NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F098853

Metagenome / Metatranscriptome Family F098853

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F098853
Family Type Metagenome / Metatranscriptome
Number of Sequences 103
Average Sequence Length 55 residues
Representative Sequence MELTLERYLQDEGLREELERRAHRERAEQMHHYFARAAQALRIPHVPEPRTGACG
Number of Associated Samples 87
Number of Associated Scaffolds 103

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 85.44 %
% of genes near scaffold ends (potentially truncated) 17.48 %
% of genes from short scaffolds (< 2000 bps) 85.44 %
Associated GOLD sequencing projects 85
AlphaFold2 3D model prediction Yes
3D model pTM-score0.53

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (85.437 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil
(66.990 % of family members)
Environment Ontology (ENVO) Unclassified
(76.699 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Subsurface (non-saline)
(86.408 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 45.78%    β-sheet: 0.00%    Coil/Unstructured: 54.22%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.53
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 103 Family Scaffolds
PF00106adh_short 38.83
PF11142DUF2917 37.86
PF13561adh_short_C2 7.77
PF00126HTH_1 4.85
PF03466LysR_substrate 3.88
PF08240ADH_N 2.91
PF07992Pyr_redox_2 0.97
PF00293NUDIX 0.97
PF027373HCDH_N 0.97
PF00753Lactamase_B 0.97

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 103 Family Scaffolds
COG0240Glycerol-3-phosphate dehydrogenaseEnergy production and conversion [C] 0.97
COG0287Prephenate dehydrogenaseAmino acid transport and metabolism [E] 0.97
COG0677UDP-N-acetyl-D-mannosaminuronate dehydrogenaseCell wall/membrane/envelope biogenesis [M] 0.97
COG1004UDP-glucose 6-dehydrogenaseCell wall/membrane/envelope biogenesis [M] 0.97
COG12503-hydroxyacyl-CoA dehydrogenaseLipid transport and metabolism [I] 0.97
COG1748Saccharopine dehydrogenase, NADP-dependentAmino acid transport and metabolism [E] 0.97
COG20843-hydroxyisobutyrate dehydrogenase or related beta-hydroxyacid dehydrogenaseLipid transport and metabolism [I] 0.97

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms85.44 %
UnclassifiedrootN/A14.56 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300002121|C687J26615_10164112All Organisms → cellular organisms → Bacteria562Open in IMG/M
3300005336|Ga0070680_101493209All Organisms → cellular organisms → Bacteria → Proteobacteria585Open in IMG/M
3300006845|Ga0075421_100013143All Organisms → cellular organisms → Bacteria → Proteobacteria10311Open in IMG/M
3300009091|Ga0102851_11330094All Organisms → cellular organisms → Bacteria795Open in IMG/M
3300009597|Ga0105259_1064593All Organisms → cellular organisms → Bacteria → Proteobacteria832Open in IMG/M
3300009597|Ga0105259_1105293All Organisms → cellular organisms → Bacteria → Proteobacteria670Open in IMG/M
3300009609|Ga0105347_1069516All Organisms → cellular organisms → Bacteria1289Open in IMG/M
3300009610|Ga0105340_1575642All Organisms → cellular organisms → Bacteria502Open in IMG/M
3300009678|Ga0105252_10040771All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1731Open in IMG/M
3300009678|Ga0105252_10356480All Organisms → cellular organisms → Bacteria664Open in IMG/M
3300011391|Ga0137331_1013252All Organisms → cellular organisms → Bacteria → Proteobacteria780Open in IMG/M
3300011395|Ga0137315_1032658All Organisms → cellular organisms → Bacteria → Proteobacteria718Open in IMG/M
3300011395|Ga0137315_1056659All Organisms → cellular organisms → Bacteria → Proteobacteria563Open in IMG/M
3300011397|Ga0137444_1011756All Organisms → cellular organisms → Bacteria1152Open in IMG/M
3300011408|Ga0137460_1022000All Organisms → cellular organisms → Bacteria1028Open in IMG/M
3300011408|Ga0137460_1064451All Organisms → cellular organisms → Bacteria → Proteobacteria695Open in IMG/M
