


| Basic Information | |
|---|---|
| Family ID | F099147 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 103 |
| Average Sequence Length | 45 residues |
| Representative Sequence | MIKLLVDLEPFQKGEILSVGKTYDTYLVDKGLAVWIKVDKQDFKKK |
| Number of Associated Samples | 75 |
| Number of Associated Scaffolds | 103 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.97 % |
| % of genes near scaffold ends (potentially truncated) | 28.16 % |
| % of genes from short scaffolds (< 2000 bps) | 70.87 % |
| Associated GOLD sequencing projects | 70 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.43 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (56.311 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater (15.534 % of family members) |
| Environment Ontology (ENVO) | Unclassified (44.660 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (46.602 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 20.27% β-sheet: 0.00% Coil/Unstructured: 79.73% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.43 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 103 Family Scaffolds |
|---|---|---|
| PF05521 | Phage_H_T_join | 28.16 |
| PF05135 | Phage_connect_1 | 26.21 |
| PF01381 | HTH_3 | 1.94 |
| PF04765 | DUF616 | 1.94 |
| PF13489 | Methyltransf_23 | 1.94 |
| PF06199 | Phage_tail_2 | 1.94 |
| PF00149 | Metallophos | 0.97 |
| PF04404 | ERF | 0.97 |
| PF04586 | Peptidase_S78 | 0.97 |
| PF05065 | Phage_capsid | 0.97 |
| PF13712 | Glyco_tranf_2_5 | 0.97 |
| COG ID | Name | Functional Category | % Frequency in 103 Family Scaffolds |
|---|---|---|---|
| COG3740 | Phage head maturation protease | Mobilome: prophages, transposons [X] | 0.97 |
| COG4653 | Predicted phage phi-C31 gp36 major capsid-like protein | Mobilome: prophages, transposons [X] | 0.97 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 60.19 % |
| Unclassified | root | N/A | 39.81 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000949|BBAY94_10037180 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 1360 | Open in IMG/M |
| 3300002408|B570J29032_109269261 | Not Available | 663 | Open in IMG/M |
| 3300002408|B570J29032_109857060 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Chitinophaga → Chitinophaga eiseniae | 1698 | Open in IMG/M |
| 3300002835|B570J40625_100003191 | Not Available | 30668 | Open in IMG/M |
| 3300002835|B570J40625_100019992 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 11361 | Open in IMG/M |
| 3300002835|B570J40625_101122655 | Not Available | 663 | Open in IMG/M |
| 3300003393|JGI25909J50240_1124092 | Not Available | 508 | Open in IMG/M |
| 3300004481|Ga0069718_14958325 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → Sphingobacteriales → Sphingobacteriaceae | 1133 | Open in IMG/M |
| 3300005581|Ga0049081_10247047 | Not Available | 627 | Open in IMG/M |
| 3300005805|Ga0079957_1023427 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4242 | Open in IMG/M |
| 3300005805|Ga0079957_1211001 | Not Available | 928 | Open in IMG/M |
| 3300005826|Ga0074477_1182083 | All Organisms → cellular organisms → Bacteria | 4465 | Open in IMG/M |
| 3300006734|Ga0098073_1006730 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → Sphingobacteriales → Sphingobacteriaceae → Sphingobacterium → unclassified Sphingobacterium → Sphingobacterium sp. SGG-5 | 2201 | Open in IMG/M |
| 3300006802|Ga0070749_10056453 | Not Available | 2377 | Open in IMG/M |
| 3300006802|Ga0070749_10196710 | Not Available | 1156 | Open in IMG/M |
| 3300006920|Ga0070748_1064038 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae | 1441 | Open in IMG/M |
| 3300006920|Ga0070748_1193954 | All Organisms → cellular organisms → Bacteria | 744 | Open in IMG/M |
| 3300007538|Ga0099851_1002367 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 7988 | Open in IMG/M |
| 3300007542|Ga0099846_1019655 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2629 | Open in IMG/M |
| 3300007542|Ga0099846_1330035 | Not Available | 519 | Open in IMG/M |
| 3300008108|Ga0114341_10217972 | Not Available | 1052 | Open in IMG/M |
| 3300008448|Ga0114876_1001477 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 17354 | Open in IMG/M |
| 3300008448|Ga0114876_1157354 | Not Available | 821 | Open in IMG/M |
