NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F098975

Metagenome / Metatranscriptome Family F098975

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F098975
Family Type Metagenome / Metatranscriptome
Number of Sequences 103
Average Sequence Length 43 residues
Representative Sequence MKIEQIETTVLEMPYTKPLVTATNNFTVARGLLVKVVTDGGSE
Number of Associated Samples 90
Number of Associated Scaffolds 103

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 91.26 %
% of genes near scaffold ends (potentially truncated) 94.17 %
% of genes from short scaffolds (< 2000 bps) 83.50 %
Associated GOLD sequencing projects 88
AlphaFold2 3D model prediction Yes
3D model pTM-score0.41

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (100.000 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere
(19.417 % of family members)
Environment Ontology (ENVO) Unclassified
(23.301 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(38.835 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 0.00%    β-sheet: 29.58%    Coil/Unstructured: 70.42%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.41
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 103 Family Scaffolds
PF02310B12-binding 10.68
PF12681Glyoxalase_2 6.80
PF04055Radical_SAM 5.83
PF01863YgjP-like 5.83
PF00903Glyoxalase 4.85
PF01797Y1_Tnp 2.91
PF13378MR_MLE_C 2.91
PF00496SBP_bac_5 1.94
PF07883Cupin_2 1.94
PF11867DUF3387 1.94
PF10047DUF2281 1.94
PF13379NMT1_2 0.97
PF08281Sigma70_r4_2 0.97
PF00856SET 0.97
PF09084NMT1 0.97
PF07978NIPSNAP 0.97
PF00528BPD_transp_1 0.97
PF08402TOBE_2 0.97
PF02746MR_MLE_N 0.97
PF07355GRDB 0.97
PF04313HSDR_N 0.97
PF04002RadC 0.97

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 103 Family Scaffolds
COG1451UTP pyrophosphatase, metal-dependent hydrolase familyGeneral function prediction only [R] 5.83
COG1943REP element-mobilizing transposase RayTMobilome: prophages, transposons [X] 2.91
COG4948L-alanine-DL-glutamate epimerase or related enzyme of enolase superfamilyCell wall/membrane/envelope biogenesis [M] 1.94
COG0715ABC-type nitrate/sulfonate/bicarbonate transport system, periplasmic componentInorganic ion transport and metabolism [P] 0.97
COG2003DNA repair protein RadC, contains a helix-hairpin-helix DNA-binding motifReplication, recombination and repair [L] 0.97
COG4521ABC-type taurine transport system, periplasmic componentInorganic ion transport and metabolism [P] 0.97

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms100.00 %
UnclassifiedrootN/A0.00 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000793|AF_2010_repII_A001DRAFT_10084431All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium676Open in IMG/M
3300000890|JGI11643J12802_10144291All Organisms → cellular organisms → Bacteria1794Open in IMG/M
3300000956|JGI10216J12902_101136796All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium647Open in IMG/M
3300004013|Ga0055465_10206234All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium647Open in IMG/M
3300004156|Ga0062589_101008510All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium778Open in IMG/M
3300004782|Ga0062382_10573391All Organisms → cellular organisms → Bacteria550Open in IMG/M
3300005328|Ga0070676_11586256All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium505Open in IMG/M
3300005332|Ga0066388_100035660All Organisms → cellular organisms → Bacteria → Proteobacteria4795Open in IMG/M
3300005444|Ga0070694_100035623All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria3291Open in IMG/M
3300005546|Ga0070696_101668922All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium549Open in IMG/M
3300005549|Ga0070704_100078256All Organisms → cellular organisms → Bacteria2425Open in IMG/M
3300005561|Ga0066699_10656172All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium752Open in IMG/M
3300005874|Ga0075288_1005466All Organisms → cellular organisms → Bacteria1620Open in IMG/M
3300005895|Ga0075277_1036477All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium731Open in IMG/M
3300005900|Ga0075272_1031003All Organisms → cellular organisms → Bacteria987Open in IMG/M