3300011409|Ga0137323_1098963Not Available646Open in IMG/M
3300011410|Ga0137440_1010162All Organisms → cellular organisms → Bacteria1479Open in IMG/M
3300011415|Ga0137325_1131076All Organisms → cellular organisms → Bacteria → Proteobacteria573Open in IMG/M
3300011419|Ga0137446_1001003All Organisms → cellular organisms → Bacteria → Proteobacteria3885Open in IMG/M
3300011419|Ga0137446_1063917All Organisms → cellular organisms → Bacteria → Proteobacteria840Open in IMG/M
3300011423|Ga0137436_1001872All Organisms → cellular organisms → Bacteria → Proteobacteria5590Open in IMG/M
3300011424|Ga0137439_1172180All Organisms → cellular organisms → Bacteria → Proteobacteria512Open in IMG/M
3300011425|Ga0137441_1130398All Organisms → cellular organisms → Bacteria621Open in IMG/M
3300011428|Ga0137456_1001182All Organisms → cellular organisms → Bacteria → Proteobacteria3730Open in IMG/M
3300011428|Ga0137456_1189915All Organisms → cellular organisms → Bacteria555Open in IMG/M
3300011432|Ga0137428_1160910All Organisms → cellular organisms → Bacteria → Proteobacteria664Open in IMG/M
3300011434|Ga0137464_1014672All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium2049Open in IMG/M
3300011438|Ga0137451_1000812All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria9611Open in IMG/M
3300011439|Ga0137432_1120407All Organisms → cellular organisms → Bacteria832Open in IMG/M
3300011445|Ga0137427_10099262Not Available1175Open in IMG/M
3300012034|Ga0137453_1081662All Organisms → cellular organisms → Bacteria → Proteobacteria626Open in IMG/M
3300012035|Ga0137445_1078389Not Available664Open in IMG/M
3300012040|Ga0137461_1114292All Organisms → cellular organisms → Bacteria → Proteobacteria779Open in IMG/M
3300012040|Ga0137461_1166513All Organisms → cellular organisms → Bacteria650Open in IMG/M
3300012041|Ga0137430_1156326All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria658Open in IMG/M
3300012113|Ga0137328_1012022Not Available765Open in IMG/M
3300012129|Ga0137345_1056202All Organisms → cellular organisms → Bacteria → Proteobacteria511Open in IMG/M
3300012137|Ga0137346_1021723Not Available790Open in IMG/M
3300012142|Ga0137343_1025330All Organisms → cellular organisms → Bacteria → Proteobacteria795Open in IMG/M
3300012143|Ga0137354_1060770All Organisms → cellular organisms → Bacteria → Proteobacteria602Open in IMG/M
3300012146|Ga0137322_1000500All Organisms → cellular organisms → Bacteria → Proteobacteria3330Open in IMG/M
3300012152|Ga0137347_1107195All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria503Open in IMG/M
3300012157|Ga0137353_1019213Not Available1131Open in IMG/M
3300012163|Ga0137355_1014315All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1411Open in IMG/M
3300012163|Ga0137355_1105221Not Available542Open in IMG/M
3300012164|Ga0137352_1027598Not Available1081Open in IMG/M
3300012174|Ga0137338_1152763All Organisms → cellular organisms → Bacteria503Open in IMG/M
3300012179|Ga0137334_1008367All Organisms → cellular organisms → Bacteria → Proteobacteria1898Open in IMG/M
3300012225|Ga0137434_1068137All Organisms → cellular organisms → Bacteria → Proteobacteria560Open in IMG/M
3300012226|Ga0137447_1020487All Organisms → cellular organisms → Bacteria → Proteobacteria1012Open in IMG/M
3300012232|Ga0137435_1003444All Organisms → cellular organisms → Bacteria → Proteobacteria4621Open in IMG/M
3300012671|Ga0137318_1001248All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1650Open in IMG/M
3300012673|Ga0137339_1002547All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1258Open in IMG/M
3300012675|Ga0137337_1054794All Organisms → cellular organisms → Bacteria626Open in IMG/M
3300014862|Ga0180096_1005780All Organisms → cellular organisms → Bacteria → Proteobacteria845Open in IMG/M
3300014863|Ga0180060_1015659All Organisms → cellular organisms → Bacteria870Open in IMG/M
3300014870|Ga0180080_1009273Not Available1229Open in IMG/M