| 3300008450|Ga0114880_1070129 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Arachidicoccus → Arachidicoccus rhizosphaerae | 1426 | Open in IMG/M |
| 3300008450|Ga0114880_1109625 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 1053 | Open in IMG/M |
| 3300009009|Ga0105105_10297844 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → Sphingobacteriales → Sphingobacteriaceae → Sphingobacterium → unclassified Sphingobacterium → Sphingobacterium sp. SGG-5 | 870 | Open in IMG/M |
| 3300009009|Ga0105105_10742271 | Not Available | 588 | Open in IMG/M |
| 3300009026|Ga0102829_1037089 | All Organisms → cellular organisms → Bacteria | 1438 | Open in IMG/M |
| 3300009082|Ga0105099_10388747 | Not Available | 831 | Open in IMG/M |
| 3300009085|Ga0105103_10547430 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium | 653 | Open in IMG/M |
| 3300009085|Ga0105103_10626627 | Not Available | 613 | Open in IMG/M |
| 3300009165|Ga0105102_10003969 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 5276 | Open in IMG/M |
| 3300009165|Ga0105102_10049388 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium | 1843 | Open in IMG/M |
| 3300009165|Ga0105102_10336635 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Chitinophaga | 790 | Open in IMG/M |
| 3300009165|Ga0105102_10514885 | Not Available | 651 | Open in IMG/M |
| 3300009165|Ga0105102_10609162 | Not Available | 604 | Open in IMG/M |
| 3300009169|Ga0105097_10146772 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium | 1297 | Open in IMG/M |
| 3300011334|Ga0153697_1518 | Not Available | 11289 | Open in IMG/M |
| 3300011336|Ga0153703_1308 | Not Available | 17990 | Open in IMG/M |
| 3300012722|Ga0157630_1048635 | Not Available | 981 | Open in IMG/M |
| 3300012729|Ga0157625_1032325 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → Sphingobacteriales → Sphingobacteriaceae | 537 | Open in IMG/M |
| 3300013004|Ga0164293_10017146 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 6063 | Open in IMG/M |
| 3300013004|Ga0164293_10041474 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → Sphingobacteriales → Sphingobacteriaceae → Sphingobacterium → unclassified Sphingobacterium → Sphingobacterium sp. SGG-5 | 3762 | Open in IMG/M |
| 3300013372|Ga0177922_10548667 | All Organisms → cellular organisms → Bacteria | 2377 | Open in IMG/M |
| 3300017736|Ga0181365_1050626 | Not Available | 1038 | Open in IMG/M |
| 3300017754|Ga0181344_1166689 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → Sphingobacteriales → Sphingobacteriaceae → Sphingobacterium → unclassified Sphingobacterium → Sphingobacterium sp. SGG-5 | 625 | Open in IMG/M |
| 3300017754|Ga0181344_1237013 | All Organisms → cellular organisms → Bacteria | 507 | Open in IMG/M |
| 3300017774|Ga0181358_1072776 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → Sphingobacteriales → Sphingobacteriaceae → Sphingobacterium → unclassified Sphingobacterium → Sphingobacterium sp. SGG-5 | 1266 | Open in IMG/M |
| 3300017780|Ga0181346_1014791 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 3309 | Open in IMG/M |
| 3300017780|Ga0181346_1040563 | Not Available | 1906 | Open in IMG/M |
| 3300017971|Ga0180438_11104991 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium | 573 | Open in IMG/M |
| 3300019784|Ga0181359_1093339 | Not Available | 1113 | Open in IMG/M |
| 3300020159|Ga0211734_10731234 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → Sphingobacteriales → Sphingobacteriaceae | 954 | Open in IMG/M |
| 3300020162|Ga0211735_10163661 | All Organisms → cellular organisms → Bacteria | 717 | Open in IMG/M |
| 3300020190|Ga0194118_10176818 | All Organisms → cellular organisms → Bacteria | 1233 | Open in IMG/M |
| 3300020498|Ga0208050_1018229 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → Sphingobacteriales → Sphingobacteriaceae | 738 | Open in IMG/M |
| 3300020527|Ga0208232_1000810 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 5989 | Open in IMG/M |
| 3300020529|Ga0208233_1036921 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → Sphingobacteriales → Sphingobacteriaceae | 595 | Open in IMG/M |
| 3300020535|Ga0208228_1030640 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 871 | Open in IMG/M |
