Metagenome / Metatranscriptome Family F099243

Basic Information
Family ID	F099243
Family Type	Metagenome / Metatranscriptome
Number of Sequences	103
Average Sequence Length	40 residues
Representative Sequence	MRNPPILISVIGFFAALAGFGFLFYGLRVIGFDWFGALGD
Number of Associated Samples	93
Number of Associated Scaffolds	103

Quality Assessment
Transcriptomic Evidence	Yes
Most common taxonomic group	Bacteria
% of genes with valid RBS motifs	99.03 %
% of genes near scaffold ends (potentially truncated)	100.00 %
% of genes from short scaffolds (< 2000 bps)	97.09 %
Associated GOLD sequencing projects	87
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.56

Most Common Taxonomy
Group	Bacteria (66.019 % of family members)
NCBI Taxonomy ID	2
Taxonomy	All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (22.330 % of family members)
Environment Ontology (ENVO)	Unclassified (28.155 % of family members)
Earth Microbiome Project Ontology (EMPO)	Free-living → Non-saline → Soil (non-saline) (46.602 % of family members)

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Predicted Topology & Secondary Structure
Classification:	Transmembrane (alpha-helical)	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 42.65% β-sheet: 0.00% Coil/Unstructured: 57.35%
Feature Viewer

Powered by Feature Viewer

Pfam ID	Name	% Frequency in 103 Family Scaffolds
PF09851	SHOCT	10.68
PF12833	HTH_18	4.85
PF13180	PDZ_2	2.91
PF13191	AAA_16	1.94
PF02627	CMD	1.94
PF08818	DUF1801	1.94
PF05988	DUF899	1.94
PF02678	Pirin	1.94
PF12697	Abhydrolase_6	1.94
PF00196	GerE	0.97
PF05235	CHAD	0.97
PF12680	SnoaL_2	0.97
PF00155	Aminotran_1_2	0.97
PF00520	Ion_trans	0.97
PF13401	AAA_22	0.97
PF03606	DcuC	0.97
PF08031	BBE	0.97
PF00528	BPD_transp_1	0.97
PF01061	ABC2_membrane	0.97
PF13460	NAD_binding_10	0.97
PF04525	LOR	0.97
PF00296	Bac_luciferase	0.97
PF12681	Glyoxalase_2	0.97
PF01872	RibD_C	0.97
PF12840	HTH_20	0.97
PF14026	DUF4242	0.97
PF07690	MFS_1	0.97
PF00884	Sulfatase	0.97
PF04402	SIMPL	0.97
PF12867	DinB_2	0.97
PF01810	LysE	0.97
PF03350	UPF0114	0.97

COG ID	Name	Functional Category	% Frequency in 103 Family Scaffolds
COG0599	Uncharacterized conserved protein YurZ, alkylhydroperoxidase/carboxymuconolactone decarboxylase family	General function prediction only [R]	1.94
COG1741	Redox-sensitive bicupin YhaK, pirin superfamily	General function prediction only [R]	1.94
COG2128	Alkylhydroperoxidase family enzyme, contains CxxC motif	Inorganic ion transport and metabolism [P]	1.94
COG4312	Predicted dithiol-disulfide oxidoreductase, DUF899 family	General function prediction only [R]	1.94
COG4430	Uncharacterized conserved protein YdeI, YjbR/CyaY-like superfamily, DUF1801 family	Function unknown [S]	1.94
COG5646	Iron-binding protein Fra/YdhG, frataxin family (Fe-S cluster biosynthesis)	Posttranslational modification, protein turnover, chaperones [O]	1.94
COG5649	Uncharacterized conserved protein, DUF1801 domain	Function unknown [S]	1.94
COG0262	Dihydrofolate reductase	Coenzyme transport and metabolism [H]	0.97
COG0277	FAD/FMN-containing lactate dehydrogenase/glycolate oxidase	Energy production and conversion [C]	0.97
COG1985	Pyrimidine reductase, riboflavin biosynthesis	Coenzyme transport and metabolism [H]	0.97
COG2141	Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase)	Coenzyme transport and metabolism [H]	0.97
COG2859	Outer membrane channel-forming protein BP26/OMP28, SIMPL family	Cell wall/membrane/envelope biogenesis [M]	0.97
COG2862	Uncharacterized membrane protein YqhA	Function unknown [S]	0.97
COG2968	Uncharacterized conserved protein YggE, contains kinase-interacting SIMPL domain	Function unknown [S]	0.97
COG3025	Inorganic triphosphatase YgiF, contains CYTH and CHAD domains	Inorganic ion transport and metabolism [P]	0.97
COG3471	Predicted secreted (periplasmic) protein	Function unknown [S]	0.97
COG4894	Putative phospholipid scramblase YxjI, Tubby2 superfamily	Lipid transport and metabolism [I]	0.97
COG5607	CHAD domain, binds inorganic polyphosphates	Function unknown [S]	0.97

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	66.02 %
Unclassified	root	N/A	33.98 %

Name	Rank	Taxonomy	Distribution
cellular organisms	root	All Organisms → cellular organisms	66.02 %
Unclassified	root	N/A	33.98 %

Name	Rank	Taxonomy	Distribution
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	66.02 %
Unclassified	root	N/A	33.98 %