3300014870|Ga0180080_1011608All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1140Open in IMG/M
3300014871|Ga0180095_1080031All Organisms → cellular organisms → Bacteria → Proteobacteria602Open in IMG/M
3300014873|Ga0180066_1024134All Organisms → cellular organisms → Bacteria1131Open in IMG/M
3300014874|Ga0180084_1048935All Organisms → cellular organisms → Bacteria836Open in IMG/M
3300014878|Ga0180065_1003451All Organisms → cellular organisms → Bacteria → Proteobacteria2872Open in IMG/M
3300014880|Ga0180082_1020086All Organisms → cellular organisms → Bacteria1361Open in IMG/M
3300014883|Ga0180086_1155250Not Available596Open in IMG/M
3300014884|Ga0180104_1139523All Organisms → cellular organisms → Bacteria → Proteobacteria710Open in IMG/M
3300015248|Ga0180079_1017899Not Available858Open in IMG/M
3300015249|Ga0180071_1034542All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria711Open in IMG/M
3300015253|Ga0180081_1040712All Organisms → cellular organisms → Bacteria → Proteobacteria772Open in IMG/M
3300015255|Ga0180077_1036902Not Available937Open in IMG/M
3300015257|Ga0180067_1011314All Organisms → cellular organisms → Bacteria → Proteobacteria1582Open in IMG/M
3300015257|Ga0180067_1032784All Organisms → cellular organisms → Bacteria1048Open in IMG/M
3300018059|Ga0184615_10181399All Organisms → cellular organisms → Bacteria → Proteobacteria1187Open in IMG/M
3300018059|Ga0184615_10251054All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria991Open in IMG/M
3300018063|Ga0184637_10267011All Organisms → cellular organisms → Bacteria1041Open in IMG/M
3300018068|Ga0184636_1330184All Organisms → cellular organisms → Bacteria534Open in IMG/M
3300018079|Ga0184627_10044910All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium2271Open in IMG/M
3300018084|Ga0184629_10124241All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1287Open in IMG/M
3300019229|Ga0180116_1194655All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria530Open in IMG/M
3300019238|Ga0180112_1062666Not Available550Open in IMG/M
3300019244|Ga0180111_1023034All Organisms → cellular organisms → Bacteria → Proteobacteria501Open in IMG/M
3300020060|Ga0193717_1045210All Organisms → cellular organisms → Bacteria → Proteobacteria1595Open in IMG/M
3300020063|Ga0180118_1094048All Organisms → cellular organisms → Bacteria → Proteobacteria503Open in IMG/M
3300020067|Ga0180109_1070509All Organisms → cellular organisms → Bacteria → Proteobacteria550Open in IMG/M
3300020067|Ga0180109_1194889All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria532Open in IMG/M
3300020068|Ga0184649_1478044All Organisms → cellular organisms → Bacteria1105Open in IMG/M
3300021081|Ga0210379_10175045All Organisms → cellular organisms → Bacteria919Open in IMG/M
3300021081|Ga0210379_10252214All Organisms → cellular organisms → Bacteria766Open in IMG/M
3300021090|Ga0210377_10004635All Organisms → cellular organisms → Bacteria → Proteobacteria11534Open in IMG/M
3300021090|Ga0210377_10121693All Organisms → cellular organisms → Bacteria1725Open in IMG/M
3300025160|Ga0209109_10122658All Organisms → cellular organisms → Bacteria → Proteobacteria1326Open in IMG/M
3300027573|Ga0208454_1025277All Organisms → cellular organisms → Bacteria1401Open in IMG/M
3300027909|Ga0209382_10029353All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria6632Open in IMG/M
3300028803|Ga0307281_10009123All Organisms → cellular organisms → Bacteria2738Open in IMG/M
3300028803|Ga0307281_10174999Not Available763Open in IMG/M
3300031455|Ga0307505_10001479All Organisms → cellular organisms → Bacteria → Proteobacteria18851Open in IMG/M
3300031576|Ga0247727_10035274All Organisms → cellular organisms → Bacteria6692Open in IMG/M
3300032144|Ga0315910_10152214All Organisms → cellular organisms → Bacteria → Proteobacteria1721Open in IMG/M
3300033812|Ga0364926_028273Not Available1037Open in IMG/M