| 3300020539|Ga0207941_1016073 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium | 1153 | Open in IMG/M |
| 3300020549|Ga0207942_1041718 | All Organisms → cellular organisms → Bacteria | 569 | Open in IMG/M |
| 3300021092|Ga0194122_10318647 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Arachidicoccus → Arachidicoccus rhizosphaerae | 796 | Open in IMG/M |
| 3300021961|Ga0222714_10001389 | All Organisms → cellular organisms → Bacteria | 27290 | Open in IMG/M |
| 3300021961|Ga0222714_10003189 | Not Available | 16891 | Open in IMG/M |
| 3300022200|Ga0196901_1072543 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → Sphingobacteriales → Sphingobacteriaceae | 1242 | Open in IMG/M |
| 3300022407|Ga0181351_1061533 | Not Available | 1542 | Open in IMG/M |
| 3300022407|Ga0181351_1122526 | Not Available | 973 | Open in IMG/M |
| 3300024351|Ga0255141_1022218 | Not Available | 971 | Open in IMG/M |
| 3300024853|Ga0255252_1002202 | Not Available | 2811 | Open in IMG/M |
| 3300025057|Ga0208018_117415 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → Sphingobacteriales → Sphingobacteriaceae → Sphingobacterium → unclassified Sphingobacterium → Sphingobacterium sp. SGG-5 | 882 | Open in IMG/M |
| 3300025635|Ga0208147_1101208 | Not Available | 698 | Open in IMG/M |
| 3300025646|Ga0208161_1007387 | All Organisms → cellular organisms → Bacteria | 4838 | Open in IMG/M |
| 3300025655|Ga0208795_1087476 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 853 | Open in IMG/M |
| 3300025655|Ga0208795_1163035 | Not Available | 547 | Open in IMG/M |
| 3300025747|Ga0255247_1020168 | Not Available | 818 | Open in IMG/M |
| 3300025889|Ga0208644_1228504 | Not Available | 786 | Open in IMG/M |
| 3300026429|Ga0255253_1016884 | All Organisms → Viruses → Predicted Viral | 1157 | Open in IMG/M |
| 3300027299|Ga0255124_1073832 | Not Available | 581 | Open in IMG/M |
| 3300027693|Ga0209704_1000142 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 12965 | Open in IMG/M |
| 3300027693|Ga0209704_1005423 | All Organisms → cellular organisms → Bacteria | 2859 | Open in IMG/M |
| 3300027693|Ga0209704_1014188 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium | 1945 | Open in IMG/M |
| 3300027693|Ga0209704_1044744 | All Organisms → cellular organisms → Bacteria | 1201 | Open in IMG/M |
| 3300027693|Ga0209704_1123965 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium | 742 | Open in IMG/M |
| 3300027785|Ga0209246_10001239 | All Organisms → cellular organisms → Bacteria | 10182 | Open in IMG/M |
| 3300027798|Ga0209353_10005313 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 6565 | Open in IMG/M |
| 3300028105|Ga0255254_1002303 | Not Available | 2932 | Open in IMG/M |
| 3300031539|Ga0307380_10460046 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 1130 | Open in IMG/M |
| 3300031758|Ga0315907_10001453 | Not Available | 31968 | Open in IMG/M |
| 3300031999|Ga0315274_11890215 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → Sphingobacteriales → Sphingobacteriaceae | 542 | Open in IMG/M |
| 3300032116|Ga0315903_10773337 | Not Available | 706 | Open in IMG/M |
| 3300032116|Ga0315903_10937866 | Not Available | 614 | Open in IMG/M |
| 3300033980|Ga0334981_0312067 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium | 694 | Open in IMG/M |
| 3300033981|Ga0334982_0246841 | Not Available | 860 | Open in IMG/M |
| 3300033981|Ga0334982_0429810 | Not Available | 595 | Open in IMG/M |
| 3300033993|Ga0334994_0056971 | All Organisms → Viruses → unclassified bacterial viruses → Bacteriophage sp. | 2415 | Open in IMG/M |
| 3300033995|Ga0335003_0106800 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → Sphingobacteriales → Sphingobacteriaceae | 1442 | Open in IMG/M |
| 3300033996|Ga0334979_0025358 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 3979 | Open in IMG/M |
| 3300033996|Ga0334979_0483968 | Not Available | 672 | Open in IMG/M |
| 3300034019|Ga0334998_0266588 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → unclassified Chitinophagaceae → Chitinophagaceae bacterium | 1031 | Open in IMG/M |
| 3300034062|Ga0334995_0224498 | Not Available | 1286 | Open in IMG/M |
| 3300034104|Ga0335031_0324943 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 992 | Open in IMG/M |
