NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F098806

Metagenome / Metatranscriptome Family F098806

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F098806
Family Type Metagenome / Metatranscriptome
Number of Sequences 103
Average Sequence Length 46 residues
Representative Sequence GPLAGQKFGRQGARLRFFATGLGMLTDPAPNSQLEIAGNWSIE
Number of Associated Samples 85
Number of Associated Scaffolds 103

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Unclassified
% of genes with valid RBS motifs 0.00 %
% of genes near scaffold ends (potentially truncated) 98.06 %
% of genes from short scaffolds (< 2000 bps) 90.29 %
Associated GOLD sequencing projects 80
AlphaFold2 3D model prediction Yes
3D model pTM-score0.36

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Unclassified (75.728 % of family members)
NCBI Taxonomy ID N/A
Taxonomy N/A

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(40.777 % of family members)
Environment Ontology (ENVO) Unclassified
(50.485 % of family members)
Earth Microbiome Project Ontology (EMPO) Unclassified
(44.660 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 0.00%    β-sheet: 19.72%    Coil/Unstructured: 80.28%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.36
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 103 Family Scaffolds
PF00109ketoacyl-synt 70.87
PF02801Ketoacyl-synt_C 24.27
PF07730HisKA_3 0.97
PF08922DUF1905 0.97
PF02353CMAS 0.97
PF00400WD40 0.97

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 103 Family Scaffolds
COG2226Ubiquinone/menaquinone biosynthesis C-methylase UbiE/MenGCoenzyme transport and metabolism [H] 0.97
COG22272-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4-benzoquinol methylaseCoenzyme transport and metabolism [H] 0.97
COG2230Cyclopropane fatty-acyl-phospholipid synthase and related methyltransferasesLipid transport and metabolism [I] 0.97
COG3850Signal transduction histidine kinase NarQ, nitrate/nitrite-specificSignal transduction mechanisms [T] 0.97
COG3851Signal transduction histidine kinase UhpB, glucose-6-phosphate specificSignal transduction mechanisms [T] 0.97
COG4564Signal transduction histidine kinaseSignal transduction mechanisms [T] 0.97
COG4585Signal transduction histidine kinase ComPSignal transduction mechanisms [T] 0.97


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
UnclassifiedrootN/A75.73 %
All OrganismsrootAll Organisms24.27 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300004633|Ga0066395_10854940Not Available549Open in IMG/M
3300005336|Ga0070680_101614064Not Available562Open in IMG/M
3300005338|Ga0068868_101962314All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Geodermatophilales → Geodermatophilaceae → Geodermatophilus → Geodermatophilus daqingensis555Open in IMG/M
3300005367|Ga0070667_102083648Not Available534Open in IMG/M
3300005467|Ga0070706_100853006Not Available842Open in IMG/M
3300005543|Ga0070672_100738706All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Geodermatophilales → Geodermatophilaceae → Geodermatophilus → Geodermatophilus daqingensis863Open in IMG/M
3300005549|Ga0070704_101798012Not Available567Open in IMG/M
3300005587|Ga0066654_10358913Not Available792Open in IMG/M
3300005719|Ga0068861_100314837Not Available1361Open in IMG/M
3300005764|Ga0066903_100866131Not Available1628Open in IMG/M
3300005764|Ga0066903_101718366Not Available1195Open in IMG/M
3300005841|Ga0068863_101160894Not Available777Open in IMG/M
3300006046|Ga0066652_101686727Not Available578Open in IMG/M
3300006871|Ga0075434_101916147Not Available599Open in IMG/M
3300006903|Ga0075426_10792440Not Available713Open in IMG/M
3300007076|Ga0075435_101281765Not Available642Open in IMG/M