3300033813|Ga0364928_0096273All Organisms → cellular organisms → Bacteria → Proteobacteria693Open in IMG/M
3300033815|Ga0364946_099325All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria645Open in IMG/M
3300034178|Ga0364934_0093855All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1125Open in IMG/M
3300034178|Ga0364934_0361479All Organisms → cellular organisms → Bacteria550Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil66.99%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment10.68%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment5.83%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil4.85%
SedimentEnvironmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment4.85%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere1.94%
Freshwater WetlandsEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands0.97%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.97%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere0.97%
SoilEnvironmental → Terrestrial → Soil → Loam → Unclassified → Soil0.97%
BiofilmEnvironmental → Terrestrial → Cave → Unclassified → Unclassified → Biofilm0.97%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300002121Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 10_1EnvironmentalOpen in IMG/M
3300005336Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaGEnvironmentalOpen in IMG/M
3300006845Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5Host-AssociatedOpen in IMG/M
3300009091Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300009597Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT299EnvironmentalOpen in IMG/M
3300009609Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT890EnvironmentalOpen in IMG/M
3300009610Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT700EnvironmentalOpen in IMG/M
3300009678Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT100EnvironmentalOpen in IMG/M
3300011391Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT163_2EnvironmentalOpen in IMG/M
3300011395Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT200_2EnvironmentalOpen in IMG/M
3300011397Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT319_2EnvironmentalOpen in IMG/M
3300011408Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT723_2EnvironmentalOpen in IMG/M
3300011409Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT423_2EnvironmentalOpen in IMG/M
3300011410Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT222_2EnvironmentalOpen in IMG/M
3300011415Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT469_2EnvironmentalOpen in IMG/M
3300011419Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT357_2EnvironmentalOpen in IMG/M
3300011423Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT119_2EnvironmentalOpen in IMG/M
3300011424Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT200_2EnvironmentalOpen in IMG/M
3300011425Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT244_2EnvironmentalOpen in IMG/M
3300011428Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT615_2EnvironmentalOpen in IMG/M
3300011432Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT718_2EnvironmentalOpen in IMG/M
3300011434Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT814_2EnvironmentalOpen in IMG/M
3300011438Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT500_2EnvironmentalOpen in IMG/M
3300011439Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT820_2EnvironmentalOpen in IMG/M
3300011445Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT700_2EnvironmentalOpen in IMG/M
3300012034Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT526_2EnvironmentalOpen in IMG/M
3300012035Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT338_2EnvironmentalOpen in IMG/M
3300012040Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT746_2EnvironmentalOpen in IMG/M
3300012041Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT754_2EnvironmentalOpen in IMG/M
