1039 | Open in IMG/M |
| 3300006904|Ga0075424_101993341 | All Organisms → cellular organisms → Bacteria | 613 | Open in IMG/M |
| 3300006969|Ga0075419_10288212 | All Organisms → cellular organisms → Bacteria | 1105 | Open in IMG/M |
| 3300009100|Ga0075418_10108957 | All Organisms → cellular organisms → Bacteria | 2941 | Open in IMG/M |
| 3300009147|Ga0114129_10662658 | All Organisms → cellular organisms → Bacteria | 1346 | Open in IMG/M |
| 3300009147|Ga0114129_13402529 | All Organisms → cellular organisms → Bacteria | 511 | Open in IMG/M |
| 3300009157|Ga0105092_10072860 | All Organisms → cellular organisms → Bacteria | 1862 | Open in IMG/M |
| 3300009162|Ga0075423_10994286 | All Organisms → cellular organisms → Bacteria | 891 | Open in IMG/M |
| 3300009792|Ga0126374_11193952 | All Organisms → cellular organisms → Bacteria | 609 | Open in IMG/M |
| 3300009809|Ga0105089_1011540 | All Organisms → cellular organisms → Bacteria | 1102 | Open in IMG/M |
| 3300009817|Ga0105062_1092223 | All Organisms → cellular organisms → Bacteria | 593 | Open in IMG/M |
| 3300009820|Ga0105085_1041753 | All Organisms → cellular organisms → Bacteria | 821 | Open in IMG/M |
| 3300010043|Ga0126380_10378411 | All Organisms → cellular organisms → Bacteria | 1042 | Open in IMG/M |
| 3300010043|Ga0126380_11638276 | All Organisms → cellular organisms → Bacteria | 576 | Open in IMG/M |
| 3300010046|Ga0126384_10597625 | All Organisms → cellular organisms → Bacteria | 965 | Open in IMG/M |
| 3300010046|Ga0126384_12124466 | All Organisms → cellular organisms → Bacteria | 539 | Open in IMG/M |
| 3300010046|Ga0126384_12314734 | All Organisms → cellular organisms → Bacteria | 519 | Open in IMG/M |
| 3300010047|Ga0126382_10478570 | All Organisms → cellular organisms → Bacteria | 995 | Open in IMG/M |
| 3300010047|Ga0126382_11311449 | All Organisms → cellular organisms → Bacteria | 655 | Open in IMG/M |
| 3300010047|Ga0126382_11357258 | All Organisms → cellular organisms → Bacteria | 646 | Open in IMG/M |
| 3300010335|Ga0134063_10645740 | All Organisms → cellular organisms → Bacteria | 543 | Open in IMG/M |
| 3300010358|Ga0126370_11066379 | All Organisms → cellular organisms → Bacteria | 742 | Open in IMG/M |
| 3300010359|Ga0126376_10843454 | All Organisms → cellular organisms → Bacteria | 899 | Open in IMG/M |
| 3300010366|Ga0126379_12522554 | All Organisms → cellular organisms → Bacteria | 612 | Open in IMG/M |
| 3300010376|Ga0126381_101207851 | All Organisms → cellular organisms → Bacteria | 1093 | Open in IMG/M |
| 3300010376|Ga0126381_102858927 | All Organisms → cellular organisms → Bacteria | 688 | Open in IMG/M |
| 3300010376|Ga0126381_103780981 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Patescibacteria group → unclassified Patescibacteria group → Patescibacteria group bacterium | 591 | Open in IMG/M |
| 3300010398|Ga0126383_12266619 | All Organisms → cellular organisms → Bacteria | 629 | Open in IMG/M |
| 3300011437|Ga0137429_1048270 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1243 | Open in IMG/M |
| 3300012039|Ga0137421_1121337 | All Organisms → cellular organisms → Bacteria | 762 | Open in IMG/M |
| 3300012199|Ga0137383_11317371 | All Organisms → cellular organisms → Bacteria | 514 | Open in IMG/M |
| 3300012202|Ga0137363_10616440 | All Organisms → cellular organisms → Bacteria | 916 | Open in IMG/M |
| 3300012205|Ga0137362_10630553 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 923 | Open in IMG/M |