Name	Rank	Taxonomy	Distribution
Terrabacteria group	clade	All Organisms → cellular organisms → Bacteria → Terrabacteria group	45.63 %
Unclassified	root	N/A	33.98 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	2.91 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	33.98 %
Actinobacteria	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	24.27 %
Chloroflexi	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	15.53 %
delta/epsilon subdivisions	subphylum	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions	1.94 %
Alphaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	0.97 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	33.98 %
Actinomycetia	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	10.68 %
unclassified Chloroflexi	no rank	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi	9.71 %
Thermomicrobia	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermomicrobia	1.94 %
Deltaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	1.94 %
Sphingomonadales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales	0.97 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	33.98 %
Chloroflexi bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	4.85 %
Chloroflexi bacterium RBG_16_69_14	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium RBG_16_69_14	2.91 %
Propionibacteriales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales	2.91 %
Chloroflexi bacterium GWC2_73_18	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium GWC2_73_18	1.94 %
unclassified Actinomycetia	no rank	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia	1.94 %
Micrococcales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales	1.94 %
unclassified Deltaproteobacteria	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria	1.94 %
Thermomicrobiales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermomicrobia → Thermomicrobiales	1.94 %
Sphingomonadaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae	0.97 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	33.98 %
Chloroflexi bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	4.85 %
Nocardioidaceae	family	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae	2.91 %
Chloroflexi bacterium RBG_16_69_14	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium RBG_16_69_14	2.91 %
unclassified Thermomicrobiales	no rank	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermomicrobia → Thermomicrobiales → unclassified Thermomicrobiales	1.94 %
Actinomycetia bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	1.94 %
Deltaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	1.94 %
Chloroflexi bacterium GWC2_73_18	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium GWC2_73_18	1.94 %
Micrococcales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales	1.94 %
Sphingomonas	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas	0.97 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	33.98 %
Chloroflexi bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	4.85 %
Nocardioides	genus	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides	2.91 %
Chloroflexi bacterium RBG_16_69_14	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium RBG_16_69_14	2.91 %
Thermomicrobiales bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermomicrobia → Thermomicrobiales → unclassified Thermomicrobiales → Thermomicrobiales bacterium	1.94 %
Actinomycetia bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	1.94 %
Deltaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	1.94 %
Chloroflexi bacterium GWC2_73_18	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium GWC2_73_18	1.94 %
Micrococcales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales	1.94 %
unclassified Sphingomonas	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas	0.97 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	33.98 %
Chloroflexi bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	4.85 %
Chloroflexi bacterium RBG_16_69_14	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium RBG_16_69_14	2.91 %
Nocardioides halotolerans	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides → Nocardioides halotolerans	1.94 %
Thermomicrobiales bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermomicrobia → Thermomicrobiales → unclassified Thermomicrobiales → Thermomicrobiales bacterium	1.94 %
Actinomycetia bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	1.94 %
Deltaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	1.94 %
Chloroflexi bacterium GWC2_73_18	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium GWC2_73_18	1.94 %
Micrococcales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales	1.94 %
Nocardioides cynanchi	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides → Nocardioides cynanchi	0.97 %
Sphingomonas sp. 8AM	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. 8AM	0.97 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
2189573000\|GPBTN7E01CZG8M	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	509	Open in IMG/M
3300000033\|ICChiseqgaiiDRAFT_c0828443	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	921	Open in IMG/M
3300000891\|JGI10214J12806_10384332	Not Available	501	Open in IMG/M
3300000891\|JGI10214J12806_10435541	Not Available	586	Open in IMG/M
3300000891\|JGI10214J12806_10880474	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides → Nocardioides halotolerans	1117	Open in IMG/M
3300001213\|JGIcombinedJ13530_101475316	Not Available	812	Open in IMG/M
3300003858\|Ga0031656_10118296	Not Available	949	Open in IMG/M
3300004156\|Ga0062589_101791285	Not Available	616	Open in IMG/M
3300004156\|Ga0062589_101895121	All Organisms → cellular organisms → Bacteria → Terrabacteria group	601	Open in IMG/M
3300004157\|Ga0062590_102017188	Not Available	599	Open in IMG/M
3300004479\|Ga0062595_101209449	Not Available	671	Open in IMG/M
3300004643\|Ga0062591_100122208	All Organisms → cellular organisms → Bacteria	1744	Open in IMG/M
3300005345\|Ga0070692_10678487	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	691	Open in IMG/M
3300005356\|Ga0070674_100915882	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides → Nocardioides cynanchi	764	Open in IMG/M
3300005366\|Ga0070659_101996070	All Organisms → cellular organisms → Bacteria	521	Open in IMG/M
3300005466\|Ga0070685_11188371	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	579	Open in IMG/M
3300005615\|Ga0070702_101877897	Not Available	502	Open in IMG/M
3300005833\|Ga0074472_11196385	Not Available	541	Open in IMG/M
3300005843\|Ga0068860_102498078	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium RBG_16_69_14	536	Open in IMG/M
3300006049\|Ga0075417_10194290	All Organisms → cellular organisms → Bacteria	959	Open in IMG/M
3300006051\|Ga0075364_10449908	All Organisms → cellular organisms → Bacteria	880	Open in IMG/M
3300006581\|Ga0074048_12640415	All Organisms → cellular organisms → Bacteria	759	Open in IMG/M
3300009094\|Ga0111539_13306015	All Organisms → cellular organisms → Bacteria → Terrabacteria group	519	Open in IMG/M
3300009101\|Ga0105247_10980251	Not Available	659	Open in IMG/M
3300009148\|Ga0105243_12618340	All Organisms → cellular organisms → Bacteria	544	Open in IMG/M
3300009789\|Ga0126307_10883760	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	722	Open in IMG/M
