NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F099511

Metagenome / Metatranscriptome Family F099511

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F099511
Family Type Metagenome / Metatranscriptome
Number of Sequences 103
Average Sequence Length 37 residues
Representative Sequence DHLPTEDEVAEVSDRWRPYRSLAVSYLFASEYDGQP
Number of Associated Samples 95
Number of Associated Scaffolds 103

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 2.91 %
% of genes near scaffold ends (potentially truncated) 93.20 %
% of genes from short scaffolds (< 2000 bps) 94.17 %
Associated GOLD sequencing projects 92
AlphaFold2 3D model prediction Yes
3D model pTM-score0.37

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (92.233 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere
(12.621 % of family members)
Environment Ontology (ENVO) Unclassified
(32.039 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(45.631 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 40.62%    β-sheet: 0.00%    Coil/Unstructured: 59.38%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.37
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 103 Family Scaffolds
PF03807F420_oxidored 35.92
PF13577SnoaL_4 7.77
PF13462Thioredoxin_4 4.85
PF03358FMN_red 3.88
PF01361Tautomerase 2.91
PF00005ABC_tran 2.91
PF00248Aldo_ket_red 2.91
PF07690MFS_1 2.91
PF00106adh_short 0.97
PF07729FCD 0.97
PF00756Esterase 0.97
PF00201UDPGT 0.97
PF00196GerE 0.97
PF13847Methyltransf_31 0.97
PF14542Acetyltransf_CG 0.97
PF04075F420H2_quin_red 0.97
PF12680SnoaL_2 0.97
PF00107ADH_zinc_N 0.97
PF05977MFS_3 0.97
PF04542Sigma70_r2 0.97
PF04261Dyp_perox 0.97
PF08922DUF1905 0.97
PF01556DnaJ_C 0.97
PF02371Transposase_20 0.97
PF01694Rhomboid 0.97
PF04203Sortase 0.97
PF03446NAD_binding_2 0.97
PF07731Cu-oxidase_2 0.97
PF12681Glyoxalase_2 0.97
PF00753Lactamase_B 0.97
PF02148zf-UBP 0.97
PF13434Lys_Orn_oxgnase 0.97
PF001982-oxoacid_dh 0.97
PF07366SnoaL 0.97
PF00561Abhydrolase_1 0.97

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 103 Family Scaffolds
COG1942Phenylpyruvate tautomerase PptA, 4-oxalocrotonate tautomerase familySecondary metabolites biosynthesis, transport and catabolism [Q] 2.91
COG1819UDP:flavonoid glycosyltransferase YjiC, YdhE familyCarbohydrate transport and metabolism [G] 1.94
COG0484DnaJ-class molecular chaperone with C-terminal Zn finger domainPosttranslational modification, protein turnover, chaperones [O] 0.97
COG0508Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide acyltransferase (E2) componentEnergy production and conversion [C] 0.97
COG0568DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32)Transcription [K] 0.97
COG0705Membrane-associated serine protease, rhomboid familyPosttranslational modification, protein turnover, chaperones [O] 0.97
COG1191DNA-directed RNA polymerase specialized sigma subunitTranscription [K] 0.97
COG1595DNA-directed RNA polymerase specialized sigma subunit, sigma24 familyTranscription [K] 0.97
COG1802DNA-binding transcriptional regulator, GntR familyTranscription [K] 0.97
COG2132Multicopper oxidase with three cupredoxin domains (includes cell division protein FtsP and spore coat protein CotA)Cell cycle control, cell division, chromosome partitioning [D] 0.97
COG2186DNA-binding transcriptional regulator, FadR familyTranscription [K] 0.97
COG2814Predicted arabinose efflux permease AraJ, MFS familyCarbohydrate transport and metabolism [G] 0.97
COG2837Periplasmic deferrochelatase/peroxidase EfeBInorganic ion transport and metabolism [P] 0.97
COG3547TransposaseMobilome: prophages, transposons [X] 0.97
COG3764Sortase (surface protein transpeptidase)Cell wall/membrane/envelope biogenesis [M] 0.97
COG4941Predicted RNA polymerase sigma factor, contains C-terminal TPR domainTranscription [K] 0.97
COG5207Uncharacterized Zn-finger protein, UBP-typeGeneral function prediction only [R] 0.97

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms92.23 %
UnclassifiedrootN/A7.77 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000550|F24TB_10719481All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1802Open in IMG/M
3300001538|A10PFW1_11050244All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1209Open in IMG/M