3300012113Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT100_2EnvironmentalOpen in IMG/M
3300012129Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT530_2EnvironmentalOpen in IMG/M
3300012137Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT560_2EnvironmentalOpen in IMG/M
3300012142Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT499_2EnvironmentalOpen in IMG/M
3300012143Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT790_2EnvironmentalOpen in IMG/M
3300012146Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT400_2EnvironmentalOpen in IMG/M
3300012152Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT590_2EnvironmentalOpen in IMG/M
3300012157Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT760_2EnvironmentalOpen in IMG/M
3300012163Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT800_2EnvironmentalOpen in IMG/M
3300012164Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT730_2EnvironmentalOpen in IMG/M
3300012174Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT366_2EnvironmentalOpen in IMG/M
3300012179Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT262_2EnvironmentalOpen in IMG/M
3300012225Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT860_2EnvironmentalOpen in IMG/M
3300012226Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT400_2EnvironmentalOpen in IMG/M
3300012232Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT100_2EnvironmentalOpen in IMG/M
3300012671Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT300_2EnvironmentalOpen in IMG/M
3300012673Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT399_2EnvironmentalOpen in IMG/M
3300012675Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT333_2EnvironmentalOpen in IMG/M
3300014862Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT293_16_1DaEnvironmentalOpen in IMG/M
3300014863Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLIBT25_16_10DEnvironmentalOpen in IMG/M
3300014870Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT560_16_10DEnvironmentalOpen in IMG/M
3300014871Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT231_16_1DaEnvironmentalOpen in IMG/M
3300014873Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT200B_16_10DEnvironmentalOpen in IMG/M
3300014874Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT660_2_16_10DEnvironmentalOpen in IMG/M
3300014878Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT200A_16_10DEnvironmentalOpen in IMG/M
3300014880Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT660_16_10DEnvironmentalOpen in IMG/M
3300014883Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT760_16_10DEnvironmentalOpen in IMG/M
3300014884Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT730_16_1DaEnvironmentalOpen in IMG/M
3300015248Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT530_16_10DEnvironmentalOpen in IMG/M
3300015249Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT293A_16_10DEnvironmentalOpen in IMG/M
3300015253Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT590_16_10DEnvironmentalOpen in IMG/M
3300015255Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT466_16_10DEnvironmentalOpen in IMG/M
3300015257Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT231_16_10DEnvironmentalOpen in IMG/M
3300018059Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_65_coexEnvironmentalOpen in IMG/M
3300018063Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b2EnvironmentalOpen in IMG/M
3300018068Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_90_b2EnvironmentalOpen in IMG/M
3300018079Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b1EnvironmentalOpen in IMG/M
3300018084Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_b1EnvironmentalOpen in IMG/M
