NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F098835

Metagenome Family F098835

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F098835
Family Type Metagenome
Number of Sequences 103
Average Sequence Length 48 residues
Representative Sequence RSTGIVHPAGVTFNAKDGEVIAPDAVWNGLFTFLKPELFKRTAAGSR
Number of Associated Samples 94
Number of Associated Scaffolds 103

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.97 %
% of genes near scaffold ends (potentially truncated) 98.06 %
% of genes from short scaffolds (< 2000 bps) 90.29 %
Associated GOLD sequencing projects 92
AlphaFold2 3D model prediction Yes
3D model pTM-score0.25

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (100.000 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil
(12.621 % of family members)
Environment Ontology (ENVO) Unclassified
(31.068 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(48.544 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 18.67%    β-sheet: 8.00%    Coil/Unstructured: 73.33%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.25
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 103 Family Scaffolds
PF00593TonB_dep_Rec 1.94
PF08843AbiEii 0.97

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 103 Family Scaffolds
COG2253Predicted nucleotidyltransferase component of viral defense systemDefense mechanisms [V] 0.97

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms100.00 %
UnclassifiedrootN/A0.00 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000364|INPhiseqgaiiFebDRAFT_104953073All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium694Open in IMG/M
3300000550|F24TB_14899714All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium722Open in IMG/M
3300001686|C688J18823_11033664All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium521Open in IMG/M
3300002459|JGI24751J29686_10066110All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium744Open in IMG/M
3300005175|Ga0066673_10641914All Organisms → cellular organisms → Bacteria → Acidobacteria615Open in IMG/M
3300005178|Ga0066688_10191806All Organisms → cellular organisms → Bacteria → Acidobacteria1295Open in IMG/M
3300005179|Ga0066684_10841955All Organisms → cellular organisms → Bacteria → Acidobacteria603Open in IMG/M
3300005180|Ga0066685_10196305All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1384Open in IMG/M
3300005186|Ga0066676_10535960All Organisms → cellular organisms → Bacteria → Acidobacteria794Open in IMG/M
3300005293|Ga0065715_10188970All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1399Open in IMG/M
3300005295|Ga0065707_10976432All Organisms → cellular organisms → Bacteria → Acidobacteria545Open in IMG/M
3300005332|Ga0066388_105543321All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium639Open in IMG/M
3300005438|Ga0070701_10021943All Organisms → cellular organisms → Bacteria → Acidobacteria3055Open in IMG/M
3300005450|Ga0066682_10472832All Organisms → cellular organisms → Bacteria → Acidobacteria795Open in IMG/M
3300005458|Ga0070681_10860093All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium825Open in IMG/M
3300005471|Ga0070698_100110303All Organisms → cellular organisms → Bacteria → Acidobacteria2717Open in IMG/M
3300005471|Ga0070698_101613368All Organisms → cellular organisms → Bacteria → Acidobacteria601Open in IMG/M
3300005536|Ga0070697_100833038All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium817Open in IMG/M
3300005540|Ga0066697_10419962All Organisms → cellular organisms → Bacteria → Acidobacteria775Open in IMG/M
3300005545|Ga0070695_101369293All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium586Open in IMG/M
3300005557|Ga0066704_10326844All Organisms → cellular organisms → Bacteria → Acidobacteria1032Open in IMG/M
3300005558|Ga0066698_10408149All Organisms → cellular organisms → Bacteria → Acidobacteria933Open in IMG/M
3300005564|Ga0070664_100863510All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium848Open in IMG/M
3300005615|Ga0070702_101684446All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium527Open in IMG/M