3300001867|JGI12627J18819_10291591All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter → unclassified Solirubrobacter → Solirubrobacter sp. URHD0082657Open in IMG/M
3300004081|Ga0063454_101250820All Organisms → cellular organisms → Bacteria618Open in IMG/M
3300004114|Ga0062593_101191873All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria798Open in IMG/M
3300005445|Ga0070708_101901806All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium551Open in IMG/M
3300005447|Ga0066689_10680170All Organisms → cellular organisms → Bacteria645Open in IMG/M
3300005526|Ga0073909_10100682All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales1142Open in IMG/M
3300005536|Ga0070697_100667731All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria916Open in IMG/M
3300005543|Ga0070672_101528787All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia598Open in IMG/M
3300005556|Ga0066707_11013931All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria506Open in IMG/M
3300005563|Ga0068855_100185388All Organisms → cellular organisms → Bacteria2350Open in IMG/M
3300005586|Ga0066691_10723516All Organisms → cellular organisms → Bacteria → Terrabacteria group588Open in IMG/M
3300005719|Ga0068861_101321612All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium702Open in IMG/M
3300005841|Ga0068863_102479064Not Available528Open in IMG/M
3300005842|Ga0068858_101608900All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria641Open in IMG/M
3300005843|Ga0068860_102072596All Organisms → cellular organisms → Bacteria590Open in IMG/M
3300006196|Ga0075422_10474620All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria564Open in IMG/M
3300006606|Ga0074062_10490423All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales719Open in IMG/M
3300006755|Ga0079222_11023082All Organisms → cellular organisms → Bacteria → Terrabacteria group714Open in IMG/M
3300006845|Ga0075421_102496483All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter → unclassified Solirubrobacter → Solirubrobacter sp.539Open in IMG/M
3300006854|Ga0075425_100406608All Organisms → cellular organisms → Bacteria → Terrabacteria group1568Open in IMG/M
3300006854|Ga0075425_103091014All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium507Open in IMG/M
3300006871|Ga0075434_102572885All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria510Open in IMG/M
3300006880|Ga0075429_100287348Not Available1440Open in IMG/M
3300006903|Ga0075426_11556912All Organisms → cellular organisms → Bacteria503Open in IMG/M
3300006904|Ga0075424_102125231All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria591Open in IMG/M
3300006914|Ga0075436_100472850All Organisms → cellular organisms → Bacteria915Open in IMG/M
3300007788|Ga0099795_10312580All Organisms → cellular organisms → Bacteria694Open in IMG/M
3300009011|Ga0105251_10338670All Organisms → cellular organisms → Bacteria685Open in IMG/M
3300009089|Ga0099828_11535559All Organisms → cellular organisms → Bacteria587Open in IMG/M
3300009094|Ga0111539_11671344All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria738Open in IMG/M
3300009098|Ga0105245_10089048All Organisms → cellular organisms → Bacteria2836Open in IMG/M
3300009098|Ga0105245_10564627All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1161Open in IMG/M
3300009100|Ga0075418_11837858All Organisms → cellular organisms → Bacteria659Open in IMG/M
3300009137|Ga0066709_101674600All Organisms → cellular organisms → Bacteria904Open in IMG/M
3300009162|Ga0075423_11518477All Organisms → cellular organisms → Bacteria719Open in IMG/M
3300010323|Ga0134086_10423312All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria539Open in IMG/M
3300010358|Ga0126370_10677943Not Available902Open in IMG/M
3300010375|Ga0105239_12160154All Organisms → cellular organisms → Bacteria647Open in IMG/M
3300010376|Ga0126381_101038460All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii1183Open in IMG/M
3300010401|Ga0134121_11772369All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter → unclassified Solirubrobacter → Solirubrobacter sp. URHD0082643Open in IMG/M
3300010403|Ga0134123_13012959All Organisms → cellular organisms → Bacteria → Terrabacteria group540Open in IMG/M