3300019229Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLT660_1_16_1Ra (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019238Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLT466_16_1Ra (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019244Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLT293_16_1Ra (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300020060Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2c2EnvironmentalOpen in IMG/M
3300020063Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLT730_16_1Ra (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300020067Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLIBT47_16_1Ra (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300020068Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_65 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021081Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_coex redoEnvironmentalOpen in IMG/M
3300021090Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_65_b1 redoEnvironmentalOpen in IMG/M
3300025160Soil microbial communities from Rifle, Colorado, USA - sediment 10ft 2EnvironmentalOpen in IMG/M
3300027573Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT100 (SPAdes)EnvironmentalOpen in IMG/M
3300027909Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes)Host-AssociatedOpen in IMG/M
3300028803Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_120EnvironmentalOpen in IMG/M
3300031455Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 23_SEnvironmentalOpen in IMG/M
3300031576Biofilm microbial communities from Wishing Well Cave, Virginia, United States - WW16-25EnvironmentalOpen in IMG/M
3300032144Garden soil microbial communities collected in Santa Monica, California, United States - Edamame soilEnvironmentalOpen in IMG/M
3300033812Sediment microbial communities from East River floodplain, Colorado, United States - 65_j17EnvironmentalOpen in IMG/M
3300033813Sediment microbial communities from East River floodplain, Colorado, United States - 30_j17EnvironmentalOpen in IMG/M
3300033815Sediment microbial communities from East River floodplain, Colorado, United States - 31_s17EnvironmentalOpen in IMG/M
3300034178Sediment microbial communities from East River floodplain, Colorado, United States - 27_j17EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
C687J26615_1016411223300002121SoilMELTLERYLEDEGLREELERRAHRERAEQMHLYFARAAQALRVPQVPQPRTGACA*
Ga0070680_10149320923300005336Corn RhizosphereVELTVERYLQDEGLREELERRAQRERAETMHRFFALAATALRVQPAPAPRPAACG*
Ga0075421_10001314353300006845Populus RhizosphereMELTLERYLQDEGLREELERRAHCERAEAMHRFFEQSTRALNLQRTPALRTDACG*
Ga0102851_1133009413300009091Freshwater WetlandsMNMELTYARYLQDEGLRDELERRAHRERAEQMHLYFAQAAQTMHMPRAPEPRADACA*
Ga0105259_106459323300009597SoilMELTLQRYLEDEGLREELERRAHRERAEQMHRYFARAAQAMRIPRLPESRTGTCA*
Ga0105259_110529323300009597SoilMERRTIMELTLARYLEDEGLREELERRAHRERAEQMHLYFAQAAQILHTPRVPEPRTDACA*
Ga0105347_106951633300009609SoilMELTFARYLEDQGLREELERRAHRERAEQMHLYFAQAAQILHMPRVPEPRTDACA*
Ga0105340_157564223300009610SoilMELTLQRYLEDEGLREELERRAHSERAEQMHRYFALAAQAMRIPRLPESRTGTCA*
Ga0105252_1004077123300009678SoilMELTLERYLEDEGLREELERRARNARAEQMHHYFARAAEAMRIARIPQPRTGACG*
Ga0105252_1035648033300009678SoilMALTLERYLEDEGLREELERRAHQERAESMHRFFAQSAQALSLPRNPELRAGTCG*
Ga0137331_101325223300011391SoilMELTFARYLEDEGLREELERRAHRERAEQMHLYFAQAAQILHMPRVPEPRTDACA*
Ga0137315_103265823300011395SoilMELTLERYLEDEGLREELERRAHQERAESMHRFFAQSAQALRLPRNPELRTGACG*
Ga0137315_105665923300011395SoilMELTLQRYLEDEGLREELERRAHRERAESMQRFFAQSAQALSLPRSPQLRADSCG*
Ga0137444_101175633300011397SoilMERRTIMELTLARYLEDEGLREELERRAHRERAEAMHDYFARAAQALRTPHVPGPRAGACA*
Ga0137460_102200023300011408SoilMALTLERYLQDEGLREELERRAHRERAEQMHRYFARAAQAMRIPRLPESRTGTCA*
Ga0137460_106445123300011408SoilMELTFARYLADEGLREELERRAHRERAEQMHLYFAQAAQILHMPRVPEPRTDACA*
Ga0137323_109896323300011409SoilMELTLERYLEDEGLREELERRARNARAEQMHHYFARAAEAMRIARVPQPRTGACG*
Ga0137440_101016223300011410SoilMELTFARYLADEGLREELERRAHRERAEQMHLYFAQAAQALHMPRAPEPRTDACA*
Ga0137325_113107623300011415SoilMERRTIMELTLARYLEDEGLREELERRAHRERAEQMHLYFAQAAQILHMPRVPEPRTDACA*