3300005617|Ga0068859_102600558All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium557Open in IMG/M
3300005713|Ga0066905_101555986All Organisms → cellular organisms → Bacteria → Acidobacteria604Open in IMG/M
3300005841|Ga0068863_101082525All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium806Open in IMG/M
3300005842|Ga0068858_101552374All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium653Open in IMG/M
3300006847|Ga0075431_101593566All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium611Open in IMG/M
3300006852|Ga0075433_10162469All Organisms → cellular organisms → Bacteria → Acidobacteria1988Open in IMG/M
3300006854|Ga0075425_101271468All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium835Open in IMG/M
3300006903|Ga0075426_11117709All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium597Open in IMG/M
3300007265|Ga0099794_10604431All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_2_65_9581Open in IMG/M
3300009012|Ga0066710_100179686All Organisms → cellular organisms → Bacteria → Acidobacteria2988Open in IMG/M
3300009012|Ga0066710_103702735All Organisms → cellular organisms → Bacteria → Acidobacteria575Open in IMG/M
3300009012|Ga0066710_104274814All Organisms → cellular organisms → Bacteria → Acidobacteria534Open in IMG/M
3300009038|Ga0099829_11725934All Organisms → cellular organisms → Bacteria → Acidobacteria514Open in IMG/M
3300009098|Ga0105245_11568621All Organisms → cellular organisms → Bacteria → Acidobacteria710Open in IMG/M
3300009147|Ga0114129_10357520All Organisms → cellular organisms → Bacteria → Acidobacteria1933Open in IMG/M
3300009156|Ga0111538_12601906All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium634Open in IMG/M
3300009162|Ga0075423_10948910All Organisms → cellular organisms → Bacteria → Acidobacteria913Open in IMG/M
3300009162|Ga0075423_12392298All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium576Open in IMG/M
3300009177|Ga0105248_10650828All Organisms → cellular organisms → Bacteria → Acidobacteria1189Open in IMG/M
3300009553|Ga0105249_12337421All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium607Open in IMG/M
3300009792|Ga0126374_10894950All Organisms → cellular organisms → Bacteria → Acidobacteria687Open in IMG/M
3300010303|Ga0134082_10130388All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1009Open in IMG/M
3300010321|Ga0134067_10065021All Organisms → cellular organisms → Bacteria → Acidobacteria1198Open in IMG/M
3300010321|Ga0134067_10301345All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium618Open in IMG/M
3300010359|Ga0126376_11743547All Organisms → cellular organisms → Bacteria → Acidobacteria659Open in IMG/M
3300010361|Ga0126378_12244912All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium623Open in IMG/M
3300010397|Ga0134124_10773426All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium957Open in IMG/M
3300010399|Ga0134127_11896040All Organisms → cellular organisms → Bacteria → Acidobacteria673Open in IMG/M
3300010401|Ga0134121_10072074All Organisms → cellular organisms → Bacteria → Acidobacteria2860Open in IMG/M
3300010403|Ga0134123_12799241All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium556Open in IMG/M
3300012189|Ga0137388_10587339All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1035Open in IMG/M
3300012201|Ga0137365_10068739All Organisms → cellular organisms → Bacteria → Acidobacteria2673Open in IMG/M
3300012209|Ga0137379_10602841All Organisms → cellular organisms → Bacteria → Acidobacteria1005Open in IMG/M
3300012359|Ga0137385_10480422All Organisms → cellular organisms → Bacteria → Acidobacteria1053Open in IMG/M
3300012362|Ga0137361_10809132All Organisms → cellular organisms → Bacteria → Acidobacteria852Open in IMG/M
3300012362|Ga0137361_11682024All Organisms → cellular organisms → Bacteria → Acidobacteria554Open in IMG/M
3300012363|Ga0137390_10119780All Organisms → cellular organisms → Bacteria → Acidobacteria2606Open in IMG/M
3300012469|Ga0150984_122598803All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium525Open in IMG/M
3300012923|Ga0137359_10788278All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium824Open in IMG/M