3300009012|Ga0066710_101422609All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Geodermatophilales → Geodermatophilaceae → Geodermatophilus → Geodermatophilus daqingensis1074Open in IMG/M
3300009094|Ga0111539_10071326All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinoallomurus → Actinoallomurus bryophytorum4099Open in IMG/M
3300010361|Ga0126378_12857109Not Available551Open in IMG/M
3300010366|Ga0126379_10903312All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Geodermatophilales → Geodermatophilaceae → Geodermatophilus → Geodermatophilus daqingensis986Open in IMG/M
3300010366|Ga0126379_11123138All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Geodermatophilales → Geodermatophilaceae → Geodermatophilus → Geodermatophilus daqingensis892Open in IMG/M
3300010366|Ga0126379_11780845Not Available720Open in IMG/M
3300010375|Ga0105239_11959519Not Available680Open in IMG/M
3300010376|Ga0126381_100847220Not Available1314Open in IMG/M
3300010376|Ga0126381_103785312Not Available591Open in IMG/M
3300010398|Ga0126383_12934039Not Available557Open in IMG/M
3300010400|Ga0134122_11218137Not Available755Open in IMG/M
3300012492|Ga0157335_1044749Not Available511Open in IMG/M
3300012915|Ga0157302_10388850Not Available571Open in IMG/M
3300012971|Ga0126369_11253239Not Available831Open in IMG/M
3300013308|Ga0157375_10746785All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Geodermatophilales → Geodermatophilaceae → Geodermatophilus → Geodermatophilus daqingensis1130Open in IMG/M
3300016270|Ga0182036_10813594Not Available762Open in IMG/M
3300016270|Ga0182036_11443474Not Available577Open in IMG/M
3300016294|Ga0182041_10871165Not Available808Open in IMG/M
3300016341|Ga0182035_11077910Not Available714Open in IMG/M
3300016387|Ga0182040_10013760Not Available4266Open in IMG/M
3300016387|Ga0182040_10768802Not Available792Open in IMG/M
3300017939|Ga0187775_10182147Not Available769Open in IMG/M
3300017974|Ga0187777_10126978Not Available1691Open in IMG/M
3300021860|Ga0213851_1502589Not Available519Open in IMG/M
3300021861|Ga0213853_10990125Not Available619Open in IMG/M
3300025898|Ga0207692_10022576All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia2897Open in IMG/M
3300025910|Ga0207684_11212410Not Available624Open in IMG/M
3300025916|Ga0207663_11262252Not Available595Open in IMG/M
3300025928|Ga0207700_11732032Not Available551Open in IMG/M
3300025936|Ga0207670_11597052Not Available555Open in IMG/M
3300025986|Ga0207658_11774483Not Available563Open in IMG/M
3300026067|Ga0207678_11507026Not Available594Open in IMG/M
3300026088|Ga0207641_11068476Not Available805Open in IMG/M
3300026498|Ga0257156_1123530Not Available539Open in IMG/M
3300028884|Ga0307308_10171470All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Geodermatophilales → Geodermatophilaceae → Geodermatophilus → Geodermatophilus daqingensis1039Open in IMG/M
3300031200|Ga0307496_10113912Not Available541Open in IMG/M
3300031546|Ga0318538_10266666All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Geodermatophilales → Geodermatophilaceae → Geodermatophilus → Geodermatophilus daqingensis921Open in IMG/M
3300031549|Ga0318571_10075906Not Available1057Open in IMG/M
3300031549|Ga0318571_10424398Not Available523Open in IMG/M
3300031564|Ga0318573_10009082All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria4126Open in IMG/M
3300031564|Ga0318573_10637879Not Available573Open in IMG/M
3300031679|Ga0318561_10342565Not Available819Open in IMG/M
3300031681|Ga0318572_10684577Not Available611Open in IMG/M
3300031713|Ga0318496_10563390Not Available630Open in IMG/M
3300031723|Ga0318493_10037027All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Geodermatophilales → Geodermatophilaceae → Geodermatophilus → Geodermatophilus daqingensis2249Open in IMG/M