| 3300034109|Ga0335051_0004055 | Not Available | 8028 | Open in IMG/M |
| 3300034121|Ga0335058_0600322 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → Sphingobacteriales → Sphingobacteriaceae | 616 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 15.53% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 15.53% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 12.62% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 11.65% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 8.74% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 5.83% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 5.83% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 2.91% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 2.91% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 1.94% |
| Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake | 1.94% |
| Freshwater | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater | 1.94% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 1.94% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 1.94% |
| Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Sediment | 0.97% |
| Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 0.97% |
| Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 0.97% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 0.97% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 0.97% |
| Hypersaline Lake Sediment | Environmental → Aquatic → Non-Marine Saline And Alkaline → Hypersaline → Sediment → Hypersaline Lake Sediment | 0.97% |
| Sediment (Intertidal) | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal) | 0.97% |
| Soil | Environmental → Terrestrial → Soil → Clay → Unclassified → Soil | 0.97% |
| Macroalgal Surface | Host-Associated → Algae → Green Algae → Ectosymbionts → Unclassified → Macroalgal Surface | 0.97% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000949 | Macroalgal surface ecosystem from Botany Bay, Sydney, Australia - BBAY94 | Host-Associated | Open in IMG/M |
| 3300002408 | Freshwater microbial communities from Lake Mendota, WI, sample - 15JUL2010 deep hole epilimnion (Lake Mendota Combined assembly, ASSEMBLY_DATE=20140123) | Environmental | Open in IMG/M |
| 3300002835 | Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605) | Environmental | Open in IMG/M |
| 3300003393 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.DD | Environmental | Open in IMG/M |
| 3300004481 | Combined Assembly of Gp0112041, Gp0112042, Gp0112043 | Environmental | Open in IMG/M |
| 3300005581 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF | Environmental | Open in IMG/M |
| 3300005805 | Microbial and algae communities from Cheney Reservoir in Wichita, Kansas, USA | Environmental | Open in IMG/M |
| 3300005826 | Microbial communities from Baker Bay sediment, Columbia River estuary, Washington - S.186_BBA | Environmental | Open in IMG/M |
| 3300006734 | Marine viral communities from the Gulf of Mexico - 31_GoM_OMZ_CsCl metaG | Environmental | Open in IMG/M |
| 3300006802 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 | Environmental | Open in IMG/M |
| 3300006920 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 | Environmental | Open in IMG/M |
| 3300007538 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaG | Environmental | Open in IMG/M |
| 3300007542 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG | Environmental | Open in IMG/M |
| 3300008108 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-C-NA | Environmental | Open in IMG/M |
| 3300008448 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - August 4, 2014 all contigs | Environmental | Open in IMG/M |
| 3300008450 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - Oct 27, 2014 all contigs | Environmental | Open in IMG/M |
| 3300009009 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 1-3cm September2015 | Environmental | Open in IMG/M |
| 3300009026 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.575 | Environmental | Open in IMG/M |
| 3300009082 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 1-3cm May2015 | Environmental | Open in IMG/M |
| 3300009085 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 10-12cm September2015 | Environmental | Open in IMG/M |