3300012971|Ga0126369_13267096All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium531Open in IMG/M
3300012976|Ga0134076_10558936All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium529Open in IMG/M
3300012987|Ga0164307_10377554All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1037Open in IMG/M
3300013297|Ga0157378_10400592All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1352Open in IMG/M
3300015241|Ga0137418_10237799All Organisms → cellular organisms → Bacteria → Acidobacteria1553Open in IMG/M
3300015357|Ga0134072_10280772All Organisms → cellular organisms → Bacteria → Acidobacteria613Open in IMG/M
3300015372|Ga0132256_101189041All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium876Open in IMG/M
3300017656|Ga0134112_10444632All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium542Open in IMG/M
3300018075|Ga0184632_10346446All Organisms → cellular organisms → Bacteria → Acidobacteria636Open in IMG/M
3300018079|Ga0184627_10029764All Organisms → cellular organisms → Bacteria2748Open in IMG/M
3300018433|Ga0066667_10752881All Organisms → cellular organisms → Bacteria → Acidobacteria822Open in IMG/M
3300018468|Ga0066662_10130912All Organisms → cellular organisms → Bacteria → Acidobacteria1854Open in IMG/M
3300020003|Ga0193739_1080723All Organisms → cellular organisms → Bacteria → Acidobacteria827Open in IMG/M
3300021080|Ga0210382_10156382All Organisms → cellular organisms → Bacteria → Acidobacteria979Open in IMG/M
3300021510|Ga0222621_1144216All Organisms → cellular organisms → Bacteria → Acidobacteria508Open in IMG/M
3300025926|Ga0207659_10436485All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1101Open in IMG/M
3300025941|Ga0207711_10155126All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium2069Open in IMG/M
3300025941|Ga0207711_11402135All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium641Open in IMG/M
3300025942|Ga0207689_11606120All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium541Open in IMG/M
3300026095|Ga0207676_10156162All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1971Open in IMG/M
3300026116|Ga0207674_11043754All Organisms → cellular organisms → Bacteria → Acidobacteria786Open in IMG/M
3300026343|Ga0209159_1096155All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1298Open in IMG/M
3300026532|Ga0209160_1321607All Organisms → cellular organisms → Bacteria → Acidobacteria528Open in IMG/M
3300026884|Ga0207455_1000594All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1340Open in IMG/M
3300027645|Ga0209117_1154512All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium598Open in IMG/M
3300027882|Ga0209590_10708970All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium643Open in IMG/M
3300027882|Ga0209590_10935893All Organisms → cellular organisms → Bacteria → Acidobacteria544Open in IMG/M
3300027909|Ga0209382_10222157All Organisms → cellular organisms → Bacteria → Acidobacteria2156Open in IMG/M
3300027909|Ga0209382_11561648All Organisms → cellular organisms → Bacteria → Acidobacteria655Open in IMG/M
3300028381|Ga0268264_10413356All Organisms → cellular organisms → Bacteria → Acidobacteria1299Open in IMG/M
3300028608|Ga0247819_10873759All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium561Open in IMG/M
3300028710|Ga0307322_10119722All Organisms → cellular organisms → Bacteria → Acidobacteria687Open in IMG/M
3300028799|Ga0307284_10012568All Organisms → cellular organisms → Bacteria → Acidobacteria2567Open in IMG/M
3300031819|Ga0318568_10925121All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium539Open in IMG/M
3300031860|Ga0318495_10158804All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1020Open in IMG/M
3300031879|Ga0306919_11190793All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium579Open in IMG/M
3300031912|Ga0306921_12065192All Organisms → cellular organisms → Bacteria → Acidobacteria605Open in IMG/M
3300031938|Ga0308175_101310111All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium807Open in IMG/M
3300033412|Ga0310810_10653620All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium992Open in IMG/M