3300031740|Ga0307468_100729519All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Geodermatophilales → Geodermatophilaceae → Geodermatophilus → Geodermatophilus daqingensis833Open in IMG/M
3300031748|Ga0318492_10139085All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Geodermatophilales → Geodermatophilaceae → Geodermatophilus → Geodermatophilus daqingensis1219Open in IMG/M
3300031748|Ga0318492_10440003Not Available688Open in IMG/M
3300031751|Ga0318494_10057254All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Geodermatophilales → Geodermatophilaceae → Geodermatophilus → Geodermatophilus daqingensis2074Open in IMG/M
3300031751|Ga0318494_10123432Not Available1444Open in IMG/M
3300031768|Ga0318509_10247602All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Geodermatophilales → Geodermatophilaceae → Geodermatophilus → Geodermatophilus daqingensis995Open in IMG/M
3300031768|Ga0318509_10352620Not Available823Open in IMG/M
3300031777|Ga0318543_10123346All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Geodermatophilales → Geodermatophilaceae → Geodermatophilus → Geodermatophilus daqingensis1126Open in IMG/M
3300031778|Ga0318498_10381470Not Available628Open in IMG/M
3300031798|Ga0318523_10438756Not Available648Open in IMG/M
3300031798|Ga0318523_10535579Not Available578Open in IMG/M
3300031831|Ga0318564_10119164Not Available1175Open in IMG/M
3300031835|Ga0318517_10082810Not Available1391Open in IMG/M
3300031859|Ga0318527_10089943Not Available1250Open in IMG/M
3300031879|Ga0306919_10347656Not Available1132Open in IMG/M
3300031880|Ga0318544_10172249Not Available833Open in IMG/M
3300031880|Ga0318544_10202209Not Available767Open in IMG/M
3300031896|Ga0318551_10033828All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Geodermatophilales → Geodermatophilaceae → Geodermatophilus → Geodermatophilus daqingensis2496Open in IMG/M
3300031945|Ga0310913_10674366Not Available732Open in IMG/M
3300031945|Ga0310913_10863173Not Available637Open in IMG/M
3300031946|Ga0310910_10070196All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Geodermatophilales → Geodermatophilaceae → Geodermatophilus → Geodermatophilus daqingensis2527Open in IMG/M
3300031947|Ga0310909_10967068Not Available697Open in IMG/M
3300031954|Ga0306926_11204941All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Geodermatophilales → Geodermatophilaceae → Geodermatophilus → Geodermatophilus daqingensis889Open in IMG/M
3300031959|Ga0318530_10487558Not Available512Open in IMG/M
3300032008|Ga0318562_10202090Not Available1151Open in IMG/M
3300032039|Ga0318559_10171653All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Geodermatophilales → Geodermatophilaceae → Geodermatophilus → Geodermatophilus daqingensis991Open in IMG/M
3300032039|Ga0318559_10452599Not Available599Open in IMG/M
3300032041|Ga0318549_10447227Not Available582Open in IMG/M
3300032054|Ga0318570_10143855All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Geodermatophilales → Geodermatophilaceae → Geodermatophilus → Geodermatophilus daqingensis1064Open in IMG/M
3300032063|Ga0318504_10031493All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Geodermatophilales → Geodermatophilaceae → Geodermatophilus → Geodermatophilus daqingensis2111Open in IMG/M
3300032063|Ga0318504_10107370All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Geodermatophilales → Geodermatophilaceae → Geodermatophilus → Geodermatophilus daqingensis1256Open in IMG/M
3300032066|Ga0318514_10520044Not Available633Open in IMG/M
3300032066|Ga0318514_10689217Not Available543Open in IMG/M
3300032076|Ga0306924_12534776Not Available513Open in IMG/M
3300032090|Ga0318518_10154331Not Available1167Open in IMG/M
3300032261|Ga0306920_103170026Not Available616Open in IMG/M
3300032261|Ga0306920_104109206Not Available526Open in IMG/M
3300032892|Ga0335081_11996306Not Available619Open in IMG/M