| 3300012206|Ga0137380_10359998 | All Organisms → cellular organisms → Bacteria | 1297 | Open in IMG/M |
| 3300012208|Ga0137376_10947426 | All Organisms → cellular organisms → Bacteria | 738 | Open in IMG/M |
| 3300012208|Ga0137376_11032825 | All Organisms → cellular organisms → Bacteria | 704 | Open in IMG/M |
| 3300012285|Ga0137370_10918437 | All Organisms → cellular organisms → Bacteria | 541 | Open in IMG/M |
| 3300012351|Ga0137386_10977903 | All Organisms → cellular organisms → Bacteria | 603 | Open in IMG/M |
| 3300012353|Ga0137367_10660594 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Sumerlaeota → unclassified Candidatus Sumerlaeota → candidate division BRC1 bacterium HGW-BRC1-1 | 729 | Open in IMG/M |
| 3300012359|Ga0137385_10523486 | All Organisms → cellular organisms → Bacteria | 1002 | Open in IMG/M |
| 3300012361|Ga0137360_10946031 | All Organisms → cellular organisms → Bacteria | 743 | Open in IMG/M |
| 3300012362|Ga0137361_10592488 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1016 | Open in IMG/M |
| 3300012532|Ga0137373_10885308 | All Organisms → cellular organisms → Bacteria | 656 | Open in IMG/M |
| 3300012582|Ga0137358_10808744 | All Organisms → cellular organisms → Bacteria | 622 | Open in IMG/M |
| 3300012685|Ga0137397_10157513 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1684 | Open in IMG/M |
| 3300012685|Ga0137397_10644826 | All Organisms → cellular organisms → Bacteria | 787 | Open in IMG/M |
| 3300012685|Ga0137397_10646302 | All Organisms → cellular organisms → Bacteria | 786 | Open in IMG/M |
| 3300012922|Ga0137394_10074056 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 2841 | Open in IMG/M |
| 3300012930|Ga0137407_10200696 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1788 | Open in IMG/M |
| 3300012930|Ga0137407_12205859 | All Organisms → cellular organisms → Bacteria | 526 | Open in IMG/M |
| 3300012948|Ga0126375_10261774 | All Organisms → cellular organisms → Bacteria | 1178 | Open in IMG/M |
| 3300012948|Ga0126375_10359307 | Not Available | 1037 | Open in IMG/M |
| 3300012948|Ga0126375_10984067 | All Organisms → cellular organisms → Bacteria | 685 | Open in IMG/M |
| 3300012948|Ga0126375_11873316 | All Organisms → cellular organisms → Bacteria | 526 | Open in IMG/M |
| 3300012971|Ga0126369_13692525 | All Organisms → cellular organisms → Bacteria | 502 | Open in IMG/M |
| 3300012975|Ga0134110_10552133 | All Organisms → cellular organisms → Bacteria | 530 | Open in IMG/M |
| 3300016445|Ga0182038_10969198 | All Organisms → cellular organisms → Bacteria | 752 | Open in IMG/M |
| 3300021081|Ga0210379_10297631 | All Organisms → cellular organisms → Bacteria | 705 | Open in IMG/M |
| 3300021560|Ga0126371_10936149 | All Organisms → cellular organisms → Bacteria | 1009 | Open in IMG/M |
| 3300021560|Ga0126371_11394381 | All Organisms → cellular organisms → Bacteria | 832 | Open in IMG/M |
| 3300026524|Ga0209690_1209323 | All Organisms → cellular organisms → Bacteria | 617 | Open in IMG/M |
| 3300026537|Ga0209157_1263463 | Not Available | 660 | Open in IMG/M |
| 3300027527|Ga0209684_1059360 | All Organisms → cellular organisms → Bacteria | 593 | Open in IMG/M |
| 3300027646|Ga0209466_1027321 | All Organisms → cellular organisms → Bacteria | 1176 | Open in IMG/M |
| 3300027646|Ga0209466_1059158 | All Organisms → cellular organisms → Bacteria | 774 | Open in IMG/M |