3300034114|Ga0364938_042014All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium775Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil12.62%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil10.68%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere9.71%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil5.83%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere5.83%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil4.85%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil4.85%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere4.85%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil3.88%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil3.88%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere3.88%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil2.91%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment1.94%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil1.94%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil1.94%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil1.94%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil1.94%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment0.97%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.97%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere0.97%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.97%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil0.97%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere0.97%
SedimentEnvironmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment0.97%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere0.97%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere0.97%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere0.97%
Corn, Switchgrass And Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere0.97%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.97%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.97%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere0.97%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere0.97%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere0.97%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere0.97%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000364Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300000550Amended soil microbial communities from Kansas Great Prairies, USA - BrdU amended with acetate total DNA F2.4 TB clc assemlyEnvironmentalOpen in IMG/M
3300001686Grasslands soil microbial communities from Hopland, California, USAEnvironmentalOpen in IMG/M
3300002459Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6Host-AssociatedOpen in IMG/M
3300005175Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122EnvironmentalOpen in IMG/M
3300005178Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137EnvironmentalOpen in IMG/M
3300005179Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133EnvironmentalOpen in IMG/M
3300005180Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134EnvironmentalOpen in IMG/M
3300005186Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125EnvironmentalOpen in IMG/M
3300005293Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1Host-AssociatedOpen in IMG/M
3300005295Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3EnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005438Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaGEnvironmentalOpen in IMG/M
3300005450Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131EnvironmentalOpen in IMG/M
3300005458Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaGEnvironmentalOpen in IMG/M
3300005471Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaGEnvironmentalOpen in IMG/M
3300005536Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaGEnvironmentalOpen in IMG/M
3300005540Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146EnvironmentalOpen in IMG/M
3300005545Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaGEnvironmentalOpen in IMG/M
3300005557Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153EnvironmentalOpen in IMG/M