3300011271|Ga0137393_11152222All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria659Open in IMG/M
3300012003|Ga0120163_1095672All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi655Open in IMG/M
3300012199|Ga0137383_10375918All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1041Open in IMG/M
3300012349|Ga0137387_11012484All Organisms → cellular organisms → Bacteria → Terrabacteria group595Open in IMG/M
3300012354|Ga0137366_10338612All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1102Open in IMG/M
3300012356|Ga0137371_11454335All Organisms → cellular organisms → Bacteria → Terrabacteria group500Open in IMG/M
3300012362|Ga0137361_10899521All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria803Open in IMG/M
3300012532|Ga0137373_10520392All Organisms → cellular organisms → Bacteria906Open in IMG/M
3300012927|Ga0137416_10123309All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales1987Open in IMG/M
3300012927|Ga0137416_11524547All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria607Open in IMG/M
3300012951|Ga0164300_10873065Not Available566Open in IMG/M
3300012960|Ga0164301_10735499All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria747Open in IMG/M
3300012961|Ga0164302_10124910All Organisms → cellular organisms → Bacteria1471Open in IMG/M
3300012987|Ga0164307_11253982All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria617Open in IMG/M
3300013294|Ga0120150_1085963All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria597Open in IMG/M
3300013297|Ga0157378_12820473Not Available538Open in IMG/M
3300013763|Ga0120179_1068910All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter → unclassified Solirubrobacter → Solirubrobacter sp. URHD0082794Open in IMG/M
3300015373|Ga0132257_101687539All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria812Open in IMG/M
3300016357|Ga0182032_11676020All Organisms → cellular organisms → Bacteria → Terrabacteria group554Open in IMG/M
3300018053|Ga0184626_10083046All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1354Open in IMG/M
3300020020|Ga0193738_1036293All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1518Open in IMG/M
3300021073|Ga0210378_10191358All Organisms → cellular organisms → Bacteria783Open in IMG/M
3300021078|Ga0210381_10012067All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2123Open in IMG/M
3300021180|Ga0210396_10308993All Organisms → cellular organisms → Bacteria1399Open in IMG/M
3300021363|Ga0193699_10317012All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria650Open in IMG/M
3300022756|Ga0222622_10272920Not Available1154Open in IMG/M
3300025134|Ga0207416_1027538All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia2762Open in IMG/M
3300025911|Ga0207654_10380678All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria977Open in IMG/M
3300025916|Ga0207663_10238879All Organisms → cellular organisms → Bacteria1331Open in IMG/M
3300025922|Ga0207646_10516483All Organisms → cellular organisms → Bacteria → Terrabacteria group1075Open in IMG/M
3300025939|Ga0207665_11260622All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Geodermatophilales → Geodermatophilaceae → Blastococcus → unclassified Blastococcus → Blastococcus sp. TML/M2B589Open in IMG/M
3300025940|Ga0207691_10258163All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1502Open in IMG/M
3300025942|Ga0207689_10327650All Organisms → cellular organisms → Bacteria1271Open in IMG/M
3300025945|Ga0207679_10369713All Organisms → cellular organisms → Bacteria1255Open in IMG/M
3300026089|Ga0207648_12109901All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium524Open in IMG/M
3300027465|Ga0207626_103087All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes599Open in IMG/M
3300027565|Ga0209219_1024167All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1498Open in IMG/M
3300027821|Ga0209811_10034619All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1690Open in IMG/M
3300027873|Ga0209814_10528252All Organisms → cellular organisms → Bacteria524Open in IMG/M
3300028047|Ga0209526_10361819All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium970Open in IMG/M
3300028047|Ga0209526_10893417Not Available541Open in IMG/M
3300028536|Ga0137415_10074951All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales3243Open in IMG/M