| 3300027874|Ga0209465_10522837 | All Organisms → cellular organisms → Bacteria | 592 | Open in IMG/M |
| 3300027907|Ga0207428_10850277 | All Organisms → cellular organisms → Bacteria | 646 | Open in IMG/M |
| 3300027909|Ga0209382_10099401 | All Organisms → cellular organisms → Bacteria | 3411 | Open in IMG/M |
| 3300029636|Ga0222749_10774309 | All Organisms → cellular organisms → Bacteria | 525 | Open in IMG/M |
| 3300031474|Ga0170818_101929849 | All Organisms → cellular organisms → Bacteria | 511 | Open in IMG/M |
| 3300031720|Ga0307469_10179833 | All Organisms → cellular organisms → Bacteria | 1625 | Open in IMG/M |
| 3300031820|Ga0307473_11277561 | All Organisms → cellular organisms → Bacteria | 548 | Open in IMG/M |
| 3300032174|Ga0307470_10957046 | All Organisms → cellular organisms → Bacteria | 677 | Open in IMG/M |
| 3300032180|Ga0307471_101247836 | All Organisms → cellular organisms → Bacteria | 906 | Open in IMG/M |
| 3300032205|Ga0307472_100650349 | All Organisms → cellular organisms → Bacteria | 939 | Open in IMG/M |
| 3300033289|Ga0310914_11386368 | All Organisms → cellular organisms → Bacteria | 606 | Open in IMG/M |
| 3300033433|Ga0326726_10656927 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1010 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 23.30% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 19.42% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 12.62% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 8.74% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 5.83% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 4.85% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 2.91% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.91% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 2.91% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 1.94% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.94% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.94% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.94% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.94% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 0.97% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.97% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 0.97% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.97% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.97% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.97% |
| Switchgrass, Maize And Mischanthus Litter | Engineered → Solid Waste → Grass → Composting → Unclassified → Switchgrass, Maize And Mischanthus Litter | 0.97% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2170459016 | Litter degradation ZMR2 | Engineered | Open in IMG/M |
| 3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000596 | Amended soil microbial communities from Kansas Great Prairies, USA - Total DNA no BrdU F1.4TC | Environmental | Open in IMG/M |
| 3300000597 | Forest soil microbial communities from Amazon forest - 2010 replicate II A1 | Environmental | Open in IMG/M |
| 3300000837 | Forest soil microbial communities from Amazon forest - Pasture72 2010 replicate I A100 | Environmental | Open in IMG/M |
| 3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300003987 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleB_D2 | Environmental | Open in IMG/M |
| 3300004268 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 MoBio | Environmental | Open in IMG/M |
| 3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