3300005558Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147EnvironmentalOpen in IMG/M
3300005564Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaGHost-AssociatedOpen in IMG/M
3300005615Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaGEnvironmentalOpen in IMG/M
3300005617Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2Host-AssociatedOpen in IMG/M
3300005713Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2)EnvironmentalOpen in IMG/M
3300005841Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2Host-AssociatedOpen in IMG/M
3300005842Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2Host-AssociatedOpen in IMG/M
3300006847Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5Host-AssociatedOpen in IMG/M
3300006852Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2Host-AssociatedOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300006903Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5Host-AssociatedOpen in IMG/M
3300007265Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1EnvironmentalOpen in IMG/M
3300009012Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159EnvironmentalOpen in IMG/M
3300009038Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaGEnvironmentalOpen in IMG/M
3300009098Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaGHost-AssociatedOpen in IMG/M
3300009147Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2)Host-AssociatedOpen in IMG/M
3300009156Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009162Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2Host-AssociatedOpen in IMG/M
3300009177Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaGHost-AssociatedOpen in IMG/M
3300009553Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaGHost-AssociatedOpen in IMG/M
3300009792Tropical forest soil microbial communities from Panama - MetaG Plot_12EnvironmentalOpen in IMG/M
3300010303Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09182015EnvironmentalOpen in IMG/M
3300010321Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09212015EnvironmentalOpen in IMG/M
3300010359Tropical forest soil microbial communities from Panama - MetaG Plot_15EnvironmentalOpen in IMG/M
3300010361Tropical forest soil microbial communities from Panama - MetaG Plot_23EnvironmentalOpen in IMG/M
3300010397Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4EnvironmentalOpen in IMG/M
3300010399Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3EnvironmentalOpen in IMG/M
3300010401Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1EnvironmentalOpen in IMG/M
3300010403Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3EnvironmentalOpen in IMG/M
3300012189Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaGEnvironmentalOpen in IMG/M
3300012201Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaGEnvironmentalOpen in IMG/M
3300012209Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaGEnvironmentalOpen in IMG/M
3300012359Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaGEnvironmentalOpen in IMG/M
3300012362Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaGEnvironmentalOpen in IMG/M
3300012363Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaGEnvironmentalOpen in IMG/M
3300012469Combined assembly of Soil carbon rhizosphereHost-AssociatedOpen in IMG/M
3300012923Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaGEnvironmentalOpen in IMG/M
3300012971Tropical forest soil microbial communities from Panama - MetaG Plot_1EnvironmentalOpen in IMG/M
3300012976Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_0_1 metaGEnvironmentalOpen in IMG/M
3300012987Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MGEnvironmentalOpen in IMG/M
3300013297Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaGHost-AssociatedOpen in IMG/M
3300015241Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300015357Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_0_1 metaGEnvironmentalOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300017656Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_11112015EnvironmentalOpen in IMG/M
3300018075Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b1EnvironmentalOpen in IMG/M