Ga0137446_100100353300011419SoilMELTFARYLADEGLREELERRAHRERAEQMHHYFAQAAQALHMPRAPEPRTDACA*
Ga0137446_106391723300011419SoilMELTLQRYLEDEGLREELERRAHRERAEQMHRYFARAAQAMRIPRLPES*
Ga0137436_100187263300011423SoilMTLTLERYLNDEGLREELERRAHRERAEQVHRYFALAAQAMRMPRAPESRTGTYA*
Ga0137439_117218023300011424SoilMELTLDRYLQDEGLREELERRAHRERAEAMHDYFARAAQDLRPPHVPGPRAGACA*
Ga0137441_113039823300011425SoilMTMELTLERYLQDEGLREELERRAHRERAEYMHRFFAQSAQALKLRRTLELRTGACG*
Ga0137456_100118223300011428SoilMQRRAIMELTFARYLADEGLREELERRAHRERAEQMHLYFAQAAQALHMPRAPEPRTDACA*
Ga0137456_118991513300011428SoilMELTLQRYLEDEGLREELERRAHRERAEQMHHYFAQAAQALHMPRAPEPRTDACA*
Ga0137428_116091013300011432SoilIMELTLARYLEDEGLREELERRAHRERAEQMHLYFAQAAQILHMPRVPEPRTDACA*
Ga0137464_101467213300011434SoilMELTLQRYLEDEGLREELERRAHSERAEQMHRYFARAAQAMRIPRLPESRTGTCA*
Ga0137451_100081233300011438SoilMELTFARYLADEGLREELERRAHRERAEQMHHYFAQAAQALHMPRASEPRTDACA*
Ga0137432_112040733300011439SoilMELTLQRFLEDEGLREELERRAHRERAERMHDYFARAAQALRIP
Ga0137427_1009926223300011445SoilMELTLARYLEDEGLREELERRAHRERAEQMHLYFAQAAQILHMPRVPEPRTDACA*
Ga0137453_108166213300012034SoilMALTLERYLNDEGLREELERRAHRERAEEMHRYFALAAQAMRIPRLPESRTGTCA*
Ga0137445_107838923300012035SoilEDEGLREELERRARDARAEQMHRYFARAAGAMRIPRLPQPRTGACG*
Ga0137461_111429223300012040SoilMELTLERYLQVEGLREELERRAHRERAERMHDYFARAAQALRIPHVPEPRTGACG*
Ga0137461_116651333300012040SoilMELTLQRYLEDEGLREELERRAHRERAEQMHHYFAQAAQALHMPRAP
Ga0137430_115632633300012041SoilMELTLQRYLEDEGLREELERRAHQERAESMHRFFAQSAQALRLPRNPELRTGA
Ga0137328_101202213300012113SoilMELTLERYLQDEGLREELERRAHCERAEQMYHYFARAAQALRIPHVPEPRTGACG*
Ga0137345_105620223300012129SoilLEDEGLREELERRAHRERAEQMHLYFAQAAQILHMPRVPEPRTDACA*
Ga0137346_102172323300012137SoilMALTLERYLQDEGLREELERRAHCERAEQMRHYFARAAQALRIPHVPEPRTGACG*
Ga0137343_102533023300012142SoilMELTLERYLRDEGLREELERRAHRERAESMHRFFAQSAQALSVPRTPEVRTDACG*
Ga0137354_106077023300012143SoilMELTLQRYLEDEGLREELERRAHRERAEQMHLNFAQAAQALHMPRAPEPRTDACA*
Ga0137322_100050023300012146SoilMERRTIMELTLARYLEDEGLREELERRAHRERAEQMHLYFAQAAQALHMPRAPEPRTDACA*
Ga0137347_110719523300012152SoilMELTLERYLQDEGLREELERRAHRERAETMHDYFARAAQALRTPHVPGPRAGACA*
Ga0137353_101921313300012157SoilSPWYTPLATPPWRSPDPMQRRAIMELTFARYLADEGLREELERRAHRERAEQMHLYFAQAAQILHMPRVPEPRTDACA*
Ga0137355_101431523300012163SoilMTLTLERYLNDEGLREELERRAHRERAEQVHRYFALAAQAMRMPRAPESRTGTCA*
Ga0137355_110522123300012163SoilMELTLQRYLEDEGLREELERRAHRERAEQMHRYFARAAQAMRIPRLP
Ga0137352_102759813300012164SoilMDLTLERYLQDEGLREELERRAHRERAEQMHHYFARAARAMRIPRVPEPRTYACG*
Ga0137338_115276323300012174SoilMELTLERYLQDEGLREELERRAHCERAEQMHHYFARAAQALRIPHVPEPRTGACG*
Ga0137334_100836713300012179SoilWYTPLATPPWRSPDPMQRRAIMELTFARYLADEGLREELERRAHRERAEQMHLYFAQAAQALHMPRAPEPRTDACA*
Ga0137434_106813713300012225SoilMELTLERYLDDEGLREELQRRAHHERAQAMHRYFARAAQAMRMPRVPEPRTDACG*
Ga0137447_102048733300012226SoilMELTYERYLADEELREELARRAHRERAEEMHRYFALAAQAMRIPRLPESRTGTCA*
Ga0137435_100344433300012232SoilMTLTLERYLNDEGLREELERRAHRERAEQVHRYFALAAQAMRMPRAPQSRTGTCA*
Ga0137318_100124833300012671SoilMELTLERYLEDAGLREELERRARDERAEQMHHYFARAAEAMRIARIPQPRTGACG*
Ga0137339_100254723300012673SoilMELTLERYLQDEGLREELERRSHCERAEQMHHYFARAAQALRIPHVPEPRTGACG*
Ga0137337_105479433300012675SoilMELTLERYLQDERLREELERRAHCERAVQMHHYFARVAQALRIPYVPE
Ga0180096_100578023300014862SoilMELTLERYLQDEGLREELERRAHRERAEQMHRYFARAAQALRIPHLPEPRPGACA*
Ga0180060_101565923300014863SoilMELTFARYLEDEGLREELERRAHRERAEQMHLYFAQAAQILHMPRAPEPRTDACA*
Ga0180080_100927323300014870SoilMELTLERYLQDERLREELERRAHCERAEQMRHYFARAAQALRIPHVPEPRAGACG*
Ga0180080_101160813300014870SoilMELTLERYLQDEGLREELERRAHRERAEQVHRYFALAAQAMRMPRAPESRTGTYA*
Ga0180095_108003123300014871SoilMQRRAIMELTFARYLADEGLREELERRAHRERAEQMHRYFARAAQAMRIPRLPESRTGTCA*
Ga0180066_102413433300014873SoilMELTLERYLEDEGLREELERRAHRERAEQMHRYFAQAAAALVGGDAPAAKLRTDACG*
Ga0180084_104893523300014874SoilMELTLQRYLEDEGLREELERRAHRERTELMHHYFARAAQALRIPHLREPRTDACG*
Ga0180065_100345133300014878SoilPWRSPDPMQRRAIMELTFARYLADEGLREELERRAHRERAEQMHLYFAQAAQALHMPRAPEPRTDACA*