3300010366\|Ga0126379_13177880	Not Available	550	Open in IMG/M
3300010397\|Ga0134124_11792913	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	647	Open in IMG/M
3300010400\|Ga0134122_13076639	Not Available	521	Open in IMG/M
3300010401\|Ga0134121_12561803	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	553	Open in IMG/M
3300010403\|Ga0134123_11352560	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium	750	Open in IMG/M
3300012469\|Ga0150984_105441571	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	1029	Open in IMG/M
3300012884\|Ga0157300_1054302	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	639	Open in IMG/M
3300012885\|Ga0157287_1102836	Not Available	533	Open in IMG/M
3300012909\|Ga0157290_10480485	All Organisms → cellular organisms → Bacteria	503	Open in IMG/M
3300012955\|Ga0164298_10581817	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	765	Open in IMG/M
3300012961\|Ga0164302_11728564	All Organisms → cellular organisms → Bacteria	525	Open in IMG/M
3300012985\|Ga0164308_11542000	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	611	Open in IMG/M
3300012987\|Ga0164307_10356082	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	1064	Open in IMG/M
3300012988\|Ga0164306_11446582	All Organisms → cellular organisms → Bacteria	587	Open in IMG/M
3300012989\|Ga0164305_11660773	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	572	Open in IMG/M
3300014272\|Ga0075327_1328860	Not Available	514	Open in IMG/M
3300014316\|Ga0075339_1225337	Not Available	536	Open in IMG/M
3300014326\|Ga0157380_11860389	Not Available	662	Open in IMG/M
3300015200\|Ga0173480_10122745	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → unclassified Sphingomonas → Sphingomonas sp. 8AM	1292	Open in IMG/M
3300015200\|Ga0173480_10828772	Not Available	593	Open in IMG/M
3300015201\|Ga0173478_10163428	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	898	Open in IMG/M
3300015371\|Ga0132258_10874635	All Organisms → cellular organisms → Bacteria	2268	Open in IMG/M
3300015371\|Ga0132258_11572996	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	1660	Open in IMG/M
3300015372\|Ga0132256_103042568	Not Available	564	Open in IMG/M
3300015373\|Ga0132257_104025200	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium GWC2_73_18	535	Open in IMG/M
3300015374\|Ga0132255_104372165	All Organisms → cellular organisms → Bacteria	599	Open in IMG/M
3300016294\|Ga0182041_11269897	Not Available	673	Open in IMG/M
3300016319\|Ga0182033_11692451	Not Available	573	Open in IMG/M
3300016387\|Ga0182040_11103872	Not Available	665	Open in IMG/M
3300016404\|Ga0182037_11829528	Not Available	543	Open in IMG/M
3300018060\|Ga0187765_10071347	Not Available	1835	Open in IMG/M
3300018060\|Ga0187765_10300965	All Organisms → cellular organisms → Bacteria	962	Open in IMG/M
3300018432\|Ga0190275_13045472	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	542	Open in IMG/M
3300018469\|Ga0190270_10806654	Not Available	946	Open in IMG/M
3300018481\|Ga0190271_10030816	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	4320	Open in IMG/M
3300018481\|Ga0190271_10489761	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermomicrobia → Thermomicrobiales → unclassified Thermomicrobiales → Thermomicrobiales bacterium	1339	Open in IMG/M
3300019356\|Ga0173481_10696088	Not Available	548	Open in IMG/M
3300019362\|Ga0173479_10422848	All Organisms → cellular organisms → Bacteria → Terrabacteria group	649	Open in IMG/M
3300022911\|Ga0247783_1225881	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	540	Open in IMG/M
3300022915\|Ga0247790_10195845	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides → Nocardioides halotolerans	535	Open in IMG/M
3300023077\|Ga0247802_1041828	All Organisms → cellular organisms → Bacteria	705	Open in IMG/M
3300025916\|Ga0207663_10279560	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium GWC2_73_18	1239	Open in IMG/M
3300025923\|Ga0207681_10162768	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	1684	Open in IMG/M
3300025924\|Ga0207694_11260210	All Organisms → cellular organisms → Bacteria → Terrabacteria group	625	Open in IMG/M
3300025930\|Ga0207701_10189666	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	1811	Open in IMG/M
3300026041\|Ga0207639_12268724	All Organisms → cellular organisms → Bacteria	504	Open in IMG/M
3300026062\|Ga0208654_1011512	All Organisms → cellular organisms → Bacteria	1112	Open in IMG/M
3300027907\|Ga0207428_10460712	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	926	Open in IMG/M
3300028381\|Ga0268264_10279481	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	1563	Open in IMG/M
3300028590\|Ga0247823_10997486	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	628	Open in IMG/M
3300028755\|Ga0307316_10249558	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	645	Open in IMG/M
3300028803\|Ga0307281_10035890	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium RBG_16_69_14	1508	Open in IMG/M
3300028803\|Ga0307281_10139152	All Organisms → cellular organisms → Bacteria	844	Open in IMG/M
3300028856\|Ga0302295_1033506	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermomicrobia → Thermomicrobiales → unclassified Thermomicrobiales → Thermomicrobiales bacterium	1028	Open in IMG/M
3300028875\|Ga0307289_10089376	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium RBG_16_69_14	1252	Open in IMG/M
3300029923\|Ga0311347_10124252	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales	1601	Open in IMG/M
3300030048\|Ga0302273_1029840	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	1640	Open in IMG/M
3300030673\|Ga0302287_10248612	Not Available	522	Open in IMG/M
3300030990\|Ga0308178_1050690	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	775	Open in IMG/M
3300031728\|Ga0316578_10141917	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	1447	Open in IMG/M
3300031797\|Ga0318550_10454095	Not Available	619	Open in IMG/M
3300031873\|Ga0315297_11473643	Not Available	550	Open in IMG/M
3300031997\|Ga0315278_10888745	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	894	Open in IMG/M
3300032001\|Ga0306922_11808611	Not Available	601	Open in IMG/M
3300032003\|Ga0310897_10403470	All Organisms → cellular organisms → Bacteria → Terrabacteria group	647	Open in IMG/M
3300032010\|Ga0318569_10492866	Not Available	571	Open in IMG/M
3300032013\|Ga0310906_10688509	All Organisms → cellular organisms → Bacteria	713	Open in IMG/M
3300032059\|Ga0318533_11202611	Not Available	554	Open in IMG/M
3300032143\|Ga0315292_10051579	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales	3048	Open in IMG/M
3300032143\|Ga0315292_11297652	Not Available	596	Open in IMG/M
3300032211\|Ga0310896_10623416	Not Available	604	Open in IMG/M
3300032275\|Ga0315270_10116538	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	1579	Open in IMG/M
3300032275\|Ga0315270_10634345	All Organisms → cellular organisms → Bacteria	696	Open in IMG/M
3300033408\|Ga0316605_12091125	Not Available	551	Open in IMG/M
3300033416\|Ga0316622_100680169	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium	1189	Open in IMG/M
3300034090\|Ga0326723_0378401	Not Available	641	Open in IMG/M
3300034151\|Ga0364935_0119889	All Organisms → cellular organisms → Bacteria → Terrabacteria group	819	Open in IMG/M