3300028782|Ga0307306_10138018All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria672Open in IMG/M
3300028784|Ga0307282_10389829All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria674Open in IMG/M
3300028811|Ga0307292_10315771All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria656Open in IMG/M
3300028828|Ga0307312_10030349All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3145Open in IMG/M
3300028828|Ga0307312_10462086All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales836Open in IMG/M
3300028828|Ga0307312_10558872Not Available756Open in IMG/M
3300031680|Ga0318574_10960084All Organisms → cellular organisms → Bacteria501Open in IMG/M
3300031720|Ga0307469_10334139All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1265Open in IMG/M
3300031744|Ga0306918_11229098All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria578Open in IMG/M
3300031910|Ga0306923_11355047All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria752Open in IMG/M
3300031946|Ga0310910_10855291All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter → unclassified Solirubrobacter → Solirubrobacter sp. URHD0082715Open in IMG/M
3300031962|Ga0307479_10267300All Organisms → cellular organisms → Bacteria1690Open in IMG/M
3300032064|Ga0318510_10425284All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales568Open in IMG/M
3300032174|Ga0307470_10576767All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter → unclassified Solirubrobacter → Solirubrobacter sp. URHD0082836Open in IMG/M
3300032180|Ga0307471_100724670All Organisms → cellular organisms → Bacteria1160Open in IMG/M
3300032180|Ga0307471_102097877All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Asanoa → Asanoa iriomotensis710Open in IMG/M
3300034817|Ga0373948_0200870All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria520Open in IMG/M
3300034817|Ga0373948_0222989All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria500Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere12.62%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil11.65%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil11.65%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil4.85%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere4.85%
PermafrostEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost3.88%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil3.88%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil3.88%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere3.88%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil2.91%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil2.91%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment1.94%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil1.94%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil1.94%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil1.94%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil1.94%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil1.94%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere1.94%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.94%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere1.94%
Rhizosphere SoilHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere Soil1.94%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere1.94%
Iron-Sulfur Acid SpringEnvironmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring0.97%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.97%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.97%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.97%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil0.97%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil0.97%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil0.97%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.97%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere0.97%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.97%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.97%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere0.97%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000550Amended soil microbial communities from Kansas Great Prairies, USA - BrdU amended with acetate total DNA F2.4 TB clc assemlyEnvironmentalOpen in IMG/M
3300001538Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A10-PF 4A)- 1 week illuminaEnvironmentalOpen in IMG/M
3300001867Texas A ecozone_OM1H0_M2 (Combined assembly for Texas A ecozone Site metagenome samples, ASSEMBLY_DATE=20130705)EnvironmentalOpen in IMG/M
3300004081Grasslands soil microbial communities from Hopland, California, USA - 2 (version 2)EnvironmentalOpen in IMG/M
3300004114Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5EnvironmentalOpen in IMG/M
3300005445Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaGEnvironmentalOpen in IMG/M
3300005447Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138EnvironmentalOpen in IMG/M
3300005526Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1EnvironmentalOpen in IMG/M
3300005536Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaGEnvironmentalOpen in IMG/M
3300005543Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaGHost-AssociatedOpen in IMG/M
3300005556Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156EnvironmentalOpen in IMG/M
3300005563Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2Host-AssociatedOpen in IMG/M
3300005586Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140EnvironmentalOpen in IMG/M
3300005719Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2Host-AssociatedOpen in IMG/M
3300005841Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2Host-AssociatedOpen in IMG/M
3300005842Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2Host-AssociatedOpen in IMG/M
3300005843Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2Host-AssociatedOpen in IMG/M
3300006196Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1Host-AssociatedOpen in IMG/M
3300006606Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMA (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006755Agricultural soil microbial communities from Georgia to study Nitrogen management - GA PlitterEnvironmentalOpen in IMG/M
3300006845Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5Host-AssociatedOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300006871Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3Host-AssociatedOpen in IMG/M
3300006880Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3Host-AssociatedOpen in IMG/M
3300006903Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5Host-AssociatedOpen in IMG/M
3300006904Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3Host-AssociatedOpen in IMG/M
3300006914Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5Host-AssociatedOpen in IMG/M
3300007788Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2EnvironmentalOpen in IMG/M
3300009011Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaGHost-AssociatedOpen in IMG/M
3300009089Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaGEnvironmentalOpen in IMG/M
3300009094Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009098Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaGHost-AssociatedOpen in IMG/M
3300009100Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2Host-AssociatedOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300009162Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2Host-AssociatedOpen in IMG/M
3300010323Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300010358Tropical forest soil microbial communities from Panama - MetaG Plot_3EnvironmentalOpen in IMG/M
3300010375Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaGHost-AssociatedOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300010401Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1EnvironmentalOpen in IMG/M
3300010403Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3EnvironmentalOpen in IMG/M
3300011271Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaGEnvironmentalOpen in IMG/M
3300012003Permafrost microbial communities from Nunavut, Canada - A20_80cm_0.25MEnvironmentalOpen in IMG/M
3300012199Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012349Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaGEnvironmentalOpen in IMG/M
3300012354Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaGEnvironmentalOpen in IMG/M