| 3300005168 | Soil and rhizosphere microbial communities from Laval, Canada - mgLPC | Environmental | Open in IMG/M |
| 3300005294 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk Soil | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005447 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 | Environmental | Open in IMG/M |
| 3300005561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 | Environmental | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006194 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 | Host-Associated | Open in IMG/M |
| 3300006573 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLAC (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006846 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Host-Associated | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300006969 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 | Host-Associated | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009157 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm March2015 | Environmental | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300009809 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S2_30_40 | Environmental | Open in IMG/M |
| 3300009817 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_10_20 | Environmental | Open in IMG/M |
| 3300009820 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_50_60 | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300011437 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT736_2 | Environmental | Open in IMG/M |
| 3300012039 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT534_2 | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012353 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012532 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012975 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_11112015 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300021081 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_coex redo | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300026524 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 (SPAdes) | Environmental | Open in IMG/M |
| 3300026537 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 (SPAdes) | Environmental | Open in IMG/M |
| 3300027527 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 6 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300027646 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 30 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300027874 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300027907 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300029636 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031474 | Fir Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
| 3300033433 | Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MN | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| 2ZMR_00494890 | 2170459016 | Switchgrass, Maize And Mischanthus Litter | MFIETYYDDRATVPGSTSEPMIPYPELSGEELEVWRKYLPMRRQIRNLD |
| INPhiseqgaiiFebDRAFT_1005742132 | 3300000364 | Soil | MFIETYYDERAAVPGSTSEPMIPYPELLGEELAVWEEYL |
| KanNP_Total_noBrdU_T14TCDRAFT_10014674 | 3300000596 | Soil | MFIETYYDDRAAVPGSTSEPMIPYPELSGEKLTVWQEYLPIKRPIRNLY |
| KanNP_Total_noBrdU_T14TCDRAFT_10047741 | 3300000596 | Soil | MFIETYYDDRATVPGSTSEPMIPYPELSGEELEVWRKYLPMRRQIRN |
| AF_2010_repII_A1DRAFT_101273593 | 3300000597 | Forest Soil | MFIETYYDERATVPGSTNEPMIPYPELSGEELEVWRKYLPIRRPIR |
| AP72_2010_repI_A100DRAFT_10326123 | 3300000837 | Forest Soil | MFIETYYDERATVPGSTNEPMIPYPELSGEELEVWR |
| JGI1027J12803_1025818431 | 3300000955 | Soil | MFIETYYDERAPVPGSTIERMIPYPELSGEELTVWQEYLPIN |
| Ga0055471_100845693 | 3300003987 | Natural And Restored Wetlands | MFIETYYDDRAALPAGTNVPQIPYPELSGEALTVWRRYLPMRRQIRNLH |
| Ga0066398_101632401 | 3300004268 | Tropical Forest Soil | MFIETYYDDRAAVPASTGEPIIPFPELSGDELTVWRNYLP |
| Ga0066395_107303711 | 3300004633 | Tropical Forest Soil | MFIQTYYDDRAAVSGSASEPIIPHPELSGEELKVWRNYLPIR |
| Ga0066809_102402502 | 3300005168 | Soil | MFIETYYDERAAVPGSTSEPMIPYPELLGEELAVWQEYLP |
| Ga0065705_109577681 | 3300005294 | Switchgrass Rhizosphere | MFIETYYDERAAVPVTTSEPMIPYPELSGEELAVWQAYLPIRREIRKP |
| Ga0066388_1018472782 | 3300005332 | Tropical Forest Soil | MFIETYYDDRVAVSGSASEPIIPYPELSGEELKVWRNYLPIRREIRNLYTQRF |
| Ga0070708_1003235981 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MFIETYYDERVPVPGSTSEPLIPYPELSGEELAVWQEYLPIRSDM |
| Ga0066689_109007832 | 3300005447 | Soil | MFIETYYDERVPVPATPREPMMPYPELSGEELTVWRKYLP |
| Ga0066699_102998412 | 3300005561 | Soil | MFIETYYDETAAVPATTSEPTIPYPELSGEELTVWRKYLPIRRQVENLRS |
| Ga0066905_1020998502 | 3300005713 | Tropical Forest Soil | MFVEIYYDDRAPVPGSASEPIIPYLELSGEQLTVWRNYLPM |
| Ga0066903_1056291031 | 3300005764 | Tropical Forest Soil | MFIETYYDERATVPGSTNEPMIPYPELSGEELEVWRKYL |
| Ga0070716_1013566361 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | MFIETYYDERAPVPGSTSEPLIPYPELSGEELAVWQ |
| Ga0070712_1006108692 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MFIETYYDERAAVPPTTSEPMIPYPELSGEELAVWQEYLP |
| Ga0075427_100764071 | 3300006194 | Populus Rhizosphere | MFIETYYDERAAVPGSTSEPMIPYPELSGEELAVWQEYLPMRREIRNLY |
| Ga0074055_112313371 | 3300006573 | Soil | MFIETYYDERAAVPVITSEPMIPYPELSGEELAVWQEYLP |
| Ga0075430_1006978651 | 3300006846 | Populus Rhizosphere | MFIETYYDERAAVPASTSEPVIPYPELSGEELAVWQEYLPMRREIRK |
| Ga0075433_112267181 | 3300006852 | Populus Rhizosphere | MFIETYYDERAAVPGSTSEPVIPYPELSGEELAVWQEYLPMRREIRN |
| Ga0075433_119287362 | 3300006852 | Populus Rhizosphere | MFKETYYDDRAAVPGSSSERMIPYPELSGEELTVWQEYLPIKRPIRNL |
| Ga0075425_1008574351 | 3300006854 | Populus Rhizosphere | MFIETYYDERAPVPGSTSEPLIPYPELSGQELAVWQEYLPVRREMRNLYS |
| Ga0075424_1019933411 | 3300006904 | Populus Rhizosphere | MFIETYYDERAAVPATTSEPMIPYPELLGEELAVWEEYLPMRREIRNLY |
| Ga0075419_102882121 | 3300006969 | Populus Rhizosphere | MFIETYYDERAAVPGSTSEPMIPYPELSGEELAVWQEYLPMRRE |
| Ga0075418_101089573 | 3300009100 | Populus Rhizosphere | MFIETYYDERAAVPGSTSEPMIPYPELSGEELAVWQEYLPMRREIR |
| Ga0114129_106626583 | 3300009147 | Populus Rhizosphere | MFIETYYDDRATVPGSTSEPMIPYPELSGQELEVWRKYL |
| Ga0114129_134025291 | 3300009147 | Populus Rhizosphere | MFIETYYDERVPVPGSTSEPLIPYPELSGEELTEE* |
| Ga0105092_100728603 | 3300009157 | Freshwater Sediment | MFIETYYDDRAVPGSTSEPMIPYPELSGEKLTVWQEYLPIKRPIRNLSSPF |
| Ga0075423_109942862 | 3300009162 | Populus Rhizosphere | MFIETYYDERAPVPGSTSEPLIPYPELSGQELAVWQEYLPVRREMRNLY |
| Ga0126374_111939521 | 3300009792 | Tropical Forest Soil | MFIETYYDDRAPVPGSTSEPIIPYPELSGEQLTMWRNYLPMRREIRNLD |
| Ga0105089_10115401 | 3300009809 | Groundwater Sand | MFIETYYDDRAAVPGSTSEPMIPYPELSGEKLTVWQEYLPIKR |
| Ga0105062_10922231 | 3300009817 | Groundwater Sand | MFIETYYDDRATVPGSTSEPMIPYPELSGEELEVWRKYLPMRRQIRNLDSR |
| Ga0105085_10417533 | 3300009820 | Groundwater Sand | MFIETYYDDRAAVPGSTSEPVIPYPELSGEELTVWRKYLPMRRQIRKVS |
| Ga0126380_103784111 | 3300010043 | Tropical Forest Soil | MFIETYYDERAAVPASTSEPMIPYPELSGEELAVWQEYLPM |
| Ga0126380_116382761 | 3300010043 | Tropical Forest Soil | MFIETYHDDRATALGSTSEPMIPYPELSGEELEVWRKYLPLRRQIRN |
| Ga0126384_105976252 | 3300010046 | Tropical Forest Soil | MFIETYYDDRAAVSGSASEPIIPYPELSGEELKVWRNYLPIRREIRNLYT |
| Ga0126384_121244662 | 3300010046 | Tropical Forest Soil | MFIETYHDDRAAAPGSTSEPIIPFPELSGDELTVWRNYLP |
| Ga0126384_123147341 | 3300010046 | Tropical Forest Soil | MFIETYYDERATVPGSTNEPMIPYPELSGEELEVWRKYLPIRRP |
| Ga0126382_104785702 | 3300010047 | Tropical Forest Soil | MFIETYYDDRAPVPGSASEPIIPYPELSGEQLTVWRNYLPMRR |
| Ga0126382_113114491 | 3300010047 | Tropical Forest Soil | MFTETYHDNRAAVPSGSSEPMISILRIVGEALTVWQEYLPIRRPIRNLY |
| Ga0126382_113572582 | 3300010047 | Tropical Forest Soil | MFIETYYDERALVPCSMSEPVIPYPELSGEELTAWRDYLPIRRPVA |
| Ga0134063_106457401 | 3300010335 | Grasslands Soil | MFIETYYDDRAAAVSGSTREPTIPYPELSGEELTV* |
| Ga0126370_110663792 | 3300010358 | Tropical Forest Soil | MFIETYYDYRAPVPGGTSEPIIPYPELSGEQLTVWRNYLPMRREIRNLY |
| Ga0126376_108434541 | 3300010359 | Tropical Forest Soil | MFIETYHDERAAVPGSTSEPVIPYPELSGEELTVW |
| Ga0126378_107919502 | 3300010361 | Tropical Forest Soil | MFIETYHDDRAAVPASTSEPIIPYPELSGEELTMWRNYLPI |
| Ga0126379_125225541 | 3300010366 | Tropical Forest Soil | MFIETYHDDRATALGSTSEPMIPYPELSGEELEVWRKYLPLRRQIRNL |
| Ga0126381_1012078511 | 3300010376 | Tropical Forest Soil | MFIETYYDDRATVRGSTSEPMIPYPELSGEELEVWRKYLPIRRPIRNLDSR |
| Ga0126381_1028589271 | 3300010376 | Tropical Forest Soil | MFIETYYDERALVPCSMSEPVIPYPELSGEELTAWRDYLPIRRPVANFASWFN |
| Ga0126381_1037809812 | 3300010376 | Tropical Forest Soil | MFIETYYDERAAVLTSTSEPMIPYPELSGKELAVWQEYLPI |
| Ga0126383_122666191 | 3300010398 | Tropical Forest Soil | MFIETYHDDRATALGSTGEPIIPYPELSGEELEVWRKYLPLRR |
| Ga0137429_10482704 | 3300011437 | Soil | MFIETYYDDRATVPAGTSAPPIPYPELSGDELTVWQQYLPM |
| Ga0137421_11213373 | 3300012039 | Soil | MFIETYYDDRATVPAGTSAPPIPYPELSGDELTVW |
| Ga0137383_113173711 | 3300012199 | Vadose Zone Soil | MFIETYYDERAAVPATTSEPMIPYPELLGEELAVWQEYLPMRREIRKPFSR |
| Ga0137363_106164402 | 3300012202 | Vadose Zone Soil | MFIETYYDERAAVFASTSEPMIPYPELSGEELTVWQEYLPMRRQI |
| Ga0137362_106305531 | 3300012205 | Vadose Zone Soil | MFIETYYDDRAAVSGNTGEPVIPYPELSGEELTVWRNYL |
| Ga0137380_103599982 | 3300012206 | Vadose Zone Soil | MFIETYYDETAAVPATTSEPTIPYPELSGEELTVWRKYLPIRRQVENLRS* |
| Ga0137376_109474263 | 3300012208 | Vadose Zone Soil | MFIETYYDERAAVPATTSEPMIPYPELLGEELAVWQEYLPMRREIRK |
| Ga0137376_110328251 | 3300012208 | Vadose Zone Soil | MFIETYYDDRAAVSGSTSEPTIPYPELSGEELTVWRK |
| Ga0137370_109184372 | 3300012285 | Vadose Zone Soil | MFIETYYDDRAAVPGGTSEPIIPYPELSGEKLTVWQEY |
| Ga0137386_109779031 | 3300012351 | Vadose Zone Soil | MFIETYYDDRAAAVSDSTSEPMIPYPELSGEKLTVW |
| Ga0137367_106605941 | 3300012353 | Vadose Zone Soil | MFIETYYDERAALPASTSEPMIPYPELSGEELTVWQEY |
| Ga0137385_105234861 | 3300012359 | Vadose Zone Soil | MFIETYYDDRAAVPGSTSEPMIPYPELSGEKLTV* |
| Ga0137360_109460311 | 3300012361 | Vadose Zone Soil | MFIETYYDERAPVPGNTSEPMIPYPELSGEALTVWRKYLPMRREIENLDSR |
| Ga0137361_105924881 | 3300012362 | Vadose Zone Soil | MFIETYYDDRAAVPGSTSEPMIPYPELSGEKLAVWQEYLPIRRPI |
| Ga0137373_108853081 | 3300012532 | Vadose Zone Soil | MFIETYYDERAPVHGSTSEPVIPYPELSGEALEVWRKYLPMRRPIENF |
| Ga0137358_108087441 | 3300012582 | Vadose Zone Soil | MFVETYYDARVLVPVGGNEPLIPYPELRGEELTVWRKYLPKQTPLENLRF |
| Ga0137397_101575133 | 3300012685 | Vadose Zone Soil | MFIETYYDERAAVPGSTSEPMIPYPELSGEELTVWRE |
| Ga0137397_106448261 | 3300012685 | Vadose Zone Soil | MFIETYYDERAAVPVTTSEPMIPYPELSGEELAVWQE |
| Ga0137397_106463021 | 3300012685 | Vadose Zone Soil | MFKETYYDDRAAVPGSLSERMIPYPELSGEELTVARILAD* |
| Ga0137394_100740569 | 3300012922 | Vadose Zone Soil | MFIETYYDDRATLPSSTSGPMIPYPELSGGELEVWRKYLPIR |
| Ga0137407_102006962 | 3300012930 | Vadose Zone Soil | MFIETYYDERAAVPASTSEPMIPYPELSGEELTVWQEYLPIR |
| Ga0137407_122058591 | 3300012930 | Vadose Zone Soil | MFIETYHDDRATVPGSTSEPMIPYPELSGEELEVWRKYLP |
| Ga0126375_102617742 | 3300012948 | Tropical Forest Soil | MFIETYYDDRAPVLGSTSEPVIPYPELSGEELRVWQKYLPMRRGIR |
| Ga0126375_103593072 | 3300012948 | Tropical Forest Soil | MFIETYYDDRAAVSGSASEPIIPYPELSGEELKVWRNYLPIRREIRNLYTQ |
| Ga0126375_109840672 | 3300012948 | Tropical Forest Soil | MFIETYYDDRVAVSGSASEPIIPYPELSGEELKVWRNYLPIRREIRNLY |
| Ga0126375_118733161 | 3300012948 | Tropical Forest Soil | MFIETYHDDRATVPARTSEPIIPYPELSGEELTVWRNYL |
| Ga0126369_136925251 | 3300012971 | Tropical Forest Soil | MFIETYYDDRAPVPGSASEPIIPYPELSGEQLTVWRNYLPMRREI |
| Ga0134110_105521332 | 3300012975 | Grasslands Soil | MFIETYYDERVPVPAMPRELMMFYPELSGEELTVWRKYLP |
| Ga0182038_109691981 | 3300016445 | Soil | MFIETYYDQRAPIPGSTSERTIPYPELSGEELAAWQEYLPIKREMGNLHSL |
| Ga0210379_102976311 | 3300021081 | Groundwater Sediment | MFIETYYDDRAAVPASTSERMIPYPELSGEKLTVWQEYLPIKRPIRNLYSP |
| Ga0126371_109361492 | 3300021560 | Tropical Forest Soil | MFIETYYDERAPVPSSTSEPVIPYPELLGEELTVWRNYLPMRREIKNLYTQF |
| Ga0126371_113943812 | 3300021560 | Tropical Forest Soil | MFIETYYDERATVRGSTTEPMIPYPELSGEELEVWRKYLPIRRPI |
| Ga0209690_12093232 | 3300026524 | Soil | MFIETYYDDRAAVPGSTSEPMIPYPELSGEKLTVWQE |
| Ga0209157_12634631 | 3300026537 | Soil | MFIETYYDDRAVATSTSEPVIPYPELSGEELTVWQKYLPIR |
| Ga0209684_10593601 | 3300027527 | Tropical Forest Soil | MFIETYYDERAAVLMSASEPMIPYPELSGKELAVWREYLPIRREMR |
| Ga0209466_10273211 | 3300027646 | Tropical Forest Soil | MFIETYYDDRVAVSGSASEPIIPYPELSGEELKVWRNYLPIRREIRNL |
| Ga0209466_10591581 | 3300027646 | Tropical Forest Soil | MFIETYYDDRAAVLGSASEPIIPYPELSGEELKVWRNYLPIRREIRNL |
| Ga0209465_105228371 | 3300027874 | Tropical Forest Soil | MFIETYYDDRAPVPGSASEPIIPYPELSGEQLTVWRNYLPMRREIKNLC |
| Ga0207428_108502771 | 3300027907 | Populus Rhizosphere | MFIETYYDERAAVPGSTSEPVIPYPELFGEELTVWREYLPM |
| Ga0209382_100994011 | 3300027909 | Populus Rhizosphere | MFKETYYDDRAAIPSSLSERMIPYPELSGEALTVWREYL |
| Ga0222749_107743091 | 3300029636 | Soil | MFIETYYDDRAALPGSTSEPEIPYPELSGEALTVWQKY |
| Ga0170818_1019298491 | 3300031474 | Forest Soil | MFIETYYDERTAVPASTNEPMIPYPELSGEELTVKKKIDKSR |
| Ga0307469_101798334 | 3300031720 | Hardwood Forest Soil | MFIETYYDDRAAVPGSTSETMILYPELSGEKLAVRQEYLAIRRDR |
| Ga0307473_112775611 | 3300031820 | Hardwood Forest Soil | MFIETYYDERAAVPGSTSEPMIPYPELLGEELAVWQEYLPIRREIRKP |
| Ga0307470_109570461 | 3300032174 | Hardwood Forest Soil | MFIETYYDERAPVPGSKSEPFIPYPELSGEELAVWQEYLPVRREMKNLYSP |
| Ga0307471_1012478361 | 3300032180 | Hardwood Forest Soil | MFIETYHDDRATVPGSTSEPMIPYPELSGEELQVWRK |
| Ga0307472_1006503492 | 3300032205 | Hardwood Forest Soil | MFIETYYDERAPVPGSTSEPLIPYPELFGEELAVWQE |
| Ga0310914_113863681 | 3300033289 | Soil | MFIETYYDERAPVPGSTSERMIPYPELSGEELTVWRKYLP |
| Ga0326726_106569272 | 3300033433 | Peat Soil | MFIETYYDDRATVGGASEPMIPYPELSGEELEVWRKYLPMRREIRNLDSRL |
| ⦗Top⦘ |