3300018079Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b1EnvironmentalOpen in IMG/M
3300018433Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116EnvironmentalOpen in IMG/M
3300018468Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111EnvironmentalOpen in IMG/M
3300020003Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2a2EnvironmentalOpen in IMG/M
3300021080Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_coex redoEnvironmentalOpen in IMG/M
3300021510Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_coexEnvironmentalOpen in IMG/M
3300025926Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025941Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025942Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026095Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026116Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026343Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 (SPAdes)EnvironmentalOpen in IMG/M
3300026532Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 (SPAdes)EnvironmentalOpen in IMG/M
3300026884Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G05K5-12 (SPAdes)EnvironmentalOpen in IMG/M
3300027645Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 (SPAdes)EnvironmentalOpen in IMG/M
3300027882Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027909Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes)Host-AssociatedOpen in IMG/M
3300028381Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300028608Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Xylose_Day6EnvironmentalOpen in IMG/M
3300028710Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_380EnvironmentalOpen in IMG/M
3300028799Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_123EnvironmentalOpen in IMG/M
3300031819Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21EnvironmentalOpen in IMG/M
3300031860Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f25EnvironmentalOpen in IMG/M
3300031879Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2)EnvironmentalOpen in IMG/M
3300031912Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2)EnvironmentalOpen in IMG/M
3300031938Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1EnvironmentalOpen in IMG/M
3300033412Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NCEnvironmentalOpen in IMG/M
3300034114Sediment microbial communities from East River floodplain, Colorado, United States - 9_s17EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
INPhiseqgaiiFebDRAFT_10495307313300000364SoilPAGVTFNAKSGEVIAPDAVWNGLFTFLKPELFTMSSPGSR*
F24TB_1489971413300000550SoilDNGDVPPHSIIKGRSTGIVHPAGVTFNAADGEVIAPDAVWNGLFTFLKPELFKMPPAAAR
C688J18823_1103366423300001686SoilGDDGDLPPHSIIKGRSTGIVHPAGVTFNAADGEVIAPDAVWNGLFTFLKPELFKTPVAASK*
JGI24751J29686_1006611013300002459Corn, Switchgrass And Miscanthus RhizospherePHSIIKGRSTGIVHPAGVTFNAKDGEVIAPDAVWNGLFTFLKPELFKRAAPPR*
Ga0066673_1064191413300005175SoilAGVTFNARDGEVIAPDAVWNGLFTFLKPELFKRTAAGLQ*
Ga0066688_1019180623300005178SoilTGIVHPAGVTFNARDGEVIAPDAIWNGLFTFLKPELFPRTAKGSQ*
Ga0066684_1084195513300005179SoilRSTGIVHPAGVAFNARDGEVIAPDAIWNGLFTFLEPELFKRSAAGAR*
Ga0066685_1019630543300005180SoilSVVKGRSTGIVHPAGVTFNARNGEVIAPDAIWNGLFTFLKPELFAPAAAGAR*
Ga0066676_1053596023300005186SoilAGVTFNAKDGEVIAPDAVWNGLFTFLKPELFKRPAAGSR*
Ga0065715_1018897013300005293Miscanthus RhizospherePAGVTFNAADGEVIAPDAVWNGLFTFLKPELFKRSTTASR*
Ga0065707_1097643223300005295Switchgrass RhizosphereDGDVPPRSLIKGRSTGIVHPAGVTFNARNGEVIAPDAVWNGLFTFLKPELFKRTAAGSQ*
Ga0066388_10554332123300005332Tropical Forest SoilSIVKGRSTGIVHPAGVTFNARDGEVIAPDAVWNGLFTFLKPELFATSAKGSP*
Ga0070701_1002194323300005438Corn, Switchgrass And Miscanthus RhizosphereDGDVPPHSIIKGRSTGIVHPAGVTFNAADGEVIAPDAVWNGLFTFLKPELFKRPTAASR*
Ga0066682_1047283213300005450SoilSTGIVHPAGVTFNARDGEVIAPDAIWNGLFTFLKPELFAPAAAGAR*
Ga0070681_1086009323300005458Corn RhizosphereTGIVHPAGVTFNAKSGEVIAPDAVWNGLFTFLKPELFNSGSQASR*
Ga0070698_10011030313300005471Corn, Switchgrass And Miscanthus RhizosphereIKGRSTGIVHPAGVTFNARDGEVIAPDAVWNGLFTFLKPELFKAPSRISR*
Ga0070698_10161336813300005471Corn, Switchgrass And Miscanthus RhizosphereRSTGIVHPAGVTFNAKDGEVIAPDAVWNGLFTFLKPELFKRTAAGSR*