3300005937|Ga0081455_10097146All Organisms → cellular organisms → Bacteria2374Open in IMG/M
3300006049|Ga0075417_10031177All Organisms → cellular organisms → Bacteria2209Open in IMG/M
3300006049|Ga0075417_10063704All Organisms → cellular organisms → Bacteria1619Open in IMG/M
3300006797|Ga0066659_11362272All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium592Open in IMG/M
3300006844|Ga0075428_100393404All Organisms → cellular organisms → Bacteria1485Open in IMG/M
3300006844|Ga0075428_101682227All Organisms → cellular organisms → Bacteria662Open in IMG/M
3300006845|Ga0075421_101329090All Organisms → cellular organisms → Bacteria794Open in IMG/M
3300006847|Ga0075431_100314966All Organisms → cellular organisms → Bacteria1579Open in IMG/M
3300006847|Ga0075431_101252650All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium703Open in IMG/M
3300006871|Ga0075434_100352202All Organisms → cellular organisms → Bacteria1493Open in IMG/M
3300006871|Ga0075434_100443452All Organisms → cellular organisms → Bacteria1319Open in IMG/M
3300006871|Ga0075434_100842023All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium933Open in IMG/M
3300006880|Ga0075429_100505063All Organisms → cellular organisms → Bacteria1060Open in IMG/M
3300006903|Ga0075426_11042559All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium619Open in IMG/M
3300006903|Ga0075426_11191187All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium578Open in IMG/M
3300006904|Ga0075424_101451473All Organisms → cellular organisms → Bacteria728Open in IMG/M
3300009147|Ga0114129_10177990All Organisms → cellular organisms → Bacteria2896Open in IMG/M
3300009157|Ga0105092_10727500All Organisms → cellular organisms → Bacteria578Open in IMG/M
3300009157|Ga0105092_10859455All Organisms → cellular organisms → Bacteria534Open in IMG/M
3300009162|Ga0075423_10039227All Organisms → cellular organisms → Bacteria4839Open in IMG/M
3300009162|Ga0075423_10435050All Organisms → cellular organisms → Bacteria1378Open in IMG/M
3300009506|Ga0118657_10789222All Organisms → cellular organisms → Bacteria1185Open in IMG/M
3300010359|Ga0126376_10412972All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium1220Open in IMG/M
3300010360|Ga0126372_10020086All Organisms → cellular organisms → Bacteria3917Open in IMG/M
3300010360|Ga0126372_10501400All Organisms → cellular organisms → Bacteria1140Open in IMG/M
3300010361|Ga0126378_11006967All Organisms → cellular organisms → Bacteria937Open in IMG/M
3300010361|Ga0126378_11077871All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium905Open in IMG/M
3300010375|Ga0105239_10078941All Organisms → cellular organisms → Bacteria3622Open in IMG/M
3300010376|Ga0126381_100898912All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium1275Open in IMG/M
3300010400|Ga0134122_10423770All Organisms → cellular organisms → Bacteria → Proteobacteria1182Open in IMG/M
3300010401|Ga0134121_12293000All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium578Open in IMG/M
3300010938|Ga0137716_10018144All Organisms → cellular organisms → Bacteria10808Open in IMG/M
3300011409|Ga0137323_1068277All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium783Open in IMG/M
3300011439|Ga0137432_1078852All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium1014Open in IMG/M
3300011444|Ga0137463_1060402All Organisms → cellular organisms → Bacteria1416Open in IMG/M
3300012039|Ga0137421_1189180All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium606Open in IMG/M
3300012171|Ga0137342_1005912All Organisms → cellular organisms → Bacteria1917Open in IMG/M
3300012202|Ga0137363_10607025All Organisms → cellular organisms → Bacteria924Open in IMG/M
3300012902|Ga0157291_10213656All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium619Open in IMG/M
3300012923|Ga0137359_10925341All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium751Open in IMG/M
3300012944|Ga0137410_11394378All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium609Open in IMG/M
3300012948|Ga0126375_11207877All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium630Open in IMG/M
3300012951|Ga0164300_10308609All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium831Open in IMG/M