| 3300009165 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 1-3cm September2015 | Environmental | Open in IMG/M |
| 3300009169 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm May2015 | Environmental | Open in IMG/M |
| 3300011334 | Lotic viral community from Han River, Hwacheon, Gangwon-do, South Korea - Daesung | Environmental | Open in IMG/M |
| 3300011336 | Lotic viral community from Han River, Hwacheon, Gangwon-do, South Korea - Paldang | Environmental | Open in IMG/M |
| 3300012722 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES163 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012729 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES157 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300013004 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES118 metaG | Environmental | Open in IMG/M |
| 3300013372 | Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPs | Environmental | Open in IMG/M |
| 3300017736 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.D.N | Environmental | Open in IMG/M |
| 3300017754 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.D.D | Environmental | Open in IMG/M |
| 3300017774 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.D | Environmental | Open in IMG/M |
| 3300017780 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.D.N | Environmental | Open in IMG/M |
| 3300017971 | Hypersaline lake sediment archaeal communities from the Salton Sea, California, USA - SS_3_D_2 metaG | Environmental | Open in IMG/M |
| 3300019784 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300020159 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_108 megahit1 | Environmental | Open in IMG/M |
| 3300020162 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_201 megahit1 | Environmental | Open in IMG/M |
| 3300020190 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015013 Mahale N5 surface | Environmental | Open in IMG/M |
| 3300020498 | Freshwater microbial communities from Lake Mendota, WI - 13JUN2010 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020527 | Freshwater microbial communities from Lake Mendota, WI - 24AUG2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020529 | Freshwater microbial communities from Lake Mendota, WI - 07SEP2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020535 | Freshwater microbial communities from Lake Mendota, WI - 25JUL2011 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020539 | Freshwater microbial communities from Lake Mendota, WI - 13SEP2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020549 | Freshwater microbial communities from Lake Mendota, WI - 12OCT2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300021092 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015021 Mahale Deep Cast 10m | Environmental | Open in IMG/M |
| 3300021961 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_3D | Environmental | Open in IMG/M |
| 3300022200 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (v3) | Environmental | Open in IMG/M |
| 3300022407 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300024351 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepA_0h | Environmental | Open in IMG/M |
| 3300024853 | Metatranscriptome of freshwater microbial communities from St. Lawrence River, New York, United States - Law_Yuk_RepC_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300025057 | Marine viral communities from the Gulf of Mexico - 31_GoM_OMZ_CsCl metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025635 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_0.3_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025646 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025655 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025747 | Metatranscriptome of freshwater microbial communities from St. Lawrence River, New York, United States - Law_Cont_RepB_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300025889 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 (SPAdes) | Environmental | Open in IMG/M |