3300033289|Ga0310914_11649713Not Available545Open in IMG/M
3300033803|Ga0314862_0052790All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Geodermatophilales → Geodermatophilaceae → Geodermatophilus → Geodermatophilus daqingensis881Open in IMG/M
3300034818|Ga0373950_0053621Not Available797Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil40.78%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil10.68%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil8.74%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere5.83%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere3.88%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil2.91%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil2.91%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere2.91%
WatershedsEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds1.94%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil1.94%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland1.94%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere1.94%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil0.97%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil0.97%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil0.97%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil0.97%
PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland0.97%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere0.97%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere0.97%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere0.97%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere0.97%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.97%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.97%
Rhizosphere SoilHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere Soil0.97%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere0.97%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere0.97%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300004633Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBioEnvironmentalOpen in IMG/M
3300005336Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaGEnvironmentalOpen in IMG/M
3300005338Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2Host-AssociatedOpen in IMG/M
3300005367Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaGHost-AssociatedOpen in IMG/M
3300005467Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaGEnvironmentalOpen in IMG/M
3300005543Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaGHost-AssociatedOpen in IMG/M
3300005549Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaGEnvironmentalOpen in IMG/M
3300005587Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103EnvironmentalOpen in IMG/M
3300005719Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2Host-AssociatedOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300005841Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2Host-AssociatedOpen in IMG/M
3300006046Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101EnvironmentalOpen in IMG/M
3300006871Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3Host-AssociatedOpen in IMG/M
3300006903Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5Host-AssociatedOpen in IMG/M
3300007076Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4Host-AssociatedOpen in IMG/M
3300009012Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159EnvironmentalOpen in IMG/M
3300009094Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2)Host-AssociatedOpen in IMG/M
3300010048Tropical forest soil microbial communities from Panama - MetaG Plot_11EnvironmentalOpen in IMG/M
3300010361Tropical forest soil microbial communities from Panama - MetaG Plot_23EnvironmentalOpen in IMG/M
3300010366Tropical forest soil microbial communities from Panama - MetaG Plot_24EnvironmentalOpen in IMG/M