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Environmental	Environmental	79.61%
Host-Associated	Host-Associated	20.39%

Habitat	Taxonomy	Distribution
Terrestrial	Environmental → Terrestrial	70.87%
Plants	Host-Associated → Plants	20.39%
Aquatic	Environmental → Aquatic	8.74%

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil	64.08%
Rhizosphere	Host-Associated → Plants → Rhizosphere	12.62%
Freshwater	Environmental → Aquatic → Freshwater	6.80%
Rhizoplane	Host-Associated → Plants → Rhizoplane	6.80%
Peat	Environmental → Terrestrial → Peat	4.85%
Marine	Environmental → Aquatic → Marine	0.97%
Sediment	Environmental → Aquatic → Sediment	0.97%
Plant Litter	Environmental → Terrestrial → Plant Litter	0.97%
Floodplain	Environmental → Terrestrial → Floodplain	0.97%
Roots	Host-Associated → Plants → Roots	0.97%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified	53.40%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	7.77%
Wetlands	Environmental → Terrestrial → Soil → Wetlands	6.80%
Lake	Environmental → Aquatic → Freshwater → Lake	5.83%
Unclassified	Environmental → Terrestrial → Peat → Unclassified	4.85%
Soil	Host-Associated → Plants → Rhizosphere → Soil	4.85%
Loam	Environmental → Terrestrial → Soil → Loam	3.88%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified	3.88%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	2.91%
Lentic	Environmental → Aquatic → Freshwater → Lentic	0.97%
Wetlands	Environmental → Aquatic → Marine → Wetlands	0.97%
Unclassified	Environmental → Aquatic → Sediment → Unclassified	0.97%
Unclassified	Environmental → Terrestrial → Plant Litter → Unclassified	0.97%
Sediment	Environmental → Terrestrial → Floodplain → Sediment	0.97%
Bulk Soil	Host-Associated → Plants → Roots → Bulk Soil	0.97%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified → Unclassified	29.13%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil	7.77%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	7.77%
Agricultural Land	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land	6.80%
Unclassified	Environmental → Terrestrial → Soil → Wetlands → Unclassified	6.80%
Sediment	Environmental → Aquatic → Freshwater → Lake → Sediment	5.83%
Grasslands	Environmental → Terrestrial → Soil → Unclassified → Grasslands	5.83%
Unclassified	Environmental → Terrestrial → Peat → Unclassified → Unclassified	4.85%
Unclassified	Host-Associated → Plants → Rhizosphere → Soil → Unclassified	4.85%
Agricultural	Environmental → Terrestrial → Soil → Unclassified → Agricultural	3.88%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil	3.88%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified	3.88%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	2.91%
Sediment	Environmental → Aquatic → Freshwater → Lentic → Sediment	0.97%
Sediment	Environmental → Aquatic → Marine → Wetlands → Sediment	0.97%
Unclassified	Environmental → Aquatic → Sediment → Unclassified → Unclassified	0.97%
Unclassified	Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified	0.97%
Unclassified	Environmental → Terrestrial → Floodplain → Sediment → Unclassified	0.97%
Unclassified	Host-Associated → Plants → Roots → Bulk Soil → Unclassified	0.97%