3300012987|Ga0164307_11716975All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium532Open in IMG/M
3300013100|Ga0157373_11073441All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium603Open in IMG/M
3300013102|Ga0157371_10190721All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1467Open in IMG/M
3300014866|Ga0180090_1038483All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium792Open in IMG/M
3300015373|Ga0132257_102754724All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium640Open in IMG/M
3300015374|Ga0132255_103811041All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium641Open in IMG/M
3300018031|Ga0184634_10456994All Organisms → cellular organisms → Bacteria575Open in IMG/M
3300018054|Ga0184621_10089962All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium1076Open in IMG/M
3300018063|Ga0184637_10059058All Organisms → cellular organisms → Bacteria2344Open in IMG/M
3300018072|Ga0184635_10417363All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium506Open in IMG/M
3300018077|Ga0184633_10044458All Organisms → cellular organisms → Bacteria2253Open in IMG/M
3300018079|Ga0184627_10002749All Organisms → cellular organisms → Bacteria → Proteobacteria7448Open in IMG/M
3300018082|Ga0184639_10385875All Organisms → cellular organisms → Bacteria725Open in IMG/M
3300018083|Ga0184628_10534594All Organisms → cellular organisms → Bacteria602Open in IMG/M
3300021081|Ga0210379_10284410All Organisms → cellular organisms → Bacteria721Open in IMG/M
3300021082|Ga0210380_10111686All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium1212Open in IMG/M
3300021432|Ga0210384_11897055All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium502Open in IMG/M
3300025312|Ga0209321_10117398All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium1454Open in IMG/M
3300025903|Ga0207680_10969282All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium609Open in IMG/M
3300025912|Ga0207707_10730562All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium829Open in IMG/M
3300025933|Ga0207706_10013915All Organisms → cellular organisms → Bacteria7295Open in IMG/M
3300025933|Ga0207706_10028034All Organisms → cellular organisms → Bacteria5031Open in IMG/M
3300025939|Ga0207665_10534956All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium909Open in IMG/M
3300026075|Ga0207708_11136173All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium682Open in IMG/M
3300026088|Ga0207641_10403704All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1313Open in IMG/M
3300027778|Ga0209464_10181773All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium746Open in IMG/M
3300027873|Ga0209814_10002780All Organisms → cellular organisms → Bacteria6460Open in IMG/M
3300027886|Ga0209486_10972116All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria568Open in IMG/M
3300027909|Ga0209382_10627412All Organisms → cellular organisms → Bacteria1166Open in IMG/M
3300027909|Ga0209382_12054990All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium546Open in IMG/M
3300028420|Ga0210366_10402443All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium572Open in IMG/M
3300031548|Ga0307408_100078404All Organisms → cellular organisms → Bacteria2462Open in IMG/M
3300031820|Ga0307473_11222450All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium559Open in IMG/M
3300031858|Ga0310892_10056718All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria1971Open in IMG/M
3300031947|Ga0310909_10584106All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium934Open in IMG/M
3300032002|Ga0307416_101097078All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria900Open in IMG/M
3300032003|Ga0310897_10705359All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium506Open in IMG/M
3300032179|Ga0310889_10597374All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium569Open in IMG/M
3300032180|Ga0307471_101055920All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium979Open in IMG/M
3300032180|Ga0307471_103760896All Organisms → cellular organisms → Bacteria537Open in IMG/M