| 3300026429 | Metatranscriptome of freshwater microbial communities from St. Lawrence River, New York, United States - Law_Law_RepC_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300027299 | Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Cont_RepB_8d | Environmental | Open in IMG/M |
| 3300027693 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 1-3cm September2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027785 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027798 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD (SPAdes) | Environmental | Open in IMG/M |
| 3300028105 | Metatranscriptome of freshwater microbial communities from St. Lawrence River, New York, United States - Law_Atlam_RepA_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031539 | Soil microbial communities from Risofladan, Vaasa, Finland - UN-3 | Environmental | Open in IMG/M |
| 3300031758 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123 | Environmental | Open in IMG/M |
| 3300031999 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_20 | Environmental | Open in IMG/M |
| 3300032116 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA119 | Environmental | Open in IMG/M |
| 3300033980 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME09Aug2015-rr0007 | Environmental | Open in IMG/M |
| 3300033981 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Aug2014-rr0011 | Environmental | Open in IMG/M |
| 3300033993 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2012-rr0037 | Environmental | Open in IMG/M |
| 3300033995 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23May2014-rr0056 | Environmental | Open in IMG/M |
| 3300033996 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2016-rr0004 | Environmental | Open in IMG/M |
| 3300034019 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Sep2014-rr0049 | Environmental | Open in IMG/M |
| 3300034062 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Jul2012-rr0045 | Environmental | Open in IMG/M |
| 3300034104 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Aug2005-rr0120 | Environmental | Open in IMG/M |
| 3300034109 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME26Aug2009-rr0158 | Environmental | Open in IMG/M |
| 3300034121 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME19May2015-rr0174 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| BBAY94_100371804 | 3300000949 | Macroalgal Surface | IFMIKLLIDLAPFEKGEVLSVGKTYDTYLVDKGMAVWVKVDKEKIKTK* |
| B570J29032_1092692613 | 3300002408 | Freshwater | LAPVEKGEVLSVGKTYDTYLVEKGMAVWVKVDKEKIKTK* |
| B570J29032_1098570604 | 3300002408 | Freshwater | MIKLLIDLAPFEKGEVLSVGKTYDTYLVEKGMAVWVKVDKQDYKKK* |
| B570J40625_10000319118 | 3300002835 | Freshwater | MIKLLVDLAPFHKDEVISVGKTYDTYLVNKGLAIWVKMDKQEIKTK* |
| B570J40625_10001999210 | 3300002835 | Freshwater | MIKLLIDLAPFQKGEILTVGKTYDTYLVDKGLAVWIKVDKQDYKKK* |
| B570J40625_1011226551 | 3300002835 | Freshwater | MIKLLIDLAPFEKGEVLSVGKTYDTYLVEKGMAVWVKVDKEKIKTK* |
| JGI25909J50240_11240921 | 3300003393 | Freshwater Lake | INSIFMIKLLVDLEPFKKDEILSVGKTYDTYLVDKGLAVWIKVDKQDYKKK* |
| Ga0069718_149583252 | 3300004481 | Sediment | MIKLLVDLVPFEKGEILSVGKTYDTYLVDKGLAVWIKVDKQEIKKK* |
| Ga0049081_102470472 | 3300005581 | Freshwater Lentic | MIKLLVDLVPFEKGEIICVGKTYNTYLVDKGLAVWIKVEKQDFKTK* |
| Ga0079957_10234274 | 3300005805 | Lake | MIKLLVDLEPFRKGEILSVGKTYDAYLVDKGLAVWIKVDKQDFEKK* |
| Ga0079957_12110011 | 3300005805 | Lake | PFQKGEILTVGKTYDTYLVDKGLAVWIKVDKQEIKTK* |
| Ga0074477_11820834 | 3300005826 | Sediment (Intertidal) | MVKLLVDLVPFEKGEIITVGKIYDTYLVEKGLAVWIKVQKQDFKKK* |
| Ga0098073_10067304 | 3300006734 | Marine | MIKLLIDLAPFEKGEVLSVGKTYDSYLVDKGLAVWVKVNKEKIKTK* |
| Ga0070749_100564532 | 3300006802 | Aqueous | MIKLLVDLAPFMKGEVLSVGKTYDTYLVDKGLAVWVKMDKQDFKKK* |
| Ga0070749_101967101 | 3300006802 | Aqueous | MIKLLVDLVPFEKGEVICVGKTYNTYLVDKGLAVWIKVDKKEFKTK* |
| Ga0070748_10640382 | 3300006920 | Aqueous | MIKLLVDLAPFMKGEVLSVGKTYDTYLVDKGLAVWVKMDKQDYKKK* |
| Ga0070748_11939542 | 3300006920 | Aqueous | MIKLLIDLAPFEKGEVLSVGKTYDTYLVDKGMAVWVKVDKEKIKTK* |
| Ga0099851_10023678 | 3300007538 | Aqueous | MIKLLVDLEPFQKGEILSVGKTYDTYLVDKGLAVWIKVDKQDFKKK* |
| Ga0099846_10196556 | 3300007542 | Aqueous | MIKLLVDLEPFQKGEILSVGKTYDTYLVDKGLAVWIKVDIQDFKKK* |
| Ga0099846_13300351 | 3300007542 | Aqueous | KAFNEINSIFMIKLLVDLEPFRKGEILSVGKTYDTYLVDKGLAVWIKVDKQDFEKK* |