Ga0070697_10083303813300005536Corn, Switchgrass And Miscanthus RhizosphereRSIVKGRSTGIVHPAGVTFNARDGEVIAPDAVWNGLFTFLKPELFARTAKGSP*
Ga0066697_1041996223300005540SoilRSTGIVHPAGVTFNAKHGEVIAPDAVWNGLFTFMKPELFKETAAGTQ*
Ga0070695_10136929313300005545Corn, Switchgrass And Miscanthus RhizosphereRSTGIVHPAGVTFNARDGEVIAPDAIWNGLFTFLKPELFSARGR*
Ga0066704_1032684413300005557SoilDVPPRTLIKGRSTGIVHPAGVTFNAKDGEVIAPDAVWNGLFTFLKPELFKRTAAGIQ*
Ga0066698_1040814913300005558SoilFNARDGEVIAPDAVWNGLFTFLKPELFKRTAAGSQ*
Ga0070664_10086351023300005564Corn RhizosphereTGIVHPAGVTFNAADGEVIAPDAVWNGLFTFLKPELFKRPAAASR*
Ga0070702_10168444613300005615Corn, Switchgrass And Miscanthus RhizospherePHSTIKGRSTGIVHPAGVTFNAKDGEVIAPDAVWNGLFTFLKPELFKMSAPAAR*
Ga0068859_10260055813300005617Switchgrass RhizosphereHSIIKGRSTGIVHPAGVTFNAKDGEVIAPDAVWNGLFTFLKPELFKRAAPPR*
Ga0066905_10155598623300005713Tropical Forest SoilNAKDGEVIAPDAVWNGLFTFLKPELFKPTAAGSR*
Ga0068863_10108252523300005841Switchgrass RhizospherePHSVIKGRSTGIVHPAGVTFNAADGEVIAPDAVWNGLFTFLKPELFKMPPAAAR*
Ga0068858_10155237413300005842Switchgrass RhizosphereHPAGVTFNARDGEVIAPDAIWNGLFTFLKPELFSARGR*
Ga0075431_10159356623300006847Populus RhizosphereTFNAKSGEVIAPDAVWNGLFTFLKPELFTMSSPGSR*
Ga0075433_1016246923300006852Populus RhizospherePPRSLIKGRSTGIVHPAGVTFNAKHGEVIAPDAVWNGLFTFLKPELFKGTAAGTR*
Ga0075425_10127146823300006854Populus RhizosphereRSTGIVHPAGVTFNAKDGEVIAPDAVWNGLFTFLKPELFKR*
Ga0075426_1111770913300006903Populus RhizosphereHPAGVTFNARDGEVIAPDAVWNGLFTFLKPELFARNSKGSQ*
Ga0099794_1060443123300007265Vadose Zone SoilTGIVHPAGVTFNAKDGEVIAPDAVWNGLFTFLKPELFKRAGPGTK*
Ga0066710_10017968623300009012Grasslands SoilGRSTGIVHPAGVTFNARDGEVIAPDAVWNGLFTFLKPELFKATATGSR
Ga0066710_10370273523300009012Grasslands SoilFNAKDGEVIAPDAVWNGLFTFLKPELFKRPAAGSR
Ga0066710_10427481413300009012Grasslands SoilGIVHPAGVAFNARDGEVIAPDAVWNGLFTFLEPELFKRTASGAR
Ga0099829_1172593423300009038Vadose Zone SoilDVPPRSILKGRSTGIVQPAGVAFNARDGEVIAPDAVWNGLFTFLKPELFAPTAAGSR*
Ga0105245_1156862123300009098Miscanthus RhizosphereGIVHPAGVTFNAKDGEVIAPDAVWNGLFTFLKPELFKRTGAGSQ*
Ga0114129_1035752013300009147Populus RhizosphereSLIKGRSTGIVHPAGVTFNAKNGEVIAPDAVWNGLFTFLKPELFNEAGRGRRSF*
Ga0111538_1260190623300009156Populus RhizosphereSIIKGRSTGIVHPAGVTFNAADGEVIAPDAVWNGLFTFLKPELFKRSTTASR*
Ga0075423_1094891023300009162Populus RhizosphereDVPPRSLIKGRSTGIVHPAGVTFNAKDGEVIAPDAVWNGLFTFLKPELFKRTAAGSR*
Ga0075423_1239229823300009162Populus RhizosphereAPHSMIKGRSTGIVHPAGVAFNAKNGEVIAPDAVWNGLFTFLKPELFNR*
Ga0105248_1065082823300009177Switchgrass RhizosphereHPAGVAFNARDGEVIAPDAIWNGLFTFLKPELFAARGR*
Ga0105249_1233742113300009553Switchgrass RhizospherePAGVAFNARDGEVIAPDAVWNGLFTFLKPELFKRTAAGSVQ*
Ga0126374_1089495023300009792Tropical Forest SoilRSTGIVHPAGVTFNARDGEVIAPDAVWNGLFTFLKPELFKPRAAGSQ*
Ga0134082_1013038813300010303Grasslands SoilVWDDVADDGDAPPRSLIKGRSTGIVHPAGVTFNARDGEVIAPDAIWNGLFTFLKPELFREPSAQ*
Ga0134067_1006502123300010321Grasslands SoilAGVTFNARDGEVIAPDAIWNGLFTFLKPELFREPSAQ*
Ga0134067_1030134523300010321Grasslands SoilVTFNARDGEVIAPDAVWNGLFTFLKPELFARAAKGPQ*
Ga0126376_1174354723300010359Tropical Forest SoilDVPARSVVKGRSTGIVHPAGVTFNAKDGEVIAPDAVWNGLFTFLKPELFKRTMAGTQ*
Ga0126378_1224491223300010361Tropical Forest SoilKGRSTGIVHPAGVTFNARDGEVIAPDAVWNGLFTFLKPELFVRPGPSEDHGVPAR*
Ga0134124_1077342623300010397Terrestrial SoilHPAGVTFNAADGEVIAPDAVWNGLFTFLKPELFKRPAAASR*
Ga0134127_1189604023300010399Terrestrial SoilSLIKGRSTGIVHPAGVAFNAKDGEVIAPDAVWNGLFTFLKPELFKRTAAGSIQ*
Ga0134121_1007207413300010401Terrestrial SoilGIVHPAGVTFNAADGEVIAPDAVWNGLFTFLKPELFKRPAAASR*
Ga0134123_1279924123300010403Terrestrial SoilIVHPAGVTFNAADGEVIAPDAVWNGLFTFLKPELFKMPPAAAR*
Ga0137388_1058733913300012189Vadose Zone SoilRSIIKGRSTGIVHPAGVTFNARDGEVIAPDAVWNGLFTFLKPELFSRTAKASQ*
Ga0137365_1006873913300012201Vadose Zone SoilIKGRSTGIVHPAGVTFNAKDGEVIAPDAVWNGLFTFLKPELFKRAAAGSR*
Ga0137379_1060284123300012209Vadose Zone SoilADDGDAPPRSLVKGRSTGIVHPAGVTFNAKHGEVIAPDAVWNGLFTFMKPELFKATAAGTQ*
Ga0137385_1048042223300012359Vadose Zone SoilPAGVTFNAKHGEVIAPDAVWNGLFTFMKPELFKATAAGTQ*
Ga0137361_1080913233300012362Vadose Zone SoilPRSIIKGRSTGIVHPAGVTFDTRDGEVIAPDAIWNGLFTFLKPELFAPAPAGRR*