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	22.33%
Sediment	Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment	5.83%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil	4.85%
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	4.85%
Terrestrial Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil	3.88%
Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil	3.88%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil	3.88%
Arabidopsis Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere	3.88%
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	2.91%
Natural And Restored Wetlands	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands	2.91%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere	2.91%
Fen	Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen	2.91%
Populus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere	2.91%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil	1.94%
Soil	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil	1.94%
Tropical Peatland	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland	1.94%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	1.94%
Freshwater Lake Sediment	Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment	0.97%
Wetland	Environmental → Aquatic → Marine → Wetlands → Sediment → Wetland	0.97%
Sediment (Intertidal)	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal)	0.97%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	0.97%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil	0.97%
Serpentine Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil	0.97%
Grass Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil	0.97%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere	0.97%
Switchgrass Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere	0.97%
Bog	Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog	0.97%
Peat Soil	Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil	0.97%
Plant Litter	Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter	0.97%
Sediment	Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment	0.97%
Corn Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere	0.97%
Populus Endosphere	Host-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere	0.97%
Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere	0.97%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere	0.97%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	0.97%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere	0.97%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere	0.97%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere	0.97%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere	0.97%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere	0.97%
Arabidopsis Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere	0.97%
Avena Fatua Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere	0.97%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
2189573000	Grass soil microbial communities from Rothamsted Park, UK - July 2010 direct MP BIO 1O1 lysis 0-21cm (T0 for microcosms)	Environmental	Open in IMG/M
3300000033	Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil	Environmental	Open in IMG/M
3300000891	Soil microbial communities from Great Prairies - Wisconsin, Continuous corn soil	Environmental	Open in IMG/M
3300001213	Combined assembly of wetland microbial communities from Twitchell Island in the Sacramento Delta (Jan 2013 JGI Velvet Assembly)	Environmental	Open in IMG/M
3300003858	Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - DIP11 DI	Environmental	Open in IMG/M
3300004156	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1	Environmental	Open in IMG/M
3300004157	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2	Environmental	Open in IMG/M
3300004479	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs	Environmental	Open in IMG/M
3300004643	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3	Environmental	Open in IMG/M
3300005345	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG	Environmental	Open in IMG/M
3300005356	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG	Host-Associated	Open in IMG/M
3300005366	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG	Host-Associated	Open in IMG/M
3300005466	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG	Environmental	Open in IMG/M
3300005615	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG	Environmental	Open in IMG/M
3300005833	Microbial communities from Cathlamet Bay sediment, Columbia River estuary, Oregon - S.174_CBK	Environmental	Open in IMG/M
3300005843	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2	Host-Associated	Open in IMG/M
3300006049	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1	Host-Associated	Open in IMG/M
3300006051	Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4	Host-Associated	Open in IMG/M
3300006581	Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLPB (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300009094	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2)	Host-Associated	Open in IMG/M
3300009101	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG	Host-Associated	Open in IMG/M
3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Host-Associated	Open in IMG/M
3300009789	Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot28	Environmental	Open in IMG/M
3300010366	Tropical forest soil microbial communities from Panama - MetaG Plot_24	Environmental	Open in IMG/M
3300010397	Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4	Environmental	Open in IMG/M
3300010400	Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2	Environmental	Open in IMG/M
3300010401	Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1	Environmental	Open in IMG/M
3300010403	Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3	Environmental	Open in IMG/M
3300012469	Combined assembly of Soil carbon rhizosphere	Host-Associated	Open in IMG/M
3300012884	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2	Environmental	Open in IMG/M
3300012885	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S104-311B-1	Environmental	Open in IMG/M
3300012909	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S149-409B-1	Environmental	Open in IMG/M
3300012955	Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG	Environmental	Open in IMG/M
3300012961	Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG	Environmental	Open in IMG/M
3300012985	Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MG	Environmental	Open in IMG/M
3300012987	Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MG	Environmental	Open in IMG/M
3300012988	Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MG	Environmental	Open in IMG/M
3300012989	Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG	Environmental	Open in IMG/M
3300014272	Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberrySE_CattailB_D1	Environmental	Open in IMG/M
3300014316	Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushMan_CattailNLC_D1	Environmental	Open in IMG/M
3300014326	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG	Host-Associated	Open in IMG/M
3300015200	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S209-509C-1 (version 2)	Environmental	Open in IMG/M
3300015201	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S014-104B-1 (version 2)	Environmental	Open in IMG/M
3300015371	Combined assembly of cpr5 and col0 rhizosphere and soil	Host-Associated	Open in IMG/M
3300015372	Soil combined assembly	Host-Associated	Open in IMG/M
3300015373	Combined assembly of cpr5 rhizosphere	Host-Associated	Open in IMG/M
3300015374	Col-0 rhizosphere combined assembly	Host-Associated	Open in IMG/M
3300016294	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178	Environmental	Open in IMG/M
3300016319	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H	Environmental	Open in IMG/M
3300016387	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176	Environmental	Open in IMG/M
3300016404	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082	Environmental	Open in IMG/M
3300018060	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MG	Environmental	Open in IMG/M
3300018432	Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 550 T	Environmental	Open in IMG/M
3300018469	Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T	Environmental	Open in IMG/M
3300018481	Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 T	Environmental	Open in IMG/M
3300019356	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2 (version 2)	Environmental	Open in IMG/M
3300019362	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S104-311B-1 (version 2)	Environmental	Open in IMG/M
3300022911	Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L064-202C-5	Environmental	Open in IMG/M
3300022915	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S171-409R-4	Environmental	Open in IMG/M
3300023077	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S076-202R-6	Environmental	Open in IMG/M
3300025916	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes)	Environmental	Open in IMG/M
3300025923	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025924	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025930	Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes)	Environmental	Open in IMG/M
3300026041	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026062	Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_CattailC_D1 (SPAdes)	Environmental	Open in IMG/M
3300027907	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes)	Host-Associated	Open in IMG/M
3300028381	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes)	Host-Associated	Open in IMG/M
3300028590	Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_PalmiticAcid_Day30	Environmental	Open in IMG/M
3300028755	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_356	Environmental	Open in IMG/M
3300028803	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_120	Environmental	Open in IMG/M
3300028856	Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Fen_N2_4	Environmental	Open in IMG/M
3300028875	Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_143	Environmental	Open in IMG/M
3300029923	II_Fen_E1 coassembly	Environmental	Open in IMG/M
3300030048	Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_N1_3	Environmental	Open in IMG/M
3300030673	Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Fen_E2_4	Environmental	Open in IMG/M
3300030990	Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_149 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300031728	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC	Host-Associated	Open in IMG/M
3300031797	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f23	Environmental	Open in IMG/M
3300031873	Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G15_0	Environmental	Open in IMG/M
3300031997	Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G06_0	Environmental	Open in IMG/M
3300032001	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2)	Environmental	Open in IMG/M
3300032003	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D1	Environmental	Open in IMG/M
3300032010	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f22	Environmental	Open in IMG/M
3300032013	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D3	Environmental	Open in IMG/M
3300032059	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27	Environmental	Open in IMG/M
3300032143	Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_0	Environmental	Open in IMG/M
3300032211	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D1	Environmental	Open in IMG/M
3300032275	Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C1_bottom	Environmental	Open in IMG/M
3300033408	Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day20_noCT	Environmental	Open in IMG/M
3300033416	Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_OW2_C1_D5_C	Environmental	Open in IMG/M
3300034090	Peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF00N	Environmental	Open in IMG/M
3300034151	Sediment microbial communities from East River floodplain, Colorado, United States - 2_s17	Environmental	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.56
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.56
Powered by PDBe Molstar