3300012356Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012362Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaGEnvironmentalOpen in IMG/M
3300012532Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_80_16 metaGEnvironmentalOpen in IMG/M
3300012927Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012951Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MGEnvironmentalOpen in IMG/M
3300012960Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MGEnvironmentalOpen in IMG/M
3300012961Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MGEnvironmentalOpen in IMG/M
3300012987Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MGEnvironmentalOpen in IMG/M
3300013294Permafrost microbial communities from Nunavut, Canada - A3_65cm_0MEnvironmentalOpen in IMG/M
3300013297Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaGHost-AssociatedOpen in IMG/M
3300013763Permafrost microbial communities from Nunavut, Canada - A15_65cm_0MEnvironmentalOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300016357Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000EnvironmentalOpen in IMG/M
3300018053Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_b1EnvironmentalOpen in IMG/M
3300020020Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2a1EnvironmentalOpen in IMG/M
3300021073Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_b1 redoEnvironmentalOpen in IMG/M
3300021078Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_coex redoEnvironmentalOpen in IMG/M
3300021180Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-OEnvironmentalOpen in IMG/M
3300021363Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3c2EnvironmentalOpen in IMG/M
3300022756Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1EnvironmentalOpen in IMG/M
3300025134Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPM 11 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025911Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025916Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025922Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025939Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025940Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025942Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025945Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026089Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300027465Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-BECK03-A (SPAdes)EnvironmentalOpen in IMG/M
3300027565Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300027821Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027873Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 (SPAdes)Host-AssociatedOpen in IMG/M
3300028047Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300028536Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300028782Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_193EnvironmentalOpen in IMG/M
3300028784Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121EnvironmentalOpen in IMG/M
3300028811Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_149EnvironmentalOpen in IMG/M
3300028828Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202EnvironmentalOpen in IMG/M
3300031680Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22EnvironmentalOpen in IMG/M
3300031720Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515EnvironmentalOpen in IMG/M
3300031744Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2)EnvironmentalOpen in IMG/M
3300031910Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2)EnvironmentalOpen in IMG/M
3300031946Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172EnvironmentalOpen in IMG/M
3300031962Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515EnvironmentalOpen in IMG/M
3300032064Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f17EnvironmentalOpen in IMG/M
3300032174Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300034817Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1Host-AssociatedOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
F24TB_1071948113300000550SoilGFDHLPTDDEVAEVSDRWRPYRSLAVSYLFASEYDGQP*
A10PFW1_1105024423300001538PermafrostYGFDDRPTEAEVAEVSDRWRPYRSLAVSYLFASEYQERT*
JGI12627J18819_1029159113300001867Forest SoilLPTEDEMIRLAERWRPYRSLAVSYLFASEFEKGT*