| Ga0114341_102179723 | 3300008108 | Freshwater, Plankton | MIKLLVDLEPFRKGEILSVGKTYDTYLVDKGLAVWIKVDKKDFEKK* |
| Ga0114876_100147714 | 3300008448 | Freshwater Lake | MIKLLIDLAPFQKGEVLSVGKTYDTYLVDKGMAVWVKVDKEKFKTK* |
| Ga0114876_11573542 | 3300008448 | Freshwater Lake | MIKLLTDIEPFKEGEVLSVGKTIDSYLVRKGLAVWVKVSKPQYRTK* |
| Ga0114880_10701293 | 3300008450 | Freshwater Lake | MIKLLVDLVPFEKGEIICVGKTYNTYLVNKGLAVWIKVEKQDFKTK* |
| Ga0114880_11096252 | 3300008450 | Freshwater Lake | MIKLLIDYQPFTKGEVLTFGKEKDAQLVEKGLAVWVKISDLNFKKK* |
| Ga0105105_102978442 | 3300009009 | Freshwater Sediment | MIKLLVDLAPFMKGEVLSVGKTYDTYLVDKGLAVWVKMDKQEIKTK* |
| Ga0105105_107422712 | 3300009009 | Freshwater Sediment | MIKLLIDLAPFEKGEVLSVGKTYDTYLVDKGMAVWVKMDKEKIKTK* |
| Ga0102829_10370892 | 3300009026 | Estuarine | MIKLLVDLSPFQKGEVLTVGKTYDTYLVDKGLAVWVKMNKQEIKTK* |
| Ga0105099_103887473 | 3300009082 | Freshwater Sediment | IFMIKLLVDLAPFMKGEVLSVGKTYDTYLVDKGLAVWVKMDKQEIKTK* |
| Ga0105103_105474302 | 3300009085 | Freshwater Sediment | DLAPFMKGEVLSVGKTYDTYLVDKGMAVWVKVDKQDYKKK* |
| Ga0105103_106266272 | 3300009085 | Freshwater Sediment | MIKLLIDLVPFEKGEIITVGKTYDTYLVNKGMAVWVKVDKQEIKTK* |
| Ga0105102_100039695 | 3300009165 | Freshwater Sediment | LESEKTFNEINTIFMIKLLVDLAPFMKGEVLSVGKTYDTYLVDKGLAVWVKVDKEKFKTK |
| Ga0105102_100493882 | 3300009165 | Freshwater Sediment | MIKLLIDLAPFQKGEVLSVGKTYDTYLVDKGMAVWVKVDKQDYKKK* |
| Ga0105102_103366352 | 3300009165 | Freshwater Sediment | MIKLLIDLAPFMKGEVLSVGKTYDTYLVEKGMAVWVKVDKEKIKTK* |
| Ga0105102_105148851 | 3300009165 | Freshwater Sediment | MIKLLIDLAPFQKGEILTVGKTYDTYLVDKGLAVWVKMDKQDFKTK* |
| Ga0105102_106091622 | 3300009165 | Freshwater Sediment | MIKLLVDLAPFHKGEVISVGKTYDTYLVDKGLAVWVKIDKQEIKTK* |
| Ga0105097_101467721 | 3300009169 | Freshwater Sediment | MIKLLVDLEPFRKGEILSVGKTYDTYLVDKGMAVWVKVDKQDYKKK* |
| Ga0153697_15185 | 3300011334 | Freshwater | MIKLLVDLEPFRKGEILSVGKTYDTYLVDKGLAVWIKVDKQDFEKK* |
| Ga0153703_130831 | 3300011336 | Freshwater | DLEPFQKGEILSVGKTYDTYLVDKGLAVWIKVDKQDFKKK* |
| Ga0157630_10486351 | 3300012722 | Freshwater | KGEVLSVGKTYDTYLVDKGMAVWVKVDKEKIKTK* |
| Ga0157625_10323252 | 3300012729 | Freshwater | MIKLLIDLAPFQKGEVLSVGKTYDTYLVDKGMAVWVKVDKEKIKTK* |
| Ga0164293_100171464 | 3300013004 | Freshwater | MIKLLVDLAPFQKGEVISVGKTYDTYLVNKGLAIWVKMDKQEIKTK* |
| Ga0164293_100414749 | 3300013004 | Freshwater | MIKLLIDLEPFRKGEILTVGKTYDTYLVDKGLAIWIKVDKQEIKTK* |
| Ga0177922_105486673 | 3300013372 | Freshwater | MIKLLVDLEPFKKDEILSVGKTYDTYLVNNGLAVWIKMDKQDYKKK* |
| Ga0181365_10506264 | 3300017736 | Freshwater Lake | VDLEPFKKDEILSVGKTYDTYLVDKGLAVWIKVDKQDYKKK |
| Ga0181344_11666892 | 3300017754 | Freshwater Lake | MIKLLIDLAPFQKGEILTVGKTYDTYLVDKGLAVWIKVD |
| Ga0181344_12370132 | 3300017754 | Freshwater Lake | MIKLLVDLAPFMKGEVLSVGKTYDTYLVDKGLAVWVKMDKQDFK |
| Ga0181358_10727762 | 3300017774 | Freshwater Lake | MIKLLVDLSPFEKGEVISVGKTYDTYLVDKGLAVWVKMDKQDYKKK |
| Ga0181346_10147911 | 3300017780 | Freshwater Lake | SIFMIKLLVDLSPFQKGEVLTVGKTYDTYLVDKGLAVWVKMNKQEIKTK |
| Ga0181346_10405635 | 3300017780 | Freshwater Lake | IFMIKLLVDLEPFKKDEILTVGKTYDTYLVDKGLAVWIKVDKQDYKKK |
| Ga0180438_111049911 | 3300017971 | Hypersaline Lake Sediment | MIKLLIDLAPFEKGEVLSVGKTYDTYLVDKGMAVWVKVDKEKIKTK |
| Ga0181359_10933392 | 3300019784 | Freshwater Lake | MIKLLVDLEPFKKDEILSVGKTYDTYLVNNGLAVWIKMDKQDYKKK |
| Ga0211734_107312342 | 3300020159 | Freshwater | MIKLLEDLIPFEKGEIICVGKTYNTYLVNKGLAVWIKVDKEEIKKK |
| Ga0211735_101636612 | 3300020162 | Freshwater | MIKLLVDLEPFQKGEILSVGKTYDTYLVDKGLAVWIKVDKQDFKKK |
| Ga0194118_101768183 | 3300020190 | Freshwater Lake | MIKLLVDLVPFQKGEIICVGKTYNTYLVNKGLAVWIKVEKQDFKTK |
| Ga0208050_10182292 | 3300020498 | Freshwater | MIKLLVDLTPFHKGEVLSVGKTYDTYLVDKGLAVWVKMDKQEIKTK |
| Ga0208232_10008109 | 3300020527 | Freshwater | MIKLLVDLAPFHKDEVISVGKTYDTYLVNKGLAIWVKMDKQEIKTK |
| Ga0208233_10369212 | 3300020529 | Freshwater | MIKLLIDLAPFEKGEVLSVGKTYDTYLVEKGMAVWVKVDKQDYKKK |
| Ga0208228_10306402 | 3300020535 | Freshwater | MIKLLIDLAPFEKGEVLSVGKTYDTYLVEKGMAVWVKVDKEKIKTK |
| Ga0207941_10160731 | 3300020539 | Freshwater | GIFMIKLLIDLAPFEKGEVLSVGKTYDTYLVDKGMAVWVKVDKEKIKTK |
| Ga0207942_10417181 | 3300020549 | Freshwater | MIKLLIDLAPFEKGEVLSVGKTYDTYLVEKGMAVWV |