3300010375Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaGHost-AssociatedOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300010398Tropical forest soil microbial communities from Panama - MetaG Plot_35EnvironmentalOpen in IMG/M
3300010400Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2EnvironmentalOpen in IMG/M
3300012492Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.yng.030610Host-AssociatedOpen in IMG/M
3300012915Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S103-311B-2EnvironmentalOpen in IMG/M
3300012971Tropical forest soil microbial communities from Panama - MetaG Plot_1EnvironmentalOpen in IMG/M
3300013308Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaGHost-AssociatedOpen in IMG/M
3300016270Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080EnvironmentalOpen in IMG/M
3300016294Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178EnvironmentalOpen in IMG/M
3300016341Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170EnvironmentalOpen in IMG/M
3300016387Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176EnvironmentalOpen in IMG/M
3300017939Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_10_MGEnvironmentalOpen in IMG/M
3300017974Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MGEnvironmentalOpen in IMG/M
3300021860Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2014 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021861Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2016 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300025898Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025910Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025916Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025928Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025936Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025986Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026067Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026088Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026498Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-49-AEnvironmentalOpen in IMG/M
3300028884Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_195EnvironmentalOpen in IMG/M
3300031200Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 9_SEnvironmentalOpen in IMG/M
3300031546Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23EnvironmentalOpen in IMG/M
3300031549Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f24EnvironmentalOpen in IMG/M
3300031564Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21EnvironmentalOpen in IMG/M
3300031679Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23EnvironmentalOpen in IMG/M
3300031681Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20EnvironmentalOpen in IMG/M
3300031713Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22EnvironmentalOpen in IMG/M
3300031723Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23EnvironmentalOpen in IMG/M
3300031740Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05EnvironmentalOpen in IMG/M
3300031748Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22EnvironmentalOpen in IMG/M
3300031751Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24EnvironmentalOpen in IMG/M
3300031768Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22EnvironmentalOpen in IMG/M
3300031777Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f24EnvironmentalOpen in IMG/M
3300031778Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f24EnvironmentalOpen in IMG/M
3300031798Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f19EnvironmentalOpen in IMG/M
3300031831Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f20EnvironmentalOpen in IMG/M
3300031835Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f21EnvironmentalOpen in IMG/M