Ga0063454_10125082023300004081SoilYGFEHIPTQAQLTQISDRWRPDRSLAVSYLFASEYEGKQAPTS*
Ga0062593_10119187323300004114SoilMALDHVPTEDELTQLPKRWRPYRSLAVSYLFASEYDGGP*
Ga0070708_10190180613300005445Corn, Switchgrass And Miscanthus RhizosphereAFDHLPTDEEMVQIADRWRPFRSLAVSYLFASEFGAGTTATVRRPR*
Ga0066689_1068017013300005447SoilMTIDHRPTEDEVAQVSDRWRPYRSLAVSYLFASEYDGQP*
Ga0073909_1010068233300005526Surface SoilHLPTEDEVAEVSDRWRPYRSLAVSYLFASEYDGQE*
Ga0070697_10066773113300005536Corn, Switchgrass And Miscanthus RhizosphereFDHLPTDEELVELSDRWRPYRSLAVSYLFASAYDEQPPV*
Ga0070672_10152878723300005543Miscanthus RhizosphereDHLPTDDEVAEVSDRWRPYRSLGVSYLFASEYDAQP*
Ga0066707_1101393113300005556SoilHLPNDDDLAQVSARWRPYRSLAVSYLFASEYDGQP*
Ga0068855_10018538813300005563Corn RhizosphereLDHLPTEREMVEFAERWRPYRSLAVSYLFASEFEEGT*
Ga0066691_1072351623300005586SoilHLPTEDEMGLLADRWRPYRSLAVSYLFASEYDGGST*
Ga0068861_10132161213300005719Switchgrass RhizosphereVGFDHPPTDDEVAQISDRWRPYRSLAVSYLFASEYDGQP
Ga0068863_10247906423300005841Switchgrass RhizosphereHVPTEDEMTQLAERRRPYRSLAVSYLFASEYDERT*
Ga0068858_10160890013300005842Switchgrass RhizosphereAIQRTYGIDHVPTEDEMKQLSDRWRPFRSLAASYLFASEYDGQP*
Ga0068860_10207259613300005843Switchgrass RhizosphereHSPTEDEMLELAEHWRPYRSLAVSYLFASEYDGGI*
Ga0075422_1047462023300006196Populus RhizosphereLPIDDEVVQVSDRWRPYRSLAVSYLFASEYDGQP*
Ga0074062_1049042313300006606SoilVPSDEEMERLAERWRPYRSLAVSYLFASEYDGGP*
Ga0079222_1102308213300006755Agricultural SoilVPSEAELVEISDRWRPYRSLAVSYLFASEYEGPR*
Ga0075421_10249648313300006845Populus RhizosphereLDHPPTEDEMLELAERWRPYRSLAVSYLFASEYDGGI*
Ga0075425_10040660813300006854Populus RhizosphereGFDHVPSEAELVEISDRWRPYRSLAVSYLFASEYEDAR*
Ga0075425_10309101413300006854Populus RhizospherePTDDELIELSDRWRPYRSLAVSYLFASAYSGQPPT*
Ga0075434_10257288513300006871Populus RhizosphereAYGFDHVPTEEELMEIADRWRPYRSLAVSYLFAAEYEDGP*
Ga0075429_10028734843300006880Populus RhizosphereDHLPTEEEMVQLAERWRPYRSLAVSYLFASEYDGGT*
Ga0075426_1155691213300006903Populus RhizosphereGFDHLPTEDEVAEVSDRWRPYRSLAVSYLFASEYDAQA*
Ga0075424_10212523123300006904Populus RhizosphereHVPSEDELTEITDRWRPYRSLAVSYLFASEYDGGA*
Ga0075436_10047285023300006914Populus RhizosphereFDHSPTDAEMLELAERWRPYRSLAVSYLFASEYEAPSTT*
Ga0099795_1031258023300007788Vadose Zone SoilGHLPAEREMAELAERWRPYRSLAVSYLFASEFEEGT*
Ga0105251_1033867013300009011Switchgrass RhizosphereLDHLPTEREMLDIAERWRPYRSLAVAYLFTSEFEESH*
Ga0099828_1153555923300009089Vadose Zone SoilLPTEDEVAQVSDRWRPYRSLAVSYLFASEYDGQP*
Ga0111539_1167134413300009094Populus RhizosphereHLPTEDEVAQVSDRWRPYRSLAVSYLFATEYQDAT*
Ga0105245_1008904813300009098Miscanthus RhizosphereGFDHVPTPDELIELSDRWRPYRSLAVSYVFASEYAG*
Ga0105245_1056462713300009098Miscanthus RhizosphereDHLPTDDEVAQLSDRWRPYRSLAVSYLFASEYDGQT*
Ga0075418_1183785813300009100Populus RhizosphereFDHVPSEAEIAEVADRWRPYRSLAVSYLFASEYEGTG*
Ga0066709_10167460023300009137Grasslands SoilMTIDHRPTEDEVAQVSDRWPPYRSLAVSYLFASEYDGQP*
Ga0075423_1151847723300009162Populus RhizosphereDHLPRAQEMLRIAEPWRPYRSLAVSYLFAYELERSVT*
Ga0134086_1042331223300010323Grasslands SoilLPDEDEVAEVSDRWRPYRSLAVSYLFASEYDGQP*
Ga0126370_1067794343300010358Tropical Forest SoilGFDHLPTDAEVAEVSDRWRPYRSLAVSYLFASEYDGPRKEET*
Ga0105239_1216015413300010375Corn RhizosphereFDRVPTPDQLIELSDRWRPYRSLAVSYVFASEYAG*
Ga0126381_10103846023300010376Tropical Forest SoilEQQMLQIAEPWRPYRSLAVMYLFASEYDAQSAQS*
Ga0134121_1177236913300010401Terrestrial SoilDHMPNEDEMAEIADRWRPYRSLAVSYLFASEFEEGP*
Ga0134123_1301295923300010403Terrestrial SoilGFDHRPTDAEMLELAERWRPYRSLAVSYLFASEYEAPSTT*
Ga0137393_1115222213300011271Vadose Zone SoilRLDHVPSKAELVEISDRWRPYRSLAVSYLFSSEYEDPR*
Ga0120163_109567223300012003PermafrostDEMLQLAERWRPYRSLAVSYLFASEFDEPASPQS*
Ga0137383_1037591813300012199Vadose Zone SoilGFDHVPTEGEMTQLAERWRPYRSLAVSYLFASEYDGQP*
Ga0137387_1101248413300012349Vadose Zone SoilHLPTEDEMGLLADRWRPYRSLAVSYLFASEYDGGPT*
Ga0137366_1033861213300012354Vadose Zone SoilRVYGFDHVPTEAELSELSDRWRPYRSLAVSYLFASQYNG*
Ga0137371_1145433523300012356Vadose Zone SoilGFDHLPTEDEMGLLADRWRPYRSLAVSYLFASEYDGGST*
Ga0137361_1089952113300012362Vadose Zone SoilGFDHLPTDEEVAQVSDRWRPYRSLAVSYLFASEYDGQP*
Ga0137373_1052039213300012532Vadose Zone SoilLPTEDEVAQVSDRWRPYRSLAVSYLFASEYEGQP*
Ga0137416_1012330943300012927Vadose Zone SoilMASRAIQHAYRFDHLPTEDEMVQVAERWRPHRSLVVSYLFASEFEKGT*