| Ga0194122_103186472 | 3300021092 | Freshwater Lake | MIKLLVDLVPFQKGEIICVGKTYNTYLVNKGLAVWIKVEKQ |
| Ga0222714_1000138926 | 3300021961 | Estuarine Water | MIKLLVDLEPFQKGEILSVGKTYDAYLVDKGLAVWIKVDKQDFKKK |
| Ga0222714_100031894 | 3300021961 | Estuarine Water | MIKLLVDLEPFRKGEILSVGKTYDTYLVDKGLAVWIKVDKQDFEKK |
| Ga0196901_10725432 | 3300022200 | Aqueous | MIKLLVDLEPFKKGEILSVGKTYDTYLVDKGLAVWIKVDKQDFEKK |
| Ga0181351_10615332 | 3300022407 | Freshwater Lake | MIKLLVDLAPFQKGEVISVGKTYDTYLVDKGLAVWVKMDKQEIKKK |
| Ga0181351_11225261 | 3300022407 | Freshwater Lake | TFNEINSIFMIKLLVDLEPFKKDEILSVGKTYDTYLVDKGLAVWIKVDKQDYKKK |
| Ga0255141_10222183 | 3300024351 | Freshwater | MIKLLVDLVPFEKGEIICVGKTYNTYLVNKGLAVWIKVEKQDFKTK |
| Ga0255252_10022028 | 3300024853 | Freshwater | LIPFEKGEIICVGKTYNTYLVNKGLAVWIKVDKEEIKKK |
| Ga0208018_1174152 | 3300025057 | Marine | MIKLLIDLAPFEKGEVLSVGKTYDSYLVDKGLAVWVKVNKEKIKTK |
| Ga0208147_11012082 | 3300025635 | Aqueous | MIKLLVDLAPFMKGEVLSVGKTYDTYLVDKGLAVWVKMDKQDFKKK |
| Ga0208161_10073874 | 3300025646 | Aqueous | MIKLLIDLAPFEKGEILSVGKTYDEYLVNKGMAVWVKVDKEKIKTK |
| Ga0208795_10874763 | 3300025655 | Aqueous | MIKLLVDLEPFQKGEILSVGKTYDTYLVDKGLAVWI |
| Ga0208795_11630352 | 3300025655 | Aqueous | TFNEINTIFMIKLLVDLEPFQKGEILSVGKTYDTYLVDKGLAVWIKVDKQDFKKK |
| Ga0255247_10201681 | 3300025747 | Freshwater | DLIPFEKGEIICVGKTYNTYLVNKGLAVWIKVDKEEIKKK |
| Ga0208644_12285042 | 3300025889 | Aqueous | MIKLLVDLAPFMKGEVLSVGKTYDTYLVDKGLAVWVKMDKQDFKKKXARLDL |
| Ga0255253_10168844 | 3300026429 | Freshwater | FEKGEIICVGKTYNTYLVNKGLAVWIKVDKEEIKKK |
| Ga0255124_10738322 | 3300027299 | Freshwater | IKLLEDLIPFEKGEIICVGKTYNTYLVNKGLAVWIKVDKEEIKKK |
| Ga0209704_10001426 | 3300027693 | Freshwater Sediment | MIKLLVDLAPFMKGEVLSVGKTYDTYLVDKGLAVWVKMDKQDYKKK |
| Ga0209704_10054232 | 3300027693 | Freshwater Sediment | MIKLLIDLLPFQKGEVLSVGKTYDTYLVDKGMAVWVKVDKEKIKTK |
| Ga0209704_10141882 | 3300027693 | Freshwater Sediment | MIKLLIDLAPFQKGEVLSVGKTYDTYLVDKGMAVWVKVDKQDYKKK |
| Ga0209704_10447442 | 3300027693 | Freshwater Sediment | MIKLLVDLAPFMKGEVLSVGKTYDTYLVDKGLAVWVKVDKEKFKTK |
| Ga0209704_11239652 | 3300027693 | Freshwater Sediment | MIKLLIDLIPFEKGEIITVGKTYDTYLVNKGMAVWVKVDKQEIKTK |
| Ga0209246_100012391 | 3300027785 | Freshwater Lake | MIKLLVDLEPFKKDEILSVGKTYDTYLVDKGLAVW |
| Ga0209353_1000531310 | 3300027798 | Freshwater Lake | MIKLLVDLEPFKKDEILSVGKTYDTYLVDKGLAVWIKVDKQDYKKK |
| Ga0255254_10023031 | 3300028105 | Freshwater | KTFDKINSIFMIKLLEDLIPFEKGEIICVGKTYNTYLVNKGLAVWIKVDKEEIKKK |
| Ga0307380_104600462 | 3300031539 | Soil | MIKLLVDLAPFEKGEVICVGKTYNTYFVDKGLAVWIKLDKQEFKKK |
| Ga0315907_1000145344 | 3300031758 | Freshwater | MIKLLVDLVPFEKGEVICVGKTYNTYLVDKGLAVWIKVDKKEFKTK |
| Ga0315274_118902152 | 3300031999 | Sediment | MIKLLVDLEPFKKDEILSVGKTYDTYLVEKGLAVWIKVDKQDYKKKXA |
| Ga0315903_107733373 | 3300032116 | Freshwater | APFQKGEILTVGKTYDTYLVDKGLAVWIKVDKQDYKKK |
| Ga0315903_109378661 | 3300032116 | Freshwater | MIKLLVDLVPFQKGEILSVGKTYDTYLVDKGLAVWIKVDKQEIKKK |
| Ga0334981_0312067_4_132 | 3300033980 | Freshwater | LIDLAPFEKGEVLSVGKTYDTYLVEKGMAVWVKVDKEKIKTK |
| Ga0334982_0246841_613_753 | 3300033981 | Freshwater | MIKLLIDLAPFQKGEVLSVGKTYDTYLVDKGMAVWVKVDKEKIKTK |
| Ga0334982_0429810_161_301 | 3300033981 | Freshwater | MIKLLVDLAPFQKGEVLTVGKTYDTYLVDKGLAVWVKMDKQEIETK |
| Ga0334994_0056971_963_1103 | 3300033993 | Freshwater | MIKLLVDLAPFHKGEVISVGKTYDTYLVDKGLAVWVKMDKQEIETK |
| Ga0335003_0106800_1039_1179 | 3300033995 | Freshwater | MIKLLIDLEPFRKGEILTVGKTYDTYLVDKGLAIWIKVDKQEIKTK |
| Ga0334979_0025358_1989_2129 | 3300033996 | Freshwater | MIKLLVDLAPFQKGEVISVGKTYDTYLVNKGLAIWVKMDKQEIETK |
| Ga0334979_0483968_3_131 | 3300033996 | Freshwater | LIDLAPFQKGEILTVGKTYDTYLVDKGLAVWIKVDKQDYKKK |
| Ga0334998_0266588_305_445 | 3300034019 | Freshwater | MIKLLVDLAPFMKGEVLSVGKTYDTYLVDKGMAVWVKVDKQDYKKK |
| Ga0334995_0224498_417_557 | 3300034062 | Freshwater | MIKLLVDIPPFKEGEVITVGKTYDSYLVRKNLAVWVKVPRQNYRTK |
| Ga0335031_0324943_272_412 | 3300034104 | Freshwater | MIKLLIDLAPFQKGEVLSVGKTYDTYLVDKGMAVWVKVDKEKFKTK |
| Ga0335051_0004055_1317_1457 | 3300034109 | Freshwater | MIKLLVDLAPFHKDEVISVGKTYDTYLVDKGLAVWVKMDKQEIKTK |
| Ga0335058_0600322_239_379 | 3300034121 | Freshwater | MIKLLVDLAPFHKGEVISVGKTYDTYLVDKGLAIWVKMDKQEIKTK |
| ⦗Top⦘ |