3300031859Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f25EnvironmentalOpen in IMG/M
3300031879Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2)EnvironmentalOpen in IMG/M
3300031880Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f25EnvironmentalOpen in IMG/M
3300031896Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19EnvironmentalOpen in IMG/M
3300031945Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082EnvironmentalOpen in IMG/M
3300031946Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172EnvironmentalOpen in IMG/M
3300031947Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000HEnvironmentalOpen in IMG/M
3300031954Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2)EnvironmentalOpen in IMG/M
3300031959Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f24EnvironmentalOpen in IMG/M
3300032008Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f18EnvironmentalOpen in IMG/M
3300032039Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f21EnvironmentalOpen in IMG/M
3300032041Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f22EnvironmentalOpen in IMG/M
3300032054Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f23EnvironmentalOpen in IMG/M
3300032063Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f17EnvironmentalOpen in IMG/M
3300032066Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f18EnvironmentalOpen in IMG/M
3300032076Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2)EnvironmentalOpen in IMG/M
3300032090Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f22EnvironmentalOpen in IMG/M
3300032261Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2)EnvironmentalOpen in IMG/M
3300032892Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5EnvironmentalOpen in IMG/M
3300033289Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108EnvironmentalOpen in IMG/M
3300033803Tropical peat soil microbial communities from peatlands in Loreto, Peru - MAQ_0_10EnvironmentalOpen in IMG/M
3300034818Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3Host-AssociatedOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
Ga0066395_1085494023300004633Tropical Forest SoilQQTDAQPLSGLLAGQKFGRKGARLRFFATGLGTLNNPGDPENPQSQLEIAGNWSIE*
Ga0070680_10161406423300005336Corn RhizosphereSQTFGRQGTRLRFFATGLGHKTDDAPTAQLEIAGNWSVE*
Ga0068868_10196231423300005338Miscanthus RhizosphereGLAGHRFGHKGLRLRMFATGLGTLTDPVTLNAELEIAGNWSVE*
Ga0070667_10208364823300005367Switchgrass RhizosphereSGPLAGKTFGRVGTRLRFFATGLGHRSDPAPHAQLEIAGNWSIE*
Ga0070706_10085300623300005467Corn, Switchgrass And Miscanthus RhizosphereHALSGPLAGKTFGRVGTRLRFFATGLGHRSDPAPHAQLEIAGNWSIE*
Ga0070672_10073870623300005543Miscanthus RhizospherePLAGKTFGRVGTRLRFFATGLGHRSDPAPHAQLEIAGNWSIE*
Ga0070704_10179801223300005549Corn, Switchgrass And Miscanthus RhizosphereAAHALSGPLAGKTFGRVGTRLRFFATGLGHRSDPAPHAQLEIAGNWSIE*
Ga0066654_1035891323300005587SoilAGQLSGPLAGKRFGRKNQRRRMYATGLGTLTDPATLNASLELAGNWTAD*
Ga0068861_10031483723300005719Switchgrass RhizosphereGRVGTRLRFFATGLGHRSDPAPHAQLEIAGNWSIE*
Ga0066903_10086613113300005764Tropical Forest SoilSGPLAGQKFGSKGTRLRFFATGLGVLTDPVKPNSQLEIAGNWSIE*
Ga0066903_10171836623300005764Tropical Forest SoilRPGAQLRFFATGLGTLTDATKPNSQLEIAGNWSIE*
Ga0068863_10116089423300005841Switchgrass RhizosphereGPLAGRTFGRRGTRLRFFATGLGHRSDPAPHAQLEIAGNWSIE*
Ga0066652_10168672713300006046SoilAHALSGPLAGRTFGRRGTRLRFFATGLGHRSDPAPHAQLEIAGNWSIE*
Ga0075434_10191614723300006871Populus RhizosphereDMLQTAAHTLSGPLSGQKFGRRGARLRFFATGLGALTDAAKPNSQLEIAGNWSIE*
Ga0075426_1079244013300006903Populus RhizosphereAAHALSGPLAGRTFGRRGTRLRFFATGLGHRSDPAPHAQLEIAGNWSIE*
Ga0075435_10128176523300007076Populus RhizosphereAHALSGPLAGKTFGRPGTRLRFFATGIGHRSDPAPHAQLEIAGNWSIE*