Ga0137416_1152454723300012927Vadose Zone SoilDHPPTEDEMVQLAEQWRPYRSLAVSYLFASEYDGGI*
Ga0164300_1087306513300012951SoilLDHHPTEREMVELAGRWRPCRSLAVSYLFASEFEEGT*
Ga0164301_1073549923300012960SoilGFDHLPTGDEVAQVSDRWRPYRRLAVSYLFASEYDGGT*
Ga0164302_1012491013300012961SoilHLPTEDEMVQVAERWRPYRSLAVDYLFASEYEKGT*
Ga0164307_1125398213300012987SoilQLPTEDEVTEVSDRWRPYRSLAVSYLFASEYEGAT*
Ga0120150_108596313300013294PermafrostLPTDDEVVELAERWRPYRSLAVSYLFASEFEEAR*
Ga0157378_1282047313300013297Miscanthus RhizosphereLPTEDEVAEVSDRWRPYRSLAVSYLFASEYDALP*
Ga0120179_106891013300013763PermafrostELPTVAGMLQLAERWRPYRSLAVSYLFASEYRGQT*
Ga0132257_10168753913300015373Arabidopsis RhizosphereKRSTDSEVPQVSDCWRPYRSLAVSYLFASEYDGQA*
Ga0182032_1167602033300016357SoilFDHLPTEEEMVQLAERWQPYRTLAVSYLFASAYEKVT
Ga0184626_1008304613300018053Groundwater SedimentDDEMLQLAERWRPYRSLAVSYLFAIEYDEPTSAQA
Ga0193738_103629313300020020SoilDHLPTEDEMVEVAVRWRPYRSLAVSYLFASEYDEGR
Ga0210378_1019135823300021073Groundwater SedimentYVPSEEELIQVSDRWRPYRSLAVSYLFASEYDEGP
Ga0210381_1001206713300021078Groundwater SedimentHVPTEDEMTQLSERWRPYRSLAVSYLFASEYDRQP
Ga0210396_1030899313300021180SoilYGLDHTPTDEELAELSDRWRPYRSLAVSYLFASEYDV
Ga0193699_1031701223300021363SoilGLDDLPTEGEMVEIAERWRPYRSLAVSYLFASEFEERR
Ga0222622_1027292013300022756Groundwater SedimentHLPNEDEVAQVSDRWRPYRSLAVSYLFASEYDGQP
Ga0207416_102753853300025134Iron-Sulfur Acid SpringLPTDEELVELSDRWRPYRSLAVGYLFAPAYGGQPPA
Ga0207654_1038067813300025911Corn RhizosphereGFDHLPTEDEVAEVSDRWRPYRSLAVSYLFASEYQDAT
Ga0207663_1023887913300025916Corn, Switchgrass And Miscanthus RhizosphereFDHLPTEAEVAEVSDRWRPYRSLAVSYLFASEYQERP
Ga0207646_1051648323300025922Corn, Switchgrass And Miscanthus RhizosphereHLPTDDEMLQLAERWRPYRSLAVSYLFASEYDEPTSAQA
Ga0207665_1126062223300025939Corn, Switchgrass And Miscanthus RhizosphereMSRRSTASELIELSDRWPPYRSLAVSYIFASEYAG
Ga0207691_1025816333300025940Miscanthus RhizosphereDHLPTDDEVAEVSDRWRPYRSLGVSYLFASEYDAQP
Ga0207689_1032765013300025942Miscanthus RhizosphereYGFDHVPTESELIELSDRWRPYRSRAVSYLFASEYAA
Ga0207679_1036971313300025945Corn RhizosphereGFDRVPTPDELIELSDRWRPYRSLAVSYVFASEYAG
Ga0207648_1210990113300026089Miscanthus RhizosphereELDHLPTEGEMLDIAERWRPYRSLAVAYLFTSEFEESH
Ga0207626_10308713300027465SoilGFDHVPTEEELTEIADRWRPYRSLAVSYLFASEYDEGP
Ga0209219_102416713300027565Forest SoilHLSTEDEMVQVAERWRPYRSLAVSYLFASEFEKGT
Ga0209811_1003461933300027821Surface SoilHLPTEDEVAEVSDRWRPYRSLAVSYLFASEYDGQE
Ga0209814_1052825213300027873Populus RhizosphereYDFDHLPNEDEVALVSDRWRPYRSLAVGYLFASEYESNRD
Ga0209526_1036181923300028047Forest SoilDHLPTEDEVAQVSDRWRPYRSLAVSYLFASEYDAQP
Ga0209526_1089341723300028047Forest SoilHLPTGDEMVQIAERWRPYRSLAVSYLFASEFEKGT
Ga0137415_1007495163300028536Vadose Zone SoilMASRAIQHAYRFDHLPTEDEMVQVAERWRPHRSLVVSYLFASEFEKGT
Ga0307306_1013801823300028782SoilFDHPPTEDEVAQVSDRWRPYRSLAVSYLFASEYDGQP
Ga0307282_1038982923300028784SoilHLPTEDEVAEVSDRWRPYRSLAVSYLFASEYDGQP
Ga0307292_1031577113300028811SoilGHVPTEDEMTQLSERWRPYRSLAVSYLFASEYDGQP
Ga0307312_1003034963300028828SoilGFDHLPTEDEVAEVSDRWRPYRSLAVSYLFASEYDGQP
Ga0307312_1046208613300028828SoilGFDHLPTDDEVAQVSDRWRPYRSLAVSYLFSSEYDGQP
Ga0307312_1055887213300028828SoilLRPRPVPTEPEVLQLAERWRPYRSLAVSYLFASEFET
Ga0318574_1096008413300031680SoilHVPTEEEIVEISDRWRPYRSLAVSYLFASEYDGGTG
Ga0307469_1033413913300031720Hardwood Forest SoilGFDHLPTDDEVAEVSDRWRPYRSLAVSYLFASEYEDPR
Ga0306918_1122909823300031744SoilVQRAYGLNRPPTDEGMAQISNRWRPYRSLAVSYLFASEYGV
Ga0306923_1135504713300031910SoilLTGDIALRRAIRRVYGFDHVPTEHELIELSDRWRLVSYLFASEYGG
Ga0310910_1085529113300031946SoilHLPTEDEMVQLAERWRPYRSLAVSYLFASEYEKGT
Ga0307479_1026730033300031962Hardwood Forest SoilDHLPTEDEVAEVSDRWRPYRSLAVSYLFASEYDGQP
Ga0318510_1042528413300032064SoilSFDHVPTEEEIVEISDRWRPYRSLAVSYLFASEYDGGTG
Ga0307470_1057676723300032174Hardwood Forest SoilIQRAYGFDHLPTEDEVARVSDRWRPHRSLAVSYLFASEYDGQP
Ga0307471_10072467033300032180Hardwood Forest SoilGFGQLPSEAEMVGLAERWRPYRSLAVSYLFASEYEGQT
Ga0307471_10209787713300032180Hardwood Forest SoilFDHVPSEAELVKISDRWRPYRSLAVSYLFASEYEDPR
Ga0373948_0200870_410_5203300034817Rhizosphere SoilDHPPTEDEMLELAERWRPYRSLAVSYLFASEYDGQP
Ga0373948_0222989_2_1153300034817Rhizosphere SoilYGFDYLPTEEEVAEVSDRWRPYRSLAVSYLFASEYDA

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.