3300032205|Ga0307472_101997792All Organisms → cellular organisms → Bacteria581Open in IMG/M
3300032828|Ga0335080_12398112All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium503Open in IMG/M
3300033481|Ga0316600_10396701All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium946Open in IMG/M
3300034147|Ga0364925_0245855All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium664Open in IMG/M
3300034148|Ga0364927_0117591All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium748Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere19.42%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment7.77%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil6.80%
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil5.83%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere4.85%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil3.88%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil3.88%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil2.91%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil2.91%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil2.91%
Rice Paddy SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil2.91%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment1.94%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment1.94%
Wetland SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment1.94%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil1.94%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil1.94%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil1.94%
SedimentEnvironmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment1.94%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere1.94%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere1.94%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere1.94%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere1.94%
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine0.97%
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands0.97%
Mangrove SedimentEnvironmental → Aquatic → Marine → Wetlands → Sediment → Mangrove Sediment0.97%
Hot Spring Fe-Si SedimentEnvironmental → Aquatic → Thermal Springs → Hot (42-90C) → Neutral → Hot Spring Fe-Si Sediment0.97%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.97%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.97%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil0.97%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil0.97%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil0.97%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere0.97%
Tabebuia Heterophylla RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere0.97%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.97%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.97%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere0.97%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere0.97%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000793Forest soil microbial communities from Amazon forest - 2010 replicate II A001EnvironmentalOpen in IMG/M
3300000890Soil microbial communities from Great Prairies - Iowa, Continuous Corn soilEnvironmentalOpen in IMG/M
3300000956Soil microbial communities from Great Prairies - Kansas, Native Prairie soilEnvironmentalOpen in IMG/M
3300004013Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailA_D2EnvironmentalOpen in IMG/M
3300004156Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1EnvironmentalOpen in IMG/M
3300004782Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare2FreshEnvironmentalOpen in IMG/M
3300005328Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaGHost-AssociatedOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005444Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaGEnvironmentalOpen in IMG/M
3300005546Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaGEnvironmentalOpen in IMG/M
3300005549Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaGEnvironmentalOpen in IMG/M
3300005561Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148EnvironmentalOpen in IMG/M
3300005874Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_0N_404EnvironmentalOpen in IMG/M
3300005895Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_10C_0N_101EnvironmentalOpen in IMG/M
3300005900Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_5C_0N_404EnvironmentalOpen in IMG/M
3300005937Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1Host-AssociatedOpen in IMG/M
3300006049Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1Host-AssociatedOpen in IMG/M
3300006797Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108EnvironmentalOpen in IMG/M
3300006844Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2Host-AssociatedOpen in IMG/M
3300006845Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5Host-AssociatedOpen in IMG/M
3300006847Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5Host-AssociatedOpen in IMG/M
3300006871Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3Host-AssociatedOpen in IMG/M
3300006880Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3Host-AssociatedOpen in IMG/M
3300006903Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5Host-AssociatedOpen in IMG/M
3300006904Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3Host-AssociatedOpen in IMG/M
3300009147Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2)Host-AssociatedOpen in IMG/M
3300009157Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm March2015EnvironmentalOpen in IMG/M
3300009162Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2Host-AssociatedOpen in IMG/M
3300009506Mangrove sediment microbial communities from Mai Po Nature Reserve Marshes in Hong Kong, China - Maipo_8EnvironmentalOpen in IMG/M
3300010359Tropical forest soil microbial communities from Panama - MetaG Plot_15EnvironmentalOpen in IMG/M
3300010360Tropical forest soil microbial communities from Panama - MetaG Plot_6EnvironmentalOpen in IMG/M
3300010361Tropical forest soil microbial communities from Panama - MetaG Plot_23EnvironmentalOpen in IMG/M
3300010375Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaGHost-AssociatedOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300010400Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2EnvironmentalOpen in IMG/M
3300010401Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1EnvironmentalOpen in IMG/M
3300010938Sediment microbial community from Chocolate Pots hot springs, Yellowstone National Park, Wyoming, USA. Combined Assembly of Gp0156111, Gp0156114, Gp0156117EnvironmentalOpen in IMG/M
3300011409Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT423_2EnvironmentalOpen in IMG/M
3300011439Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT820_2EnvironmentalOpen in IMG/M
3300011444Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT800_2EnvironmentalOpen in IMG/M
3300012039Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT534_2EnvironmentalOpen in IMG/M
3300012171Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT466_2EnvironmentalOpen in IMG/M
3300012202Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaGEnvironmentalOpen in IMG/M
3300012902Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S169-409C-1EnvironmentalOpen in IMG/M
3300012923Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaGEnvironmentalOpen in IMG/M
3300012944Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012948Tropical forest soil microbial communities from Panama - MetaG Plot_14EnvironmentalOpen in IMG/M
3300012951Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MGEnvironmentalOpen in IMG/M
3300012987Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MGEnvironmentalOpen in IMG/M
3300013100Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaGHost-AssociatedOpen in IMG/M
3300013102Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaGHost-AssociatedOpen in IMG/M
3300014866Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT890_16_10DEnvironmentalOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300018031Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b1EnvironmentalOpen in IMG/M
3300018054Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_b1EnvironmentalOpen in IMG/M
3300018063Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b2EnvironmentalOpen in IMG/M
3300018072Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b2EnvironmentalOpen in IMG/M
3300018077Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b1EnvironmentalOpen in IMG/M
3300018079Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b1EnvironmentalOpen in IMG/M
3300018082Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b2EnvironmentalOpen in IMG/M
3300018083Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_b1EnvironmentalOpen in IMG/M
3300021081Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_coex redoEnvironmentalOpen in IMG/M
3300021082Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_coex redoEnvironmentalOpen in IMG/M
3300021432Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-MEnvironmentalOpen in IMG/M
3300025312Soil microbial communities from Rifle, Colorado, USA - sediment 16ft 4 - CSP-I_5_4EnvironmentalOpen in IMG/M
3300025903Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025912Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025933Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025939Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026075Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026088Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300027778Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare1Fresh (SPAdes)EnvironmentalOpen in IMG/M
3300027873Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 (SPAdes)Host-AssociatedOpen in IMG/M
3300027886Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost (SPAdes)EnvironmentalOpen in IMG/M
3300027909Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes)Host-AssociatedOpen in IMG/M
3300028420Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Washington, United States ? S.641 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031548Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3Host-AssociatedOpen in IMG/M
3300031820Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515EnvironmentalOpen in IMG/M
3300031858Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D2EnvironmentalOpen in IMG/M
3300031947Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000HEnvironmentalOpen in IMG/M
3300032002Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3Host-AssociatedOpen in IMG/M
3300032003Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D1EnvironmentalOpen in IMG/M
3300032179Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D2EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300032205Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05EnvironmentalOpen in IMG/M
3300032828Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4EnvironmentalOpen in IMG/M
3300033481Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day5_CTEnvironmentalOpen in IMG/M
3300034147Sediment microbial communities from East River floodplain, Colorado, United States - 44_j17EnvironmentalOpen in IMG/M
3300034148Sediment microbial communities from East River floodplain, Colorado, United States - 18_j17EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
AF_2010_repII_A001DRAFT_1008443113300000793Forest SoilMKVAQIETAVLEMPYIKPLVTAANNFTVARGVLAKVV
JGI11643J12802_1014429113300000890SoilMKIETIETTILEMPYTKPLITATNHFTVARGLLVKVVTDGGLPGY
JGI10216J12902_10113679623300000956SoilMKIGKVTNIETTILEMPYTKPLVTATNNFTVARGILVKVITE
Ga0055465_1020623423300004013Natural And Restored WetlandsVRIAQIETTKLEMPYKKPLVTATNNFTVARGLLVKAVTDEGVEGYGYS
Ga0062589_10100851023300004156SoilMKIEKITTKKLEMPYTKPLVTATNNFTVARGLLVTVVTNGG
Ga0062382_1057339123300004782Wetland SedimentMKVESIDTKMLEMPYTKPLVTATNNFTVARGLLVTVVTNGGVEGY
Ga0070676_1158625613300005328Miscanthus RhizosphereMKIGKVTNIETTVLEMPYTKPLVTATNNFTVARGILVKVITEGGIEG
Ga0066388_10003566053300005332Tropical Forest SoilMRIEQIETTVLEMPYTKPLVTATNNFTVACGVLAKVVTDTGMEG
Ga0070694_10003562353300005444Corn, Switchgrass And Miscanthus RhizosphereMKIGKVTNIETTSLEMPYTKPLVTATNNFTVARGILVKVITEGGIEG
Ga0070696_10166892213300005546Corn, Switchgrass And Miscanthus RhizosphereMKIGKVTNIETTVLEMPYTKPLVTATNNFTVARGILVKVITEGGIE
Ga0070704_10007825643300005549Corn, Switchgrass And Miscanthus RhizosphereMKIGKVTNIETTSLEMPYTKPLVTATNNFTVARGILVKVITEGGIEGYGYSD
Ga0066699_1065617213300005561SoilMKIGKVGNIETTVLEMPYTKPLVTATNNFTVARGLLVKV
Ga0075288_100546613300005874Rice Paddy SoilMKIARIDTRALEMPYTKPLVTATNNFTVARGLLVTVVTDS
Ga0075277_103647723300005895Rice Paddy SoilMKIGKVAKVETTILEMPYSKPLVTATNNFTVARGLLVKVITE
Ga0075272_103100323300005900Rice Paddy SoilMKIGKVAKVETTILEMPYSKPLVTATNNFTVARGLLVKVITEGGIEGYG
Ga0081455_1009714633300005937Tabebuia Heterophylla RhizosphereMKIDRIETTGLEMPYKKPLITATNNFTVARGSGGVLE*
Ga0075417_1003117713300006049Populus RhizosphereMRIEQIETTVLEMPYTKPLVTATNNFTVARGLLVKVITDGGLEGYG
Ga0075417_1006370423300006049Populus RhizosphereVKIEQIETTVLEMPYTKPLVTATNNFTVARGLLVKVITDGGLEG
Ga0066659_1136227213300006797SoilMKIGKVGNIETTVLEMPYTKRLVTATNNFTVARGLLVKVITD
Ga0075428_10039340413300006844Populus RhizosphereMRIEQIETTVLEMPYTKPLVTATNNFTVARGLLVKVITDGGLEGYGY
Ga0075428_10168222713300006844Populus RhizosphereMKIGKVINIETTILEMPYTKPLVTATNNFTVARGILVKVITEGGIEG
Ga0075421_10132909013300006845Populus RhizosphereMKIDTIETTVLEMPYEKPLVTATNNFTVARGLLVKVITDGGLEGYGY
Ga0075431_10031496633300006847Populus RhizosphereMRIEQIETTVLEMPYTKPLVTATNNFTVARGLLVKVI
Ga0075431_10125265013300006847Populus RhizosphereVKIEQIETTVLEMPYTKPLVTATNNFTVARGLLVKVITDGGLE
Ga0075434_10035220213300006871Populus RhizosphereMRIEQIETTVLEMPYTKPLVTATNNFTVARGLLVKVITN
Ga0075434_10044345223300006871Populus RhizosphereVKIDQIETTVLEMPYKKPLVTATNNFTVARGLLVKVVTDAGVEGY
Ga0075434_10084202313300006871Populus RhizosphereMKIGKVAGVETRLLEMPYTKPLVTATNNFTVARGLL
Ga0075429_10050506323300006880Populus RhizosphereMKIDTIETTVLEMPYEKPLVTATNNFTVARGLLVKVITDGGL
Ga0075426_1104255923300006903Populus RhizosphereMKIGKVINIETTILEMPYTKPLVTATNNFTVARGIL
Ga0075426_1119118723300006903Populus RhizosphereMKIGKVAGVETRLLEMPYTKPLVTATNNFTVARGLLVKVITD
Ga0075424_10145147323300006904Populus RhizosphereMRIEQIETTVLEMPYTKPLVTATNNFTVARGLLVKVITNGGLEGYGY
Ga0114129_1017799043300009147Populus RhizosphereVKIEQIETTVLEMPYTKPLVTATNNFTVARGLLVKVITNGGLEG
Ga0105092_1072750013300009157Freshwater SedimentMKIEHIETTVLEMPYKKPLVTATNNFTVARGLLVKLVTDDGVE
Ga0105092_1085945513300009157Freshwater SedimentMKIKQIETTVLEMPYKKPLVTATNNFTVARGLLVKLVTDDGVEGYGY
Ga0075423_1003922713300009162Populus RhizosphereMKIGKVTNIETTSLEMPYTKPLVTATNNFTVARGILVKVITEGGIEGYGY
Ga0075423_1043505043300009162Populus RhizosphereVKIEQIETTVLEMPYTKPLVTATNNFTVARGLLVKVITNGGLEGYGY
Ga0118657_1078922223300009506Mangrove SedimentMKIEHIESTILEMPYKKPLITATNKFVVARGVLVKVIAAGIDGYGYADLF
Ga0126376_1041297223300010359Tropical Forest SoilMKVAQIETTVLEMPYTKPLVTATNNFTVACGVLAKVVTDTGMEGLRL
Ga0126372_1002008613300010360Tropical Forest SoilVKIEQIETTVLEMPYIKPLVTATNNFTVARGILAKVVTDTAVEGYGYAD
Ga0126372_1050140013300010360Tropical Forest SoilMKCYAVEIQMKVERIETTVLEMPYTKPLVTATNNFTVARGILAKVVTDTAVEGYG
Ga0126378_1100696733300010361Tropical Forest SoilMRIEQIETTVLEMPYTKPLVTATNNFTVACGVLAKVVTDTGMEGLRLR
Ga0126378_1107787113300010361Tropical Forest SoilMKIGKVATVETTILEMPYTKPLVTATNNFTVARGI
Ga0105239_1007894153300010375Corn RhizosphereMKIGKVINIETTILEMPYTKPLVTATNNFTVAHGILVK
Ga0126381_10089891223300010376Tropical Forest SoilVKIEQIETTVLEMPYKKPLVTATNNFTLARGLLIKVVTNAEW
Ga0134122_1042377013300010400Terrestrial SoilMKIGKVTNIETTILEMPYTKPLVTATNNFTVARGILVKVITEGG
Ga0134121_1229300023300010401Terrestrial SoilMKIGKVTNIETTILEMPYTKPLVTATNNFTVARGILVKVI
Ga0137716_10018144143300010938Hot Spring Fe-Si SedimentMKIAKIDTRVLELPYTKPLVTATNNFTVARGLLVTVASETGI
Ga0137323_106827723300011409SoilMKIERVETKKLEMPYIKPLVTATNNFTVARGLLVTV
Ga0137432_107885213300011439SoilMKIERVETKKLEMPYIKPLVTATNNFTVARGLLVTVATNGG
Ga0137463_106040233300011444SoilMKIESVETEKLEMPYTKPLVTATNTFTVASGLLVTVRTNGGVEGY
Ga0137421_118918013300012039SoilMKIEKIDTKKLEMPYTKPLVTATNNFTVARGLLVTVVTQSGVEGYGYADL
Ga0137342_100591213300012171SoilVIPVKINRIETTKLDMPYKKPLVTATNNFTIARGLLVKAVTDEGVEGY
Ga0137363_1060702513300012202Vadose Zone SoilMKIEQIETTVLEMPYTKPLVTATNNFTVARGLLVKVVTDGGSE
Ga0157291_1021365613300012902SoilMKIEKIDTKKLEMPYTKPLVTATNNFTVARGLLVTVVTSGGVE
Ga0137359_1092534113300012923Vadose Zone SoilMKIGKVAGIETTQLEMPYTKPLVTATNNFTVARGLLVKVITD
Ga0137410_1139437813300012944Vadose Zone SoilMKIGKVAGIETTQLAMPYTKPLVTETNNFTVARGLLVKV
Ga0126375_1120787713300012948Tropical Forest SoilVKIEQIETTVLEMPYKKPLVTATNNFTLARGLLIKVVTNAEWKD
Ga0164300_1030860923300012951SoilMTIGKVTGVETSLLEMPYTKPLVTATNNFTVARGLLAKVITDG
Ga0164307_1171697513300012987SoilMKIGKVINIETTILEMPYTKPLVTATNNFTVAHGILVKVITEG
Ga0157373_1107344113300013100Corn RhizosphereMKIGKVTNIETTVLEMPYTKPLVTATNNFTVARGILVKVITE
Ga0157371_1019072133300013102Corn RhizosphereMKIGKVTNIETTVLEMPYTKPLVTATNNFTVARGILVKVITEGGIEGYG
Ga0180090_103848323300014866SoilMKIVQIETHILEMPYTKPLVTATNNFTVARGLLVKVVTDGGV*
Ga0132257_10275472413300015373Arabidopsis RhizosphereMTTGKVTGVETSLLAMPYTKPLVTATNNFTVARGLLAKVITDGGIEGYG
Ga0132255_10381104113300015374Arabidopsis RhizosphereMKIGKVTNIETTSLEMPYTKPLVTATNNFTVARGILVKV
Ga0184634_1045699413300018031Groundwater SedimentMKIAQIETRLLEMPYTKPLITATNNFTVARGLLVKAVTGATCCCRGS
Ga0184621_1008996213300018054Groundwater SedimentMKVTDVETRTLEMPYTKPLVTATNNFTVARGVLVKVVT
Ga0184637_1005905833300018063Groundwater SedimentMKIAQVETRALEMPYTKPLITATNNFTVARGLLVKAVTGATCCCRGS
Ga0184635_1041736323300018072Groundwater SedimentMKIASIDTRTLEMPYTKPLVTATNNFTVARGLLVTVV
Ga0184633_1004445833300018077Groundwater SedimentMKIAQIETRALEMPYTKPLITATNNFTVARGLLVKAVTDAGVEGYG
Ga0184627_1000274963300018079Groundwater SedimentMKIAQIETRALEMPYTKPLITATNNFTVARGLLVKAVTGATCCCRGS
Ga0184639_1038587513300018082Groundwater SedimentMKIEKVETKKLEMLYTKPLVTATNNFTVARGLLVT
Ga0184628_1053459413300018083Groundwater SedimentMKIERVETKKLEMPYTKPLVTATNNFTVARGLLVTVR
Ga0210379_1028441013300021081Groundwater SedimentVKINRIETTKLDMPYRKPLVTATNNFTIARGLLVK
Ga0210380_1011168613300021082Groundwater SedimentMKIEKIETRKLEMPYTKPLVTATNNFTVARGLLVTVGTHGGV
Ga0210384_1189705523300021432SoilMKVIQIETTVLEMPYTKPLVTATNNFTVARGVLAKVVTNTGVEGYGYADLF
Ga0209321_1011739813300025312SoilMKIAQIETRPLEMPYTRPLVAATNNFTVARGLLVKAVMD
Ga0207680_1096928223300025903Switchgrass RhizosphereMKIGKVTNIETTVLEMPYTKPLVTATNNFTVARGILVKVITEGGIEGYGY
Ga0207707_1073056223300025912Corn RhizosphereMKIGKVTNIETTSLEMPYTKPLVTATNNFTVARGILVKVITEGGIEGYGYS
Ga0207706_1001391593300025933Corn RhizosphereMKIGKVTNIETTSLEMPYTKPLVTATNNFTVARGILVKVITEGGI
Ga0207706_1002803413300025933Corn RhizosphereMKIGKVINIETTILEMPYTKPLVTATNNFTVARGILVKVITEGGI
Ga0207665_1053495623300025939Corn, Switchgrass And Miscanthus RhizosphereMKIGKVAGVETRLLEMPYTKPLVTATNNFTVARGLLVKVIT
Ga0207708_1113617323300026075Corn, Switchgrass And Miscanthus RhizosphereMKIERVETKKLEMPYTKPLVTATNNFTVARGLLVTVRTNG
Ga0207641_1040370423300026088Switchgrass RhizosphereMTIGKVTGVETSLLEMPYTKPLVTATNNFTVARGL
Ga0209464_1018177313300027778Wetland SedimentMKVESIDTKMLEMPYTKPLVTATNNFTVARGLLVTVVTNGGVEGYGYA
Ga0209814_1000278093300027873Populus RhizosphereVKIEQIETTVLEMPYTKPLVTATNNFTVARGLLVKVITDGGIEGYGY
Ga0209486_1097211623300027886Agricultural SoilMKIETVETTVLEMPYTKPLITATNHFTVARGLLVRVV
Ga0209382_1062741233300027909Populus RhizosphereMRIEQIETTVLEMPYTKPLVTATNNFTVARGLLVKVITD
Ga0209382_1205499013300027909Populus RhizosphereMRIEQIESTVLEMPYIKPLVTATNNFTVACGLLVKVVTDGGLEGY
Ga0210366_1040244313300028420EstuarineMKIGKIAKVETTVLEMPYSKPLVTATNNFTVARGLLVKVVTDG
Ga0307408_10007840433300031548RhizosphereMKIEKIATKKLEMPYTKPLVTATNNFTVARGLLVTVVTSGGVEGYG
Ga0307473_1122245023300031820Hardwood Forest SoilMKVIQVETIVLEMPYTKPLITATNNFTVARGVLAKVVTNTG
Ga0310892_1005671833300031858SoilMKIETVETTILEMPYSKPLITATNHFTVARGLLVKVVTDGGVS
Ga0310909_1058410623300031947SoilMKIDQIETTVLEMPYIKPLVTATNNFTVARGLLVKVITD
Ga0307416_10109707823300032002RhizosphereMKIKTVETTVLEMPYTKPLITATNHFTVARGLLVKVVTDKGAQG
Ga0310897_1070535923300032003SoilMKIEKIATKKLEMPYTKPLVTATNNFTVARGLLVTV
Ga0310889_1059737413300032179SoilMKIEKIDTKKLEMPYTKPLVTATNNFTVARGLLVTVVT
Ga0307471_10105592013300032180Hardwood Forest SoilMTIGKVTGVETSLLEMPYTKPLVTATNNFTVARGLLAK
Ga0307471_10376089613300032180Hardwood Forest SoilMKIDQIETTVLEMPYTKPLVTATNNFTVACGLLVKVVTDGGI
Ga0307472_10199779213300032205Hardwood Forest SoilMIIDQIETTVLEMPYKKPLVTATNNFTVARGLLVKVVTDAGVEG
Ga0335080_1239811213300032828SoilMKINQIETTVLEMPYTKPLVTATNNFTVARGVLVKAITDSGIEGYGYA
Ga0316600_1039670113300033481SoilMKIEKIDTKKLEMPYTKPLVTATNNFTVARGLLVTVVTQGGVEGYGYAD
Ga0364925_0245855_388_5223300034147SedimentVKINRIETTKLDMPYKKPLVTATNNFTIAHGLLVKAVTDEGVEG
Ga0364927_0117591_627_7463300034148SedimentIETTKLDMPYKKPLVTATNNFTIAHGLLVKAVTDEGVEG

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.