Ga0066710_10142260913300009012Grasslands SoilGQKFGRRGARLRFFATGLGALTDAAKPHSQLEIAGNWSIE
Ga0111539_1007132613300009094Populus RhizosphereTLSGPLSGQKFGRRGARLRFFATGLGALTDAAKPNSQLEIAGNWSIE*
Ga0126373_1286396123300010048Tropical Forest SoilGGRELGRQEDGLRCFAPGLGKLTDPAKPNSQLEIAGNWSIE*
Ga0126378_1285710923300010361Tropical Forest SoilGQKFGRPGARLRFFATGLGALIDPVKLHSQLEIAGNWSIE*
Ga0126379_1090331223300010366Tropical Forest SoilGQTFGRRGTRLRFFATGLGHRTDPAPNAQLEIAGNWSIE*
Ga0126379_1112313813300010366Tropical Forest SoilPLAGQKFGRPGARLRFFATGLGALTDAAKPNSQLEIAGNWSVE*
Ga0126379_1178084523300010366Tropical Forest SoilGSLAGQTFGKNGTRLRFFATGIGQRINPAPHAQLEIAGNWSIE*
Ga0105239_1195951913300010375Corn RhizosphereQTAAHALSGPLAGKTFGRVGTRLRFFATGLGHRSDPAPHAQLEIAGNWSIE*
Ga0126381_10084722013300010376Tropical Forest SoilKKGTRLRFFATGLGHKTDDAPTAQLEIAGNWSVE*
Ga0126381_10378531223300010376Tropical Forest SoilLAGQTFGRVGTRLRMFASGLGILADPVTLNSQLELAGNWSIE*
Ga0126383_1293403913300010398Tropical Forest SoilPLAGKTFGRVGTRLRFFATGIGHRSDPAPHAQLEIAGNWSIE*
Ga0134122_1121813723300010400Terrestrial SoilFAHALSGPLSSQTFGRQGTRLRFFATGLGHKTDDAPTAQLEIAGNWSVE*
Ga0157335_104474913300012492Arabidopsis RhizosphereTAAHTLSGPLAGQKFGRRGARLRFFATGLGALTDAAKPNSQLEIAGNWSIE*
Ga0157302_1038885023300012915SoilGRKGTRLRFFATGLGQKTSDAPTAQLEIAGNWSIE*
Ga0126369_1125323913300012971Tropical Forest SoilATLSGPLAGQKFGRPGARLRFFATGLGTLTDATKPNSQLEIAGNWSIE*
Ga0157375_1074678513300013308Miscanthus RhizosphereLAGHRFGHKGLRLRMFATGLGTLTDPVTLNAELEIAGNWSVE*
Ga0182036_1081359423300016270SoilALSGPLAGQKFGRGGARLRFFATGLGHKTSEAPNSQLEIAGNWSIV
Ga0182036_1144347423300016270SoilLQTATHALSGPLAGQKFGRKGTRLRFFATGLGHKLNDAPTAQLEIAGNWSIE
Ga0182041_1087116523300016294SoilPPGTAAQVLSGPLAGQKFGRGGARLRFFATGLGHKTSEAPNSQLEIAGNWSIV
Ga0182035_1107791023300016341SoilGPLAGQKFGRQGARLRFFATGLGMLTDPAPNSQLEIAGNWSIE
Ga0182040_1001376013300016387SoilPLAGKTFGRTGTRLRFFATGIGTRTDLAPHAQLEIAGNWSIE
Ga0182040_1076880213300016387SoilLSGPLAGQNFGRPGARLRFFATGLGTLTDPIAPNSQLEIAGNWSIA
Ga0187775_1018214713300017939Tropical PeatlandTAARALSGPLAGQTFGRRGTRLRFFATGLGQKTSDAPTAQLEIAGNWSVE
Ga0187777_1012697833300017974Tropical PeatlandAQTAARALSGPLSGQTFGRAGTRLRFFATGLGTLTDAAKPNSQLEIAGNWSIE
Ga0213851_150258923300021860WatershedsGPLAGQVFGRKGTRLRFFATGLGHKLSAAPTSQLEIAGNWSIE
Ga0213853_1099012513300021861WatershedsRALSGPLAGQVFGRKGTRLRFFATGLGHKLSAAPTSQLEIAGNWSIE
Ga0207692_1002257613300025898Corn, Switchgrass And Miscanthus RhizosphereFGRPGTRLRFFATGIGHRSDPAPHAQLEIAGNWSIE
Ga0207684_1121241013300025910Corn, Switchgrass And Miscanthus RhizosphereAHALSGPLAGKTFGRVGTRLRFFATGLGHRSDPAPHAQLEIAGNWSIE
Ga0207663_1126225213300025916Corn, Switchgrass And Miscanthus RhizosphereQTAAHALSGPLAGKTFGRPGTRLRFFATGLGHRSDPAPHAQLEIAGNWSIE
Ga0207700_1173203213300025928Corn, Switchgrass And Miscanthus RhizosphereALSGPLSGQTFGRQGTRLRFFATGLGHKTDDAPTAQLEIAGNWSVE
Ga0207670_1159705213300025936Switchgrass RhizosphereKFGVAGLSLRMFATGLGTLVDPATLNSQLEIAGNWATE
Ga0207658_1177448323300025986Switchgrass RhizosphereMAQTAAHALSGPLAGKTFGRVGTRLRFFATGLGHRSDPAPHAQLEIAGNWSIE
Ga0207678_1150702623300026067Corn RhizosphereLAGQKFGRKGTRLRFFATGLGHKLSDAPTAQLEIAGNWSIE
Ga0207641_1106847613300026088Switchgrass RhizosphereFAHALSGPLSSQTFGRQGTRLRFFATGLGHKTDDAPTAQLEIAGNWSVE
Ga0257156_112353013300026498SoilLSGPLSGQKFGQKGTRLRFFATGLGHKTNDAPTAKLEIAGNWSIE
Ga0307308_1017147013300028884SoilLAHALSGPLSSQTFGRKGTRLRFFATGLGHKTDDAPTAQLEIAGNWSVE
Ga0307496_1011391213300031200SoilALSGPLAGKKFGRVGTRLRMFATGLGTLTDPAAPNSQLEIAGNWSIE
Ga0318538_1026666613300031546SoilAATLSGPLAGQKFGRQGTRLRFFATGLGALTSPAPNSQLEIAGNWSIE
Ga0318571_1007590613300031549SoilQKFGSKGTRLRFFATGLGQKTSDAPTAQLEIAGNWSIE
Ga0318571_1042439823300031549SoilLQTAADKLSGPLSGQKFGRKGARLRFFATGLGALTDAAKPNSQLEIAGNWSIE
Ga0318573_1000908253300031564SoilTAATTLSGPLAGQKFGRPGARLRFFATGLGALINSAPNSQLEIAGNWSIE
Ga0318573_1063787913300031564SoilTAAHALSGPLAGQTFGQRGTRLRFFATGLGSKTDPAPHAQLEIAGNWSIE
Ga0318561_1034256513300031679SoilLQTAVGTLAGPLAGQKFGRPGARLRFFATGLGTLTDATKPNSQLEIAGNWSIE
Ga0318572_1068457723300031681SoilMKQTSEATLSGPLAGQNFGRPGARLRFFATGLGTLTDPIAPNSQLEIAGNWSIA
Ga0318496_1056339023300031713SoilAHALSGPLAGKTFGRVGTRLRFFATGIGHRSDPAPHAQLEIAGNWSIE
Ga0318493_1003702713300031723SoilSGPLAGQKFGRQGARLRFFATGLGALTDPTPPNSQLEIAGNWSIQ
Ga0307468_10072951923300031740Hardwood Forest SoilFGRVGTRLRFFATGLGHRSDPAPHAQLEIAGNWSIE
Ga0318492_1013908513300031748SoilALSGPLSGQKFGRKGARLRFFATGLGALTDAAKPNSQLEIAGNWSIE
Ga0318492_1044000323300031748SoilPLAGQKFGRPGAQLRFFATGLGTLTDATKPNSQLEIAGNWSIE
Ga0318494_1005725413300031751SoilMLQTATATLSGPLAGQKFGRPGAQLRFFATGLGTLTDATKPNSQLEIAGNWSIE
Ga0318494_1012343223300031751SoilHALSGPLAGQTFGQQGTRLRFFATGLGNKTDPAPHAQLEIAGNWSIE
Ga0318509_1024760213300031768SoilLAGQKFGKKGARLRFFATGLGTRTDPVLFHSQLEIAGNWSIE
Ga0318509_1035262013300031768SoilQKFGRQGARLRFFATGLGALTDPTPPNSQLEIAGNWSIQ
Ga0318543_1012334613300031777SoilELLSGPLAGQKFGRQGARLRFFATGLGALTDPTPPNSQLEIAGNWSIQ
Ga0318498_1038147013300031778SoilGQKFGSKGTRLRFFATGLGQKTSDAPTAQLEIAGNWSIE
Ga0318523_1043875613300031798SoilKFGRPGARLRFFATGLGALTSPAPNSQLEIAGNWSIE
Ga0318523_1053557913300031798SoilFGQRGTRLRFFATGLGNKTDPAPHAQLEIAGNWSIE
Ga0318564_1011916413300031831SoilLQTDAATLSGPLAGQKFGRQGARLRFFATGLGALTDPTPPNSQLEIAGNWSIQ
Ga0318517_1008281013300031835SoilSGPLAGQKFGRPGAQLRFFATGLGALINSSPNSQLEIAGNWSIE
Ga0318527_1008994313300031859SoilTTVGTLAGPLAGQKFGRPGARLRFFATGLGTLTDATKPNSQLEIAGNWSIE
Ga0306919_1034765623300031879SoilQTAADKLSGPLSGQKFGRKGARLRFFATGLGALTDAAKPNSQLEIAGNWSIE
Ga0318544_1017224913300031880SoilDMVQTAAQALSGPLAGQKFGRGGARLRFFATGLGHKTSEAPNSQLEIAGNWSIV
Ga0318544_1020220913300031880SoilAAAKLSGPLAGQKFGRKGTRLRFFATGLGFKTDPAPNANLEIAGNWSIE
Ga0318551_1003382833300031896SoilQTATATLSGPLAGQKFGRPGAQLRFFATGLGTLTDATKPNSQLEIAGNWSIE
Ga0310913_1067436623300031945SoilAPLAGPQAGQKFGRPGARLRFFATGLGALTSPAPNSQLEIAGNWSIE
Ga0310913_1086317323300031945SoilTLSGPLAGQNFGRPGARLRFFATGLGTLTDPIAPNSQLEIAGNWSIA
Ga0310910_1007019643300031946SoilDMLQTAANALSGPLSGQKFGRKGARLRFFATGLGALTDAAKPNSQLEIAGNWSIE
Ga0310909_1096706823300031947SoilRLSGPLAGQRFGRKGARLRFFATGLGFKTDPAPNANLEIAGNWSIE
Ga0306926_1120494123300031954SoilLAGQTFGRRGTRLRFFATGLGHRTDPAPNAQLEIAGNWSIE
Ga0318530_1048755823300031959SoilALSGPLAGQMFGRPGARLRFFATGLGHKTDPAPNAQLEIAGNWSIE
Ga0318562_1020209013300032008SoilSGFRARLRFFATGLGTLTDATKPNSQLEIAGNWSIE
Ga0318559_1017165313300032039SoilSGPLAGQKFGRPGAQLRFFATGLGTLTDATKPNSQLEIAGNWSIE
Ga0318559_1045259923300032039SoilKQTSAATLSGPLAGQNFGRPGARLRFFATGLGTLTDPIAPNSQLEIAGNWSIA
Ga0318549_1044722723300032041SoilLQTAAQALSGPLAGQTFGQRGTRLRFFATGLGNKTDPAPHAQLEIAGNWSIE
Ga0318570_1014385523300032054SoilQRFGRKGARLRFFATGLGFKTDPAPNANLEIAGNWSIE
Ga0318504_1003149333300032063SoilMVQTAAQALSGPLAGQKFGRGGARLRFFATGLGHKTSEAPNSQLEIAGNWSIV
Ga0318504_1010737013300032063SoilAAAALSGPLAGQKFGRQGARLRFFATGLGALTDPTPPNSQLEIAGNWSIQ
Ga0318514_1052004423300032066SoilATLSGPLAGQKFGRPGAQLRFFATGLGTLTDATKPNSQLEIAGNWSIE
Ga0318514_1068921723300032066SoilGQKFGRQGARLRFFATGLGALTDPTPPNSQLEIAGNWSIQ
Ga0306924_1253477613300032076SoilGTLAGPLAGQKFGRPGARLRFFATGLGTLTDATKPNSQLEIAGNWSIE
Ga0318518_1015433113300032090SoilPLAGQKFGRPGARLRFFATGLGTLTDATKPNSQLEIAGNWSIE
Ga0306920_10317002623300032261SoilAQRLSGPLAGQKFGQKGARLRFFATGLGALTDAAKPNSQLEIAGNWSIE
Ga0306920_10410920613300032261SoilLQTAAHALSGPLAGQTFGQRGTRLRFFATGLGSKTDPAPHAQLEIAGNWSIE
Ga0335081_1199630623300032892SoilAAHALSGPLSGQKFGRKGTRLRFFATGLGALTDAAKPNSQLEIAGNWSIE
Ga0310914_1164971323300033289SoilAATLTGPLAGQKFGRPGARLRFFATGLGTLTDPTKPNSQLEIAGNWSIE
Ga0314862_0052790_741_8813300033803PeatlandQLSGPLAGQVFGRKGTRLRFFATGLGQKTSDAPTAQLEIAGNWSIE
Ga0373950_0053621_2_1333300034818Rhizosphere SoilGPLAGQKFGRKGTRLRFFATGLGHKLSDAPTAQLEIAGNWSIE


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.