Ga0137361_1168202413300012362Vadose Zone SoilTGIVHPAGVTFNAKDGEVVAPDAVWNGLFTFLKPELFKRTAPGTQ*
Ga0137390_1011978013300012363Vadose Zone SoilIVHPAGVTFNAKDGEVIAPDAVWNGLFTFLKPELFTRTAAGAR*
Ga0150984_12259880323300012469Avena Fatua RhizosphereDNGDVPPHSVIKGRSTGIVHPAGVTFNAADGEVIAPDAVWNGLFTFLKPELFKMPPAAAR
Ga0137359_1078827813300012923Vadose Zone SoilKGRSTGIVHPAGVTFNARDGEVIAPDAVWNGLFTFLKPELFARAAKGPQ*
Ga0126369_1326709623300012971Tropical Forest SoilTGIVHPAGVTFNAKDGEVIAPDAVWNGLFTFLKPELFRR*
Ga0134076_1055893623300012976Grasslands SoilGVTFNAKDGEVIAPDAVWNGLFTFLKPELFRPPDSRSSR*
Ga0164307_1037755423300012987SoilVHPAGVTFNAADGEVIAPDAVWNGLFTFLKPELFKMPPAAAR*
Ga0157378_1040059213300013297Miscanthus RhizosphereHPAGVTFNAADGEVIAPDAVWNGLFTFLKPELFKMPPAAAR*
Ga0137418_1023779933300015241Vadose Zone SoilRSLIKGRSTGIVHPAGVTFNARDGEVIAPDAVWNGLFTFLKPELFARAAKGPQ*
Ga0134072_1028077223300015357Grasslands SoilTGIVHPAGVTFNARDGEVIAPDAIWNGLFTFLKPELFREPSAQ*
Ga0132256_10118904123300015372Arabidopsis RhizosphereTFNARDGEVIAPDAVWNGLFTFLKPELFAPTATGSR*
Ga0134112_1044463223300017656Grasslands SoilVKGRSTGIVHPAGVTFNAKDGELIAPDAVWNGLFTFLKPELFKPTPPGTP
Ga0184632_1034644623300018075Groundwater SedimentTFNARDGEVIAPDAVWNGLFTFLKPELFKRPAAGSQ
Ga0184627_1002976413300018079Groundwater SedimentRSIIKGRSTGLVHPAGVTFNAKDGEVIAPDAIWNGLFTFLKPELFYPAVPSSR
Ga0066667_1075288123300018433Grasslands SoilVHPAGVTFNARDGEVIAPDAVWNGLFTFLKPELFKRTAAGSQ
Ga0066662_1013091223300018468Grasslands SoilRSTGIVHPAGVTFNARDGELIAPDAVWNGLFTFLKPELFKPTRPGTP
Ga0193739_108072323300020003SoilGRSTGIVHPAGVTFNARNGEVIAPDAVWNGLFTFLKPELFKRTAAGSQ
Ga0210382_1015638223300021080Groundwater SedimentDVPPRSLIKGRSTGIVHPAGVTFNAKDGEVIAPDAVWNGLFTFLKPELFKRTAAGSQ
Ga0222621_114421623300021510Groundwater SedimentAFNARDGEVIAPDAVWNGLFTFLKPELFKRTAAGSQ
Ga0207659_1043648523300025926Miscanthus RhizospherePAGVTFNAKDGEVIAPDAVWNGLFTFLKPELFKMSSVK
Ga0207711_1015512623300025941Switchgrass RhizosphereDGDVPPHSIIKGRSTGIVHPAGVTFNAADGEVIAPDAVWNGLFTFLKPELFKRPTAASR
Ga0207711_1140213523300025941Switchgrass RhizosphereRSTGIVHPAGVTFNARDGEVIAPDAVWNGLFTFLKPELFKMATGTPRAGAAQ
Ga0207689_1160612013300025942Miscanthus RhizosphereTGIVHPAGVTFNAADGEVIAPDAVWNGLFTFLKPELFKMPPAAAR
Ga0207676_1015616213300026095Switchgrass RhizosphereGIVHPAGVTFNARDGEVIAPDAVWNGLFTFLKPELFKMATGTPRAGAPQ
Ga0207674_1104375413300026116Corn RhizosphereMGRSTGIVHPAGVTFNAKNGEVIAPDAVWNGLFTFLEPELFNR
Ga0209159_109615513300026343SoilDEKDDGDAPPRSVVKGRSTGIVHPAGVTFNARDGEVIAPDAIWNGLFTFLKPELFAPAAAGAR
Ga0209160_132160723300026532SoilDVPPRTLIKGRSTGIVHPAGVTFNAKDGEVIAPDAVWNGLFTFLKPELFKRTAAGIQ
Ga0207455_100059413300026884SoilTFNAADGEVIAPDAVWNGLFTFLKPELFKRPAAASR
Ga0209117_115451213300027645Forest SoilTFNARDGEVIAPDAIWNGLFTFLKPELFAPAAAGPR
Ga0209590_1070897013300027882Vadose Zone SoilGVTFNARDGEVIAPDAVWNGLFTFLKPELFSRTAKASQ
Ga0209590_1093589323300027882Vadose Zone SoilIVHPAGVAFNARDGEVIAPDAIWNGLFTFLKPELFKRTTVGAR
Ga0209382_1022215713300027909Populus RhizosphereNGDVPPRALIKGRSTGIVHPAGVTFNARNGEVIAPDAIWNGLFTFLKPELFGRTPPTGP
Ga0209382_1156164823300027909Populus RhizosphereDVPPRSLIKGRSTGIVHPAGVTFNAKNGEVIAPDAVWNGLFTFLKPELFKPTGAGTQ
Ga0268264_1041335613300028381Switchgrass RhizosphereGRSTGIVHPAGVAFNARDGEVIAPDAVWNGLFTFLKPELFKRTAAGSVQ
Ga0247819_1087375913300028608SoilSVIKGRSTGIVHPAGVTFNAADGEVIAPDAVWNGLFTFLKPELFKMPPAAAR
Ga0307322_1011972223300028710SoilDGDVAPRSLIKGRSTGIVHPAGVTFNAKDGEVIAPDAVWNGLFTFLKPELFKRTAAGSQ
Ga0307284_1001256813300028799SoilIKGRSTGIVHPAGVTFNAKDGEVIAPDAVWNGLFTFLKPELFKRTAAGSQ
Ga0318568_1092512123300031819SoilHPAGVTFNARDGEVIAPDAVWNGLFTFLKPELFAGTGKGSQ
Ga0318495_1015880423300031860SoilGRSTGIVHPAGVTFNARDGEVIAPDAVWNGLFTFLKPELFAGTGKGSQ
Ga0306919_1119079323300031879SoilSLIKGRSTGIVHPAGVTFNARDGEVIAPDAVWNGLFTFLKPELFAGTGKGSQ
Ga0306921_1206519213300031912SoilSTGIVHPAGVTFNARDGEVIAPDAVWNGLFTFMKPELFRPLGAETR
Ga0308175_10131011123300031938SoilPHSLIMGRSTGIVHPAGVTFNAKNGEVIAPDAVWNGLFTFLKPELFNR
Ga0310810_1065362013300033412SoilDEGDDGDVAPHSLIMGRSTGIVHPAGVTFNAKSGEVIAPDAVWNGLFTFLKPELFNSGSQASR
Ga0364938_042014_646_7743300034114SedimentVHPAGVTFNAKDGEVIAPDAIWNGLFTFLKPELFNPAVPQSR

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.