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome / Metatranscriptome Family F099243

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Gene Neighborhood

Neighboring Pfam domains

Neighboring Clusters of Orthologous Genes (COGs)

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
N55_02789340	2189573000	Grass Soil	VRNPPILISVIGFFAALAGFGYLFFGLRVIGFDWFGIFGD
ICChiseqgaiiDRAFT_08284431	3300000033	Soil	MRNPPILVSVIGFFGAIAGFYWIYLGLRLLGFDWFGVLGDLE
JGI10214J12806_103843322	3300000891	Soil	MKNPPILISVIGFFAALAGVSYLFFGLSALGFDWFGALGDLPKYE
JGI10214J12806_104355411	3300000891	Soil	MRNPPILVSVIGFFAAIAGFYWIYLGLRVIGFDWFGVL
JGI10214J12806_108804743	3300000891	Soil	VKNPPILISVLGFFAGLAGVSFLIFGFRVLGFDWFGIFGDLPEYD
JGIcombinedJ13530_1014753162	3300001213	Wetland	VKNPPILISVLGFFAVMAGVYYIFGGLRLVGFDFFGAFKN
Ga0031656_101182962	3300003858	Freshwater Lake Sediment	MRNPPILVSVLGFFAGLAGFAWIFLGLRILGFDWFTVLGDV
Ga0062589_1017912852	3300004156	Soil	MRNPPILVSVIGFFGAIAGFYWLYLGLRLLGFDWFGALGDLPSTE
Ga0062589_1018951212	3300004156	Soil	VRNPPILISVIGFFAALAGFNYLFLGLRALGFDWFNALGD
Ga0062590_1020171881	3300004157	Soil	MRNPPILVSVIGFFALLAGFGYLFFGLRVLGFDWFGLFGD
Ga0062595_1012094492	3300004479	Soil	MKNPPILISIIGFFAALAGFAYLFFGLRVLGFDWFGILGDLQAFEHV
Ga0062591_1001222081	3300004643	Soil	MKNPPVLVAVLGFFAALAGFGFIFMGFRMIGFDWFGLFGD
Ga0070692_106784871	3300005345	Corn, Switchgrass And Miscanthus Rhizosphere	VRNPPILISVLGFFAGLAGFSYLFYGLRMLGFDWFGAFGDLPQLE
Ga0070674_1009158822	3300005356	Miscanthus Rhizosphere	VKNPPILISVLGFFAGLAGVSFLFFGLRVLGFDWFGAFGDLPE
Ga0070659_1019960702	3300005366	Corn Rhizosphere	MRNPPILISVLGFFAALAGFGWLFFGLRVLGFDWFGIFGDLPQFNSV
Ga0070685_111883711	3300005466	Switchgrass Rhizosphere	MKNPPILISVLGFFAALAGFAWLFFGLRLLGFDWFGLFGDVPALEH
Ga0070702_1018778971	3300005615	Corn, Switchgrass And Miscanthus Rhizosphere	MRNPPILVSVIGFFGAIAGFYWLYLGLRLLGFDWFGALGDLP
Ga0074472_111963851	3300005833	Sediment (Intertidal)	MKNPPILISVIGFFAALAGFAGIFFGLRILGFDWFGALGDLPAFESV
Ga0068860_1024980782	3300005843	Switchgrass Rhizosphere	MKNPPILVSVLGFFAALAGFGFLFYGLRVIGFDWF
Ga0075417_101942903	3300006049	Populus Rhizosphere	VRNPPVLVSVIGFFAALAGFGYLFWGLRVLGFDWFGAF
Ga0075364_104499081	3300006051	Populus Endosphere	VRNPPVLVSVIGFFAALAGFGYLFWGLRVLGFDWFGAFG
Ga0074048_126404151	3300006581	Soil	MRNPPVLVSVIGFFAALAGFGFLFYGLRVLGFDWFGLLGD
Ga0111539_133060152	3300009094	Populus Rhizosphere	VRNPPILVSVIGFFGLLAGFEFFFFALRAIGFDWFGLFGDLPAVE
Ga0105247_109802512	3300009101	Switchgrass Rhizosphere	VLNPPILISVLGFFGLLAGFGFFFFGLRAIGFDWFGLFGDLP
Ga0105243_126183402	3300009148	Miscanthus Rhizosphere	MKNPPILVSVLGFFAALAGFGFLFYGLRVIGFDWFG
Ga0126307_108837601	3300009789	Serpentine Soil	MRNPPVLISVIGFFAAIAGFAMLFAGLRFLGFDWFGV
Ga0126379_131778802	3300010366	Tropical Forest Soil	MKNPPILISVLGFFAGLAGFAWLFFGLRVLGFDWFGIFG
Ga0134124_117929132	3300010397	Terrestrial Soil	VRNPPILISVLGFFGLLAGFEFFFFGLRALGFDWFGLFGDLP
Ga0134122_130766391	3300010400	Terrestrial Soil	VRNPPVLVSVIGFFAALAGFGFLFWGLRVLGFDWFGAL
Ga0134121_125618031	3300010401	Terrestrial Soil	MKNPPILIAVLGFFGLMTAFFYIFAGLRMIGFDWFGAFKD
Ga0134123_113525601	3300010403	Terrestrial Soil	VRNPPILISVLGFFAGLAGFSYLFYGLRMLGFDWF
