NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F099551

Metagenome / Metatranscriptome Family F099551

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F099551
Family Type Metagenome / Metatranscriptome
Number of Sequences 103
Average Sequence Length 43 residues
Representative Sequence MAEQHLCQRHGRPAVASRVRLRPDGTQEVEYLCEIDLAEERM
Number of Associated Samples 87
Number of Associated Scaffolds 103

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 100.00 %
% of genes near scaffold ends (potentially truncated) 97.09 %
% of genes from short scaffolds (< 2000 bps) 92.23 %
Associated GOLD sequencing projects 84
AlphaFold2 3D model prediction Yes
3D model pTM-score0.55

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (95.146 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil
(26.214 % of family members)
Environment Ontology (ENVO) Unclassified
(33.981 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(42.718 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 11.43%    β-sheet: 20.00%    Coil/Unstructured: 68.57%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.55
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 103 Family Scaffolds
PF00011HSP20 28.16
PF01638HxlR 8.74
PF13191AAA_16 3.88
PF00583Acetyltransf_1 3.88
PF01972SDH_sah 3.88
PF01738DLH 1.94
PF00027cNMP_binding 1.94
PF00694Aconitase_C 1.94
PF01545Cation_efflux 1.94
PF13527Acetyltransf_9 0.97
PF13426PAS_9 0.97
PF14417MEDS 0.97
PF00440TetR_N 0.97
PF01636APH 0.97
PF08450SGL 0.97
PF13581HATPase_c_2 0.97
PF12681Glyoxalase_2 0.97
PF00733Asn_synthase 0.97
PF03949Malic_M 0.97
PF00126HTH_1 0.97

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 103 Family Scaffolds
COG0071Small heat shock protein IbpA, HSP20 familyPosttranslational modification, protein turnover, chaperones [O] 28.16
COG1733DNA-binding transcriptional regulator, HxlR familyTranscription [K] 8.74
COG0616Periplasmic serine protease, ClpP classPosttranslational modification, protein turnover, chaperones [O] 7.77
COG0053Divalent metal cation (Fe/Co/Zn/Cd) efflux pumpInorganic ion transport and metabolism [P] 1.94
COG1230Co/Zn/Cd efflux system componentInorganic ion transport and metabolism [P] 1.94
COG3965Predicted Co/Zn/Cd cation transporter, cation efflux familyInorganic ion transport and metabolism [P] 1.94
COG0281Malic enzymeEnergy production and conversion [C] 0.97
COG0686Alanine dehydrogenase (includes sporulation protein SpoVN)Amino acid transport and metabolism [E] 0.97
COG3386Sugar lactone lactonase YvrECarbohydrate transport and metabolism [G] 0.97
COG3391DNA-binding beta-propeller fold protein YncEGeneral function prediction only [R] 0.97

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms96.12 %
UnclassifiedrootN/A3.88 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000033|ICChiseqgaiiDRAFT_c2391909All Organisms → cellular organisms → Bacteria2330Open in IMG/M
3300000156|NODE_c0341274All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium651Open in IMG/M
3300000651|AP72_2010_repI_A10DRAFT_1057694All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium515Open in IMG/M
3300000890|JGI11643J12802_10311834All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium574Open in IMG/M
3300000955|JGI1027J12803_106326788All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium719Open in IMG/M
3300002075|JGI24738J21930_10114079All Organisms → cellular organisms → Bacteria584Open in IMG/M
3300002244|JGI24742J22300_10030072All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium946Open in IMG/M
3300004006|Ga0055453_10088954All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria897Open in IMG/M
3300004156|Ga0062589_102598081All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria525Open in IMG/M
3300004479|Ga0062595_101718171Not Available592Open in IMG/M
3300005434|Ga0070709_11156262All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria621Open in IMG/M
3300005435|Ga0070714_101340597All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria698Open in IMG/M
3300005439|Ga0070711_100032162All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia3486Open in IMG/M