Ga0180082_102008633300014880SoilMELTYARYLQDEGLRDELERRAHRERAEQMHHYFAQAAQALHMPRVPEPRTDACA*
Ga0180086_115525013300014883SoilMELTFARYLEDEGLREELERRAHRERAGQMHLYFAQAAQILHMPRVPEPRTDACA*
Ga0180104_113952323300014884SoilMGLTLERYLEDEGLREELERRAHQERAESMHRFFAQSAQALRLPRNPELRTGACG*
Ga0180079_101789923300015248SoilMELTLQRYLEDEGLREELERRAHRERAEQVHRYFALAAQAMRMPRAPESRTGTCA*
Ga0180071_103454223300015249SoilMELTLERYLQDEGLREELERRAHRARAEQMHHYFARAAQALRIPHVPEPRTGACG*
Ga0180081_104071223300015253SoilMELTLERYLQDEGLREELERRAHCERAKQMYHYFARAAQALRIPHVPEPRTGACG*
Ga0180077_103690223300015255SoilMELTLERYLEDEGLREELERRARDERAEQMHHYFARAAEAMRIARIPQPRTGACG*
Ga0180067_101131433300015257SoilLREELERRAHRERAEQMHRYFARAAQAMRIPRLPESRTGTCA*
Ga0180067_103278433300015257SoilMELTLERYLEDEGLREELERRAHRERAEQMHRYFARAAQAMRIPRLPESRTGTCA*
Ga0184615_1018139933300018059Groundwater SedimentMELTLERYLEDAGLREELERRAHRERAERMSLYFARAAEAMRIPRIPEPRTGACG
Ga0184615_1025105423300018059Groundwater SedimentMELTFARYLADEGLREELERRAHRERAEQMHLYFAQAAQALHMPRAPEPRTDACA
Ga0184637_1026701113300018063Groundwater SedimentMELTLVRYLEDEGLREELERRAHRERAEQMHCYFAQAAQALRIPHAPEPRTDACI
Ga0184636_133018423300018068Groundwater SedimentMTLTLERYLNDEGLREELERRAHRERAEQVHRYFALAAQAMRMPRAPESRTGTYA
Ga0184627_1004491043300018079Groundwater SedimentMELTLERYLKDEGLREELERRAHRERAEQMHCYFAQAAQALRIPHAPELRTDACI
Ga0184629_1012424123300018084Groundwater SedimentMELTLQRYLEDEGLREELERRAHRERAEQVHRYFALAAQAMRMPRAPESRTGTYA
Ga0180116_119465523300019229Groundwater SedimentMELTLDRYLQDEGLREELERRAHRERAEQMHRYFARAAQAMRIPRLPESRTGTCA
Ga0180112_106266623300019238Groundwater SedimentMELTLQRYLEDEGLREELERRAHSERAEQMHRYFALAAQAMRIPRLPESRTGTCA
Ga0180111_102303413300019244Groundwater SedimentLTLERYLQDEGLREELERRAHRERAESMHRFFAQSAQALDLPRTPALRTGPCA
Ga0193717_104521013300020060SoilMELTLERYLEDEGLREELERRAHRERAESMHHFFAQSAQALSLPRNPELRTGACG
Ga0180118_109404813300020063Groundwater SedimentLQDEGLREELERRAHRERAEQMHHYFARAAQALRIPHVPEPRTGACG
Ga0180109_107050923300020067Groundwater SedimentMELTLQRYLEDEGLREELERRAHLERAESMHRFFAQSAQALRLPRNPELRTGACG
Ga0180109_119488923300020067Groundwater SedimentMELTLERYLQDEGLREELERRAHRERAEQMHHYFARAAQALRIPHVPEPRTGACG
Ga0184649_147804433300020068Groundwater SedimentMELTLERYLEDEGLREELERRAHRERAEQMHRYFAQAAQALHMPHAPEPRTDACG
Ga0210379_1017504523300021081Groundwater SedimentMELTLQRYLEDEGLREELERRAHRERAEQMHRYFARAAQAMRIPRLPESRTGTCA
Ga0210379_1025221423300021081Groundwater SedimentMELTLDRYLQDEGLREELERRAHRERAEQMHRYFAQAAQALHLPHAPEARTDACA
Ga0210377_1000463553300021090Groundwater SedimentMELTYARYLQDEGLRDELERRAHRERAEQMHHYFAQAAQALHMPRVPEPRTDACA
Ga0210377_1012169333300021090Groundwater SedimentMELTLERYLKDEGLREELERRAHRERAEQMHRYFAQAAAALVAGNAPAAKLRTDACG
Ga0209109_1012265833300025160SoilMELTLERYLEDEGLREELERRAHRERAEQMHLYFARAAQALRVPQVPQPRTGACA
Ga0208454_102527723300027573SoilMELTLERYLEDEGLREELERRARNARAEQMHHYFARAAEAMRIARIPQPRTGACG
Ga0209382_1002935333300027909Populus RhizosphereMELTLERYLQDEGLREELERRAHCERAEAMHRFFEQSTRALNLQRTPALRTDACG
Ga0307281_1000912353300028803SoilMTLTLERYLNDEGLREELERRAHRERAEQVHRYFALAAQAMRMPRAPESRTGTCA
Ga0307281_1017499913300028803SoilGLREELERRAHRERAEQVHRYFALAAQAMRMPRAPESRTGTYA
Ga0307505_10001479243300031455SoilMELTLERYLHDEDLRDELERRAHRERAESMRRFFAQSAQALHLQRTPELRTGACG
Ga0247727_1003527473300031576BiofilmMELTLERYLQDEGLREELERRAHRERADAMHRFFAQSTAALLGGNTPAPKLRTDTCG
Ga0315910_1015221433300032144SoilMELTLERYLEDEGLREELERRAHRERAESMHRFFAQSAQALDLARHPEHRAVACG
Ga0364926_028273_858_10253300033812SedimentMDLTLERYLEDEGLREELERRAHRERAEQMHHYFARAAQAMRIPHVPEPRTDACG
Ga0364928_0096273_52_2193300033813SedimentMELTLDRYLQDEGLREELERRAHRERAETMHDYFARAAQALRTPHVPGPRAGACA
Ga0364946_099325_7_1743300033815SedimentMRLTLERYLEDEGLREELERRAHRERAEQMHRYFAQAAQALHMPHAPEPRTDACG
Ga0364934_0093855_284_4573300034178SedimentMRLTLERYLEDEGLREELERCAHRERAEAMHRYFAQAASALLAHHAPAPKLRTDACG
Ga0364934_0361479_188_3553300034178SedimentMELTLERYLQDEGLREELERRAHCERAEQMHHYFARAAQALRIPHVPEPRTGACG

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.