Ga0150984_1054415711	3300012469	Avena Fatua Rhizosphere	VRNPPILISVIGFFGAIAGFAWLFFGLRLLGFDWFGAFGDLPQFEHV
Ga0157300_10543021	3300012884	Soil	MKNPPILISVLGFFGAMAGFAWLFFGLRLLGFDWFGAL
Ga0157287_11028362	3300012885	Soil	MKNPPILVSVLGFFAALAGFGFLFFGLRVICFDWFEMI
Ga0157290_104804852	3300012909	Soil	MRNPPVLVSVIGFFAMLAGLYWLYLGLRLLGFDWFGALGDLPAYEQ
Ga0164298_105818171	3300012955	Soil	MRNPPILISVLGFFAMLAGFGFFFFGLRVLGFDWFGIFG
Ga0164302_117285642	3300012961	Soil	MKNPPILISVLGFFAALAGFAWLFFGLRLLGFDWFGLFGDVP
Ga0164308_115420002	3300012985	Soil	MKNPPILISVIGFFALLAGFGFFFFGLRVLGFDWFGIL
Ga0164307_103560823	3300012987	Soil	MRNPPILISVIGFFAALAGFGYLFMGFRMLGFDWFGALGDLPAFNHV
Ga0164306_114465822	3300012988	Soil	MKNPPILIAVLGFFAALAGFGFLFFGLRAIGFDWFGAFGDLPQL
Ga0164305_116607733	3300012989	Soil	MKNPPILISVVGFFAGLAGFGYLFFGLRILGFDWFGIFGDLPSVERV
Ga0075327_13288601	3300014272	Natural And Restored Wetlands	MKNPPILISVIGFFAMLAGFGFLFWGFSVIGFDWFGLFGDLPE
Ga0075339_12253372	3300014316	Natural And Restored Wetlands	VKNPPILISVIGFFAAMAGFAWLFFGLRLLGFDWFGVLGD
Ga0157380_118603891	3300014326	Switchgrass Rhizosphere	MKNPPILISVLGFFAALAGFGFLFYGLRVIGFDWFGIFGDLP
Ga0173480_101227451	3300015200	Soil	MKNPPILISVLGFFAALAGFAFFFFGLRVLGFDWFGAL
Ga0173480_108287721	3300015200	Soil	MKNPPIFVSLLGFFALLAGFAYLFFGLRMIGFDWFGV
Ga0173478_101634281	3300015201	Soil	VKNPPILIAVLGFFGALAGFYWLYLGLRLLGFDWFGL
Ga0132258_108746355	3300015371	Arabidopsis Rhizosphere	MRTPPILISVLGFFAALAGFGWLFFGLRVLGFDWFGAL
Ga0132258_115729961	3300015371	Arabidopsis Rhizosphere	MKNPPILISVIGFFAAMAGFAWLFLGLRILGFDWFGILGDLPKF
Ga0132256_1030425682	3300015372	Arabidopsis Rhizosphere	VRNPPILISVLGFFGLLAGFEFFFFGLRALGFDWFGLFGDLERYEGV
Ga0132257_1040252001	3300015373	Arabidopsis Rhizosphere	MKNPPILISILGFFAALAGFGLLFWGFRVLGFDWFGAFG
Ga0132255_1043721651	3300015374	Arabidopsis Rhizosphere	MRNPPILISVIGFFAALAGFGFLFYGLRVIGFDWFGALGD
Ga0182041_112698971	3300016294	Soil	MRNPPILVAVIGFFAALAGFSFLFFGLRAIGFDWFGA
Ga0182033_116924511	3300016319	Soil	MRNPPILISVLGFFAGLAGFSFLFFGLRVLGFDWFGALGDLPQ
Ga0182040_111038722	3300016387	Soil	MRNPPILISVLGFFAGLAGFSFLFFGLRVLGFDWFGALGDLPQFN
Ga0182037_118295282	3300016404	Soil	MRNPPILISVLGFFAGLAGFSFLFFGLRVLGFDWFGALGDL
Ga0187765_100713474	3300018060	Tropical Peatland	VKNPPILIAVLGFFAALAGFGFLFFGLRAIGFDWFGAL
Ga0187765_103009652	3300018060	Tropical Peatland	MRNPPIFISVLGFFAAMAGFGYLFWGLRVLGFDWFGAFG
Ga0190275_130454722	3300018432	Soil	VKNPPILISVLGFFAGLAGFSFLFFGLRVLGFDWFGAFGD
Ga0190270_108066541	3300018469	Soil	MHVKNPPILVAVLGFFAALAGFGFLFFGLRVLGFDWFGALG
Ga0190271_100308167	3300018481	Soil	MKNPPILISVLGFFAALAGFAYFFFGLRVLGFDWFGAFG
Ga0190271_104897611	3300018481	Soil	MKNPPILISVLGFFGAMAGFAWLFFGLRLLGFDWFG
Ga0173481_106960881	3300019356	Soil	MRNPPILIAVIGFFGALAGMFWLYLGLRLLGFDWFGALGDLPAFE
Ga0173479_104228482	3300019362	Soil	VRNPPILVSVIGFFGLLAGFEFFFFGLRAIGFDWFGLFGDL
Ga0247783_12258811	3300022911	Plant Litter	VKNPPILIAVLGFFGALAGFYWLYLGLRLLGFDWFGLLGDLQPFEA
Ga0247790_101958451	3300022915	Soil	VKNPPILISVLGFFAGLAGVSFLIFGFRVLGFDWFGIFGDLPEYDDVG
Ga0247802_10418282	3300023077	Soil	VRNPPVLVSVIGFFAALAGFGYLFWGLRVLGFDWFGA