3300005451|Ga0066681_10409737All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria833Open in IMG/M
3300005545|Ga0070695_101166352All Organisms → cellular organisms → Bacteria632Open in IMG/M
3300005548|Ga0070665_101622032All Organisms → cellular organisms → Bacteria655Open in IMG/M
3300005549|Ga0070704_100319456All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1300Open in IMG/M
3300005561|Ga0066699_10896101Not Available619Open in IMG/M
3300005561|Ga0066699_11191992All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium523Open in IMG/M
3300005615|Ga0070702_100708956All Organisms → cellular organisms → Bacteria768Open in IMG/M
3300006051|Ga0075364_10114281All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon1804Open in IMG/M
3300006178|Ga0075367_11080754All Organisms → cellular organisms → Bacteria → Terrabacteria group513Open in IMG/M
3300006755|Ga0079222_11113944All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria695Open in IMG/M
3300006800|Ga0066660_11197785All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria596Open in IMG/M
3300006904|Ga0075424_102805565All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Gaiellales → Gaiellaceae → Gaiella → unclassified Gaiella → Gaiella sp. SCGC AG-212-M14507Open in IMG/M
3300006914|Ga0075436_101530968All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium507Open in IMG/M
3300009094|Ga0111539_12943197All Organisms → cellular organisms → Bacteria → Terrabacteria group551Open in IMG/M
3300009098|Ga0105245_11138131All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium827Open in IMG/M
3300009156|Ga0111538_11199596All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria959Open in IMG/M
3300009840|Ga0126313_10441162All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1037Open in IMG/M
3300010041|Ga0126312_10319532All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1097Open in IMG/M
3300010042|Ga0126314_10912983All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria649Open in IMG/M
3300010042|Ga0126314_11044378All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium607Open in IMG/M
3300010044|Ga0126310_11712549All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium522Open in IMG/M
3300010371|Ga0134125_12673574All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria543Open in IMG/M
3300010400|Ga0134122_10357153All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1275Open in IMG/M
3300010400|Ga0134122_11324916All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria729Open in IMG/M
3300011332|Ga0126317_11041871All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria593Open in IMG/M
3300011999|Ga0120148_1078473All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium647Open in IMG/M
3300012356|Ga0137371_10913332All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium667Open in IMG/M
3300012925|Ga0137419_10091812All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Rubrobacterales → Rubrobacteraceae → environmental samples → uncultured Rubrobacteraceae bacterium2080Open in IMG/M
3300012937|Ga0162653_100009157All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1159Open in IMG/M
3300012975|Ga0134110_10204276All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium830Open in IMG/M
3300015241|Ga0137418_10510225All Organisms → cellular organisms → Bacteria960Open in IMG/M
3300015356|Ga0134073_10044695All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1167Open in IMG/M
3300015372|Ga0132256_101981202All Organisms → cellular organisms → Bacteria → Terrabacteria group689Open in IMG/M
3300018027|Ga0184605_10403526All Organisms → cellular organisms → Bacteria → Terrabacteria group610Open in IMG/M
3300018066|Ga0184617_1077358All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium896Open in IMG/M
3300018072|Ga0184635_10001351All Organisms → cellular organisms → Bacteria7061Open in IMG/M
3300018076|Ga0184609_10345519All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium694Open in IMG/M
3300018081|Ga0184625_10578794All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria554Open in IMG/M
3300018468|Ga0066662_11717192All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria657Open in IMG/M
3300019279|Ga0184642_1052694All Organisms → cellular organisms → Bacteria → Terrabacteria group1412Open in IMG/M
3300019279|Ga0184642_1062545All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria680Open in IMG/M
3300019279|Ga0184642_1322263All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria659Open in IMG/M
3300019867|Ga0193704_1053250All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium788Open in IMG/M
3300019890|Ga0193728_1159164All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria986Open in IMG/M
3300020002|Ga0193730_1098805All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria814Open in IMG/M
3300020002|Ga0193730_1154626All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium603Open in IMG/M
3300021080|Ga0210382_10289197All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → unclassified Pseudonocardiaceae → Pseudonocardiaceae bacterium720Open in IMG/M
3300021080|Ga0210382_10327774All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium675Open in IMG/M
3300021151|Ga0179584_1113385All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria572Open in IMG/M
3300023067|Ga0247743_1048827All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium609Open in IMG/M
3300024251|Ga0247679_1037032All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria820Open in IMG/M
3300025904|Ga0207647_10668511All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium568Open in IMG/M
3300025921|Ga0207652_10616171All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria972Open in IMG/M
3300025931|Ga0207644_11552747All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium555Open in IMG/M
3300025949|Ga0207667_10423576All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae1354Open in IMG/M
3300025949|Ga0207667_11493994All Organisms → cellular organisms → Bacteria → Terrabacteria group647Open in IMG/M
3300025996|Ga0208777_1020487All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium567Open in IMG/M
3300027907|Ga0207428_10860927All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium642Open in IMG/M
3300027907|Ga0207428_11181131All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium533Open in IMG/M
3300027993|Ga0247749_1035548All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium578Open in IMG/M
3300028708|Ga0307295_10008219All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2437Open in IMG/M
3300028719|Ga0307301_10253387All Organisms → cellular organisms → Bacteria575Open in IMG/M
3300028744|Ga0307318_10180032Not Available729Open in IMG/M
3300028768|Ga0307280_10161115All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Gaiellales → Gaiellaceae → Gaiella → unclassified Gaiella → Gaiella sp. SCGC AG-212-M14779Open in IMG/M
3300028778|Ga0307288_10482654All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium511Open in IMG/M
3300028787|Ga0307323_10343018All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria535Open in IMG/M
3300028791|Ga0307290_10020539All Organisms → cellular organisms → Bacteria2302Open in IMG/M
3300028791|Ga0307290_10194964All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium742Open in IMG/M
3300028791|Ga0307290_10339990All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria549Open in IMG/M
3300028809|Ga0247824_10847020All Organisms → cellular organisms → Bacteria568Open in IMG/M
3300028814|Ga0307302_10058132All Organisms → cellular organisms → Bacteria → Terrabacteria group1806Open in IMG/M
3300028814|Ga0307302_10625179All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria535Open in IMG/M
3300028824|Ga0307310_10295013All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium788Open in IMG/M
3300028872|Ga0307314_10019691All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1532Open in IMG/M
3300028876|Ga0307286_10021103All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium2100Open in IMG/M
3300028876|Ga0307286_10056695All Organisms → cellular organisms → Bacteria1335Open in IMG/M
3300028884|Ga0307308_10125814All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1225Open in IMG/M
3300030785|Ga0102757_10003013All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria674Open in IMG/M
3300030785|Ga0102757_10050421All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1429Open in IMG/M
3300030830|Ga0308205_1026582All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria691Open in IMG/M
3300030830|Ga0308205_1066062All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria504Open in IMG/M
3300030903|Ga0308206_1157709All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales → Actinomycetaceae → Actinomyces → unclassified Actinomyces → Actinomyces sp.551Open in IMG/M
3300030905|Ga0308200_1142951All Organisms → cellular organisms → Bacteria → Proteobacteria547Open in IMG/M
3300030905|Ga0308200_1167380All Organisms → cellular organisms → Bacteria518Open in IMG/M
3300031092|Ga0308204_10124699All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria738Open in IMG/M
3300031455|Ga0307505_10236945All Organisms → cellular organisms → Bacteria847Open in IMG/M
3300031720|Ga0307469_12081279All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium552Open in IMG/M
3300032211|Ga0310896_10666321All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria586Open in IMG/M
3300033550|Ga0247829_10808731Not Available780Open in IMG/M
3300034818|Ga0373950_0004089All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2124Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil26.21%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil6.80%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere5.83%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment4.85%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment4.85%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil4.85%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere4.85%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil3.88%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere3.88%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil2.91%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil2.91%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil2.91%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil1.94%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil1.94%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil1.94%
Populus EndosphereHost-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere1.94%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere1.94%
SoilEnvironmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil0.97%
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands0.97%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil0.97%
PermafrostEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost0.97%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil0.97%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil0.97%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil0.97%
Rice Paddy SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil0.97%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere0.97%
Agricultural SoilEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil0.97%
SoilEnvironmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil0.97%
Corn, Switchgrass And Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere0.97%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.97%
Rhizosphere SoilHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere Soil0.97%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere0.97%
Sugar Cane Bagasse Incubating BioreactorEngineered → Solid Waste → Grass → Composting → Bioreactor → Sugar Cane Bagasse Incubating Bioreactor0.97%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000033Soil microbial communities from Great Prairies - Iowa, Continuous Corn soilEnvironmentalOpen in IMG/M
3300000156Sugar cane bagasse incubating bioreactor microbial communities from Sao Carlos, Brazil, that are aerobic and semianaerobicEngineeredOpen in IMG/M
3300000651Forest soil microbial communities from Amazon forest - Pasture72 2010 replicate I A10EnvironmentalOpen in IMG/M
3300000890Soil microbial communities from Great Prairies - Iowa, Continuous Corn soilEnvironmentalOpen in IMG/M
3300000955Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300002075Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4Host-AssociatedOpen in IMG/M
3300002244Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1Host-AssociatedOpen in IMG/M
3300004006Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Goodyear_PhragA_D2EnvironmentalOpen in IMG/M
3300004156Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1EnvironmentalOpen in IMG/M
3300004479Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAsEnvironmentalOpen in IMG/M
3300005434Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaGEnvironmentalOpen in IMG/M
3300005435Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaGEnvironmentalOpen in IMG/M
3300005439Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaGEnvironmentalOpen in IMG/M
3300005451Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130EnvironmentalOpen in IMG/M
3300005545Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaGEnvironmentalOpen in IMG/M
3300005548Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaGHost-AssociatedOpen in IMG/M
3300005549Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaGEnvironmentalOpen in IMG/M
3300005561Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148EnvironmentalOpen in IMG/M
3300005615Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaGEnvironmentalOpen in IMG/M
3300006051Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4Host-AssociatedOpen in IMG/M
3300006178Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2Host-AssociatedOpen in IMG/M
3300006755Agricultural soil microbial communities from Georgia to study Nitrogen management - GA PlitterEnvironmentalOpen in IMG/M
3300006800Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109EnvironmentalOpen in IMG/M
3300006904Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3Host-AssociatedOpen in IMG/M
3300006914Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5Host-AssociatedOpen in IMG/M
3300009094Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009098Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaGHost-AssociatedOpen in IMG/M
3300009156Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009840Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105AEnvironmentalOpen in IMG/M
3300010041Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot104AEnvironmentalOpen in IMG/M
3300010042Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105BEnvironmentalOpen in IMG/M
3300010044Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot60EnvironmentalOpen in IMG/M
3300010371Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1EnvironmentalOpen in IMG/M
3300010400Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2EnvironmentalOpen in IMG/M
3300011332Soil microbial communities from California, USA to study soil gas exchange rates - SR-CA-SC2 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300011999Permafrost microbial communities from Nunavut, Canada - A28_65cm_6MEnvironmentalOpen in IMG/M
3300012356Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012925Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012937Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t5i015EnvironmentalOpen in IMG/M
3300012975Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_11112015EnvironmentalOpen in IMG/M
3300015241Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300015356Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300018027Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_coexEnvironmentalOpen in IMG/M
3300018066Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5_b1EnvironmentalOpen in IMG/M
3300018072Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b2EnvironmentalOpen in IMG/M
3300018076Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_coexEnvironmentalOpen in IMG/M
3300018081Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b1EnvironmentalOpen in IMG/M
3300018468Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111EnvironmentalOpen in IMG/M
3300019279Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019867Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3m1EnvironmentalOpen in IMG/M
3300019890Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c1EnvironmentalOpen in IMG/M
3300020002Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1a1EnvironmentalOpen in IMG/M
3300021080Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_coex redoEnvironmentalOpen in IMG/M
3300021151Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_06_16RNAfungal (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300023067Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S221-509R-5EnvironmentalOpen in IMG/M
3300024251Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK20EnvironmentalOpen in IMG/M
3300025904Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025921Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025931Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025949Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025996Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_0N_301 (SPAdes)EnvironmentalOpen in IMG/M
3300027907Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes)Host-AssociatedOpen in IMG/M
3300027993Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S199-509C-5EnvironmentalOpen in IMG/M
3300028708Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_152EnvironmentalOpen in IMG/M
3300028719Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_182EnvironmentalOpen in IMG/M
3300028744Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_367EnvironmentalOpen in IMG/M
3300028768Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_119EnvironmentalOpen in IMG/M
3300028778Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_142EnvironmentalOpen in IMG/M
3300028787Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_381EnvironmentalOpen in IMG/M
3300028791Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_144EnvironmentalOpen in IMG/M
3300028809Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_PalmiticAcid_Day48EnvironmentalOpen in IMG/M
3300028814Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_183EnvironmentalOpen in IMG/M
3300028824Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_197EnvironmentalOpen in IMG/M
3300028872Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_204EnvironmentalOpen in IMG/M
3300028876Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_140EnvironmentalOpen in IMG/M
3300028884Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_195EnvironmentalOpen in IMG/M
3300030785Forest soil microbial communities from USA, for metatranscriptomics studies - Jemez Pines PI 5C (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030830Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_368 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030903Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_369 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030905Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_204 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031092Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_367 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031455Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 23_SEnvironmentalOpen in IMG/M
3300031720Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515EnvironmentalOpen in IMG/M
3300032211Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D1EnvironmentalOpen in IMG/M
3300033550Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day4EnvironmentalOpen in IMG/M
3300034818Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3Host-AssociatedOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
ICChiseqgaiiDRAFT_239190913300000033SoilMAVQHRCRRHGRPAVASRVRLLPDGTQETEYLCEIDLAEERXSSGF
NODE_034127413300000156Sugar Cane Bagasse Incubating BioreactorMAEQHLCQRHGRPAIASRVRLRPDGTQEIEYLCEIDL
AP72_2010_repI_A10DRAFT_105769423300000651Forest SoilMAEQHLCQRHGRPAVASRVRLRPDGTQEVEYLCEIDLAEERMSGRLGGG
JGI11643J12802_1031183413300000890SoilMAEQHLCQRHGRPAVASRVRMRPDGTQEVEYLCEIDLAEERMSGRLGRG
JGI1027J12803_10632678813300000955SoilMAVDQPVCQRHGRPAVASRVRRRPDGTQEVEYLCEIDLAEEQMSS
JGI24738J21930_1011407923300002075Corn RhizosphereMAEQHLCQRHGRPAVASRVRLRPDGTQEVEYLCEIDLAEERMS
JGI24742J22300_1003007213300002244Corn, Switchgrass And Miscanthus RhizosphereMAVDQPVCQRHGRPAVASRVRLRPDGTQEVEYLCEIDLAEEQMSSRFG
Ga0055453_1008895433300004006Natural And Restored WetlandsMAVEHLCQRHGRPAVASRVRLRPDGTQETEYLCELDLAEERMSSRLD
Ga0062589_10259808113300004156SoilMATEQHYCERHHRPAVASRVRLRADGSQEVEYLCELDLAEERLSSRGL
Ga0062595_10171817123300004479SoilVAAEGPLCERHHRPAVASRVRILPDGTRETEYLCEIDLAEE
Ga0070709_1115626223300005434Corn, Switchgrass And Miscanthus RhizosphereMAVEHRCKRHGRPAVASRVRLRPDGTQETEYLCELDLAEERMS
Ga0070714_10134059713300005435Agricultural SoilMAVEHRCKRHGRPAVASRVRLRPDGTQETEYLCELDLAEERMSSR
Ga0070711_10003216213300005439Corn, Switchgrass And Miscanthus RhizosphereMAVEHLCQRHGRPAVASRVRLRPDGTQETEYLCELDLAEERMSSRLGGSS
Ga0066681_1040973713300005451SoilMAVEHLCQRHGRPAVASRVRLRPDGTQETEYLCELDLAEERMSS
Ga0070695_10116635223300005545Corn, Switchgrass And Miscanthus RhizosphereMAEQHLCKRHGRPAVASRVRLRPDGTQEVEYLCEIDLAEERMSGRLGGSR
Ga0070665_10162203213300005548Switchgrass RhizosphereMAAEQHFCERHHRPAVASRVRILADGTRETEYLCELDLA
Ga0070704_10031945633300005549Corn, Switchgrass And Miscanthus RhizosphereMAEQHLCQRHGRPAVASRVRLRPDGTQEVEYLCEIDLAEERMSGRLGGSRS
Ga0066699_1089610123300005561SoilMAVEHLCKRHGRPAVASRVRLRPDGTQEVEYLCEI
Ga0066699_1119199223300005561SoilMAAAEHLCQKHGRPAVATRTRLLPDGTQEVEYLCEI
Ga0070702_10070895633300005615Corn, Switchgrass And Miscanthus RhizosphereMAEQHLCQRHGRPAVASRVRLRPDGTQEVEYLCEIDLAEERM
Ga0075364_1011428113300006051Populus EndosphereMADQPVCQRHGRPAVASRVHTRPDGTQEVEYLCEIDVAEERMR
Ga0075367_1108075413300006178Populus EndosphereMAEQHLCKRHGRPAVASRVRLRPDGTQEVEYVCEIDLA
Ga0079222_1111394423300006755Agricultural SoilMAVEHLCQRHGRPAVASRVRLRPDGTQEVEYLCEIDLAEE
Ga0066660_1119778513300006800SoilMSVEQRCQRHGRPAVATRTRLRPDGTQEVEYLCEIDLAEERMAN
Ga0075424_10280556513300006904Populus RhizosphereMAAADQPVCPRHGRPAVASRVRLNPDGTQEVEYLCEIDLAEEQMSSRFGGR
Ga0075436_10153096823300006914Populus RhizosphereVAAEGPVCERHHRPAVASRVRILPDGTRETEYLCEIDLAEERMSGRFG
Ga0111539_1294319723300009094Populus RhizosphereMAEQHLCKRHGRPAVASRVRLRPDGTQEVEYLCEIDLAEERMSGRLGGSRSL
Ga0105245_1113813113300009098Miscanthus RhizosphereMAAEQHFCERHHRPAVASRVRILADGTRETEYLCEIDLAEERMSG
Ga0111538_1119959623300009156Populus RhizosphereMATEQWCQRHNRPAVASRVRRRADGTEQVEYLCEIDLAE
Ga0126313_1044116213300009840Serpentine SoilMAVEHRCQRHGRPAIASRVRLRPDGTQEVEYLCELDVAEERMPGRFGG
Ga0126312_1031953233300010041Serpentine SoilMAIEHRCQRHGRPAVASRVRLRPDGTQETEYLCELD
Ga0126314_1091298313300010042Serpentine SoilMAVEHRCQRHGRPAIASRVRLRPDGTREVEYLCELDVAEERMSGRFGGR
Ga0126314_1104437813300010042Serpentine SoilVATEQHFCERHGRPAVASRVRINPDGTREVEYLCD
Ga0126310_1171254923300010044Serpentine SoilMAEQPRCQRHGRPAVASRIRLRPDGTQETEYLCELDLAEERMS
Ga0134125_1267357413300010371Terrestrial SoilMAEQHLCQRHGRPAVASRVRLRPDGTQEVEYLCEIDLAEE
Ga0134122_1035715333300010400Terrestrial SoilMAEQHLCQRHGRPAVASRVRLRPDGTQEVEYLCEIDLAEERMSGRLGGSR
Ga0134122_1132491613300010400Terrestrial SoilMAVEHLCQRHGRPAVASRVRLRPDGTQETEYLCELDLAEERM
Ga0126317_1104187113300011332SoilMAVEHLCQRHGRPAVASRVRLRPDGTQETEYLCDID
Ga0120148_107847323300011999PermafrostMAAEQHFCERHHRPAVASRVRTLPDGTQEIEYLCEIDLAAGRIVVARGFADHDYPR*
Ga0137371_1091333223300012356Vadose Zone SoilMAAADQPVCQRHGRPAVASRVRLRPDGTQEVEYLCEIDLAEEQM
Ga0137419_1009181233300012925Vadose Zone SoilMAAEQHHCEKHHRPAVASRVRILPDGTRQTEYLCEIDLAEQ
Ga0162653_10000915733300012937SoilMSEQPRCPRHGRPAIASRVRLRPDGTQETEYLCEIDLAEERMQRGFGRRSLQLGES*
Ga0134110_1020427623300012975Grasslands SoilMAVEQHLCQRHGRPAVASRVRLRPDGTQEVEYLCDIDLAEERMGRLGGGR
Ga0137418_1051022533300015241Vadose Zone SoilMAAEQHFCERHHRPAVASRVRTRPDGTQEVEYLCEIDLAEERMASRFGPQ*
Ga0134073_1004469523300015356Grasslands SoilMAAEQHLCRRHGRPAVASRVRVRPDGTQEVEYLCDI
Ga0132256_10198120213300015372Arabidopsis RhizosphereMAEQHLCKRHGRPAVASRVRLRPDGTQEVEYLCEI
Ga0184605_1040352623300018027Groundwater SedimentMAEQHLCQRHGRPAVASRIRTRPDGTQEVEYLCEIDLAEE
Ga0184617_107735813300018066Groundwater SedimentMAEQPVCQRHGRPAVASRVRLRPDGTQEVEYLCEIDVAEERMGRLG
Ga0184635_10001351103300018072Groundwater SedimentMAVDQPVCKRHGRPAVASRVVTRPDGTQEVEYLCELDLAEERMRSPFGG
Ga0184609_1034551923300018076Groundwater SedimentMAVEQPVCKRHGRPAVASRVVTRPDGTQEVEYLCELDLAEERMRSP
Ga0184625_1057879413300018081Groundwater SedimentMAVEHLCQRHGRPAVASRVRLRPDGTQETEYLCELDLAEERMSSR
Ga0066662_1171719223300018468Grasslands SoilMSVEHLCQRHGRPAVPTRTRPRPDGTQEVEYLCENDLAEARQAH
Ga0184642_105269413300019279Groundwater SedimentMAVEQPVCQRHGRPAVAQRIRRLPDGTEEVEYLCELDLAEERMSG
Ga0184642_106254523300019279Groundwater SedimentMATEQHYCQRHNRPAVASRVRVRPDGTQEVEYLCEIDLAEERM
Ga0184642_132226323300019279Groundwater SedimentMATEQHYCERHHRPAVASRVRVLPDGTQEVEYLCELDLAE
Ga0193704_105325033300019867SoilMAEQHLCQRHGRPAVASRVRMRPDGTQEVEYLCEI
Ga0193728_115916413300019890SoilMSVEHRCQRHGRPAVATRTRLRPDGTQEVEYLCEIDLAE
Ga0193730_109880533300020002SoilMTVEHLCQRHGRPAVASRVRLRPDGTQETEYLCELDLAEE
Ga0193730_115462623300020002SoilMAAADQPICPRHGRPAVASRVRLNPDGTQEVEYLCEIDLAEEQMSSR
Ga0210382_1028919723300021080Groundwater SedimentMAAADQPVCPRHGRPAVASRVRLRPDGTQEVEYLC
Ga0210382_1032777413300021080Groundwater SedimentMATEQHYCQRHHRPAVASRVRTLPDGTQEVEYLCEIDLAEERM
Ga0179584_111338513300021151Vadose Zone SoilMAVEHRCQRHGRPAVASRVRLRPDGTQETEYLCELDLAEER
Ga0247743_104882723300023067SoilMAEQHLCQRHGRPAVASRVRLRPDGTQEVEYLCEIDLA
Ga0247679_103703223300024251SoilMAVEHLCQRHGRPAVASRVRLRPDGTQEVEYLCEIDLAEERMG
Ga0207647_1066851113300025904Corn RhizosphereMAEQHLCQRHGRPAVASRVRLRPDGTQEVEYLCEIDLAEERMSGRLG
Ga0207652_1061617113300025921Corn RhizosphereMAVEHLCQRHGRPAVASRVRLRPDGTQEVEYLCEIDLAEERMGRLGG
Ga0207644_1155274713300025931Switchgrass RhizosphereMAVDQPVCQRHGRPAVASRVRLRPDGTQEVEYLCEIDLAEEPMSS
Ga0207667_1042357613300025949Corn RhizosphereMAEQHLCQRHGRPAVASRVRLRPDGSQEVEYLCEIDLAEERMSGRLGGSR
Ga0207667_1149399423300025949Corn RhizosphereMAEQHLCKRHGRPAVASRVRLRPDGTQEVEYLCEID
Ga0208777_102048723300025996Rice Paddy SoilMTAEHLCQRHGRPAVASRVRLRPDGTEEVEYLCEIDLAEERMGRLGG
Ga0207428_1086092713300027907Populus RhizosphereMADQPVCQRHGRPAVASRVHTRPDGTQEVEYLCEIDV
Ga0207428_1118113113300027907Populus RhizosphereMAEQHLCQRHGRPAVASRVRLRPDGTQEVEYLCEIDLAE
Ga0247749_103554813300027993SoilMAEQHLCQRHGRPAVASRVRLRPDGTQEVEYLCEIDLAEERMSGR
Ga0307295_1000821913300028708SoilMAEQHLCQRHGRPAVASRVRQRPDGTQEVEYLCEIDLAEERMS
Ga0307301_1025338713300028719SoilMAAADQPVCPRHGRPAVASRVRLNPDGTQEVEYLCEIDLAEEQM
Ga0307318_1018003213300028744SoilVATEQHYCQRHHRPAVASRVRTLPDGTEEVEYLCELDIAE
Ga0307280_1016111513300028768SoilMAAADQPVCPRHGRPAVASRVRLNPDGTQEVEYLCEIDLAEEQMS
Ga0307288_1048265413300028778SoilMAEQHLCQRHGRPAVASRVRLRPDGTQEVEYLCEIDL
Ga0307323_1034301823300028787SoilMAEQHLCQRHGRPAVASRVRQRPDGTQEVEYLCEIDLAEERMSGRLGGSRSL
Ga0307290_1002053953300028791SoilMAVEQPVCQRHGRPAVAQRIRRLPDGTEEVEYLCE
Ga0307290_1019496423300028791SoilMAEQHLCQRHGRPAVASRVRMRPDGTQEVEYLCEIDLAEERMSGRL
Ga0307290_1033999023300028791SoilMAVEHVCQRHGRPAVASRVRLRPDGTQEVEYLCEIDLAEERMG
Ga0247824_1084702023300028809SoilMAEQHLCQRHGRPAVASRVRLRPDGTQEVEYLCELDLAEERMS
Ga0307302_1005813213300028814SoilMAEQHLCQRHGRPAVASRVRLRPDGTQEVEYLCEIDLAEERMSGRLGG
Ga0307302_1062517923300028814SoilMAVEHLCQRHGRPAVASRVRLLPDGTQETEYLCELD
Ga0307310_1029501323300028824SoilMASEQHYCQRHNRPAVASRVRTRPDGTQEVEYLCEIDLAEERMQS
Ga0307314_1001969143300028872SoilMAEQHLCQRHGRPAVASRVRMRPDGTQEVEYLCEID
Ga0307286_1002110313300028876SoilMAVEQPVCQRHGRPAVASRVVTRPDGTQGVEYLCELDLA
Ga0307286_1005669513300028876SoilMAEQPRCQRHGRPAVASRVRLRPDGTQETEYLCELD
Ga0307308_1012581423300028884SoilMAAADQPVCAQHGRPAVASRVRLRPDGTQEVEYLCEIDLAEEQMSSRFGGR
Ga0102757_1000301313300030785SoilMASEQHFCARHHRPAIASRVHLRPDGSQEVEYLCELDVAEERMSNRF
Ga0102757_1005042133300030785SoilMAVEHRCQRHGRPAVASRVRLRPDGTQETEYLCELDLAEERMSSR
Ga0308205_102658223300030830SoilMAVEQHYCQRHGRPAVASRVRILPDGTQETEYLCELDLA
Ga0308205_106606223300030830SoilMAVEHRCQRHGRPAVASRVRLRPDGTQETEYLCELDLAEERMSTRLGGS
Ga0308206_115770913300030903SoilVATEQHYCQRHHRPAVASRVRTLPDGSQEVEYLCELDIAEERLSRGF
Ga0308200_114295123300030905SoilVAAEQHFCERHHRPAVASRVRILPDGTRETEYLCEIDLAEERM
Ga0308200_116738023300030905SoilVATEQHYCQRHHRPAVASRVRTLPDGTQEVEYLCEI
Ga0308204_1012469913300031092SoilMAVEHLCQRHGRPAVASRVRLRPDGTQEVEYLCEIDLAEERMGHLG
Ga0307505_1023694523300031455SoilMAVQHRCQRHGRPAVASRVRLLPDGTQETEYLCEIDLAEERLSSGFGN
Ga0307469_1208127923300031720Hardwood Forest SoilMAVDQPVCQRHGRPAVASRVRLRPDGTQEVEYLCEIDLAEEQMSSRFGGRGS
Ga0310896_1066632123300032211SoilMAVEHLCQRHGRPAVASRVRLRPDGTQETEYLCELDLAEERMSTRL
Ga0247829_1080873113300033550SoilMAEQHLCQRHGRPAVASRVRLRPDGTQEVEYLCEIDLAEERMSGRLGGS
Ga0373950_0004089_2016_21233300034818Rhizosphere SoilMAVEHLCQRHGRPAVASRVRLRPDGTQETEYLCELD

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.