Ga0207663_102795601	3300025916	Corn, Switchgrass And Miscanthus Rhizosphere	MKNPPILISILGFFAALAGFGLLFWGFRVLGFDWFGAFGDLP
Ga0207681_101627681	3300025923	Switchgrass Rhizosphere	MRNPPVLVAVLGFFGALAGFGFLFMGFRMLGFDWFGLFGDLPRFE
Ga0207694_112602102	3300025924	Corn Rhizosphere	MRNPPVLVAVLGFFGALAGFGFLFMGFRMLGFDWFGLFGDL
Ga0207701_101896664	3300025930	Corn, Switchgrass And Miscanthus Rhizosphere	VRNPPVLVSVIGFFAALAGFGYLFWGLRVLGFDWFGALGDLPA
Ga0207639_122687241	3300026041	Corn Rhizosphere	VRNPPVLVSVIGFFAALAGFGYLFWGLRVLGFDWFG
Ga0208654_10115122	3300026062	Natural And Restored Wetlands	MRNPPILVSVIGFFGAIAGFYWIYLGLRLLGFDWFGA
Ga0207428_104607121	3300027907	Populus Rhizosphere	MRNPPILVSVIGFFAAIAGFYWIYLGLRIIGFDWFGILGDL
Ga0268264_102794813	3300028381	Switchgrass Rhizosphere	VRNPPILISVLGFFGLLAGFGFFFFGLRAIGFDWFGLFGDLPAVEHVGL
Ga0247823_109974862	3300028590	Soil	VKNPPILIAVLGFFGALAGFYWLYLGLRLLGFDWFGLLGDLQPF
Ga0307316_102495583	3300028755	Soil	VRNPPILISVLGFFGAMAGFAWLFIGLRMIGFDWFGIFGDLPAFERV
Ga0307281_100358903	3300028803	Soil	MKNPPILISVLGFFAALAGFGFLFFGLRVIGFDWFG
Ga0307281_101391521	3300028803	Soil	MRNPPILVSVIGFFAALAGFGWLLVGLRLLGFDWFGALGD
Ga0302295_10335061	3300028856	Fen	MKNPPVLVSVIGFFAAIAGFGWIVLGARPLGFDWFG
Ga0307289_100893761	3300028875	Soil	MKNPPILISVLGFFAALAGFGFLFFGLRVIGFDWF
Ga0311347_101242521	3300029923	Fen	MKNPPILVSVIGFFAAIAGFAWLAFGLRLLGFDWFGV
Ga0302273_10298404	3300030048	Bog	VKNPPILISVLGFFAAMAGFAWLFFGMRLLGFDWFGALGDVPAFEH
Ga0302287_102486122	3300030673	Fen	MKNPPVLVSVIGFFAAIAGFGWIVLGARLLGFDWFGVL
Ga0308178_10506901	3300030990	Soil	VRNPPILIAVIGFFAAMAGFGWLFMGMRMLGFDWFG
Ga0316578_101419171	3300031728	Rhizosphere	MKNPPILISVLGFFVGMAGFAWLFFGISLLGFDWFGALGDL
Ga0318550_104540952	3300031797	Soil	MKNPPIFISVLGFFAALAGFGYLFWGLRVLGFDWFGAFGDLPAVEH
Ga0315297_114736431	3300031873	Sediment	MRNPPVLVSVIGFFAALAGFGWLLVGLRLVGFDWFGALG
Ga0315278_108887453	3300031997	Sediment	VKNPPVLISVIGFFGALAGFGYIFFGLRALGFDWF
Ga0306922_118086112	3300032001	Soil	MRNPPILVAVIGFFAALAGFSFLFFGLRAIGFDWFG
Ga0310897_104034702	3300032003	Soil	MRNPPVLVAVLGFFGALAGFGFLFMGFRMLGFDWFGLF
Ga0318569_104928662	3300032010	Soil	VRNPPILIAVLGFFAGLAGFSFLFFGLRVIGFDWFGVLGDLPK
Ga0310906_106885092	3300032013	Soil	MKNPPILVSVLGFFAALAGFGFLFYGLRVIGFDWFGIFGDLPN
Ga0318533_112026112	3300032059	Soil	VRNPPILIAVLGFFAGLAGFSFLFFGLRVIGFDWFGVLGDLPKYE
Ga0315292_100515794	3300032143	Sediment	MKNPPILISVIGFFVALAGFAWLFLGLRVLGFDWFT
Ga0315292_112976521	3300032143	Sediment	VKNPPILISVIGFFAAMAGFGWLFFGLRLLGFDWFG
Ga0310896_106234162	3300032211	Soil	MKNPPILVSVLGFFAALAGFGFLFYGLRVIGFDWFGIFGD
Ga0315270_101165381	3300032275	Sediment	MKNPPVLVSVIGFFVALAGFAWLFLGLRLIGFDWFGILGD
Ga0315270_106343452	3300032275	Sediment	MKNPPILISVIGFFAAIAGFAWLFLGLRLLGFDWF
Ga0316605_120911252	3300033408	Soil	MKNPPVLISVIGFFAALAGFGWLFFGLRVLGFDWFGLLGDLP
Ga0316622_1006801693	3300033416	Soil	MKNPPILVSIIGFFGVLAGLGWLVLGLRILGFDWFTV
Ga0326723_0378401_1_129	3300034090	Peat Soil	MKNPPILIAVIGFFAALAGFGYLFFGLRVLGFDWFGLLGDLPA
Ga0364935_0119889_702_818	3300034151	Sediment	MRNPPVLVSVIGFFAMLAGLYWLYLGLRLLGFDWFGALG

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign