NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F098740

Metagenome Family F098740

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F098740
Family Type Metagenome
Number of Sequences 103
Average Sequence Length 112 residues
Representative Sequence MNLRKTCLLCAGLVTTLGIIWMVGLPLQAGHAGSATGVGSVYAANVQQETVRHRRPLSLRMLAHVLNDCEQKGRPIHPGLVRWASRALSSEEGQNTFQKSGDQLFGRPSFQSMSSITN
Number of Associated Samples 90
Number of Associated Scaffolds 103

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 75.73 %
% of genes near scaffold ends (potentially truncated) 35.92 %
% of genes from short scaffolds (< 2000 bps) 85.44 %
Associated GOLD sequencing projects 84
AlphaFold2 3D model prediction No

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (100.000 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine
(16.505 % of family members)
Environment Ontology (ENVO) Unclassified
(50.485 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(74.757 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: Yes Secondary Structure distribution: α-helix: 48.31%    β-sheet: 0.00%    Coil/Unstructured: 51.69%
Feature Viewer
Powered by Feature Viewer

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 103 Family Scaffolds
PF16347DUF4976 16.50
PF05057DUF676 8.74
PF00884Sulfatase 3.88
PF01878EVE 0.97
PF13673Acetyltransf_10 0.97
PF06283ThuA 0.97
PF03372Exo_endo_phos 0.97

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 103 Family Scaffolds
COG1673Predicted RNA-binding protein, contains PUA-like EVE domainGeneral function prediction only [R] 0.97
COG2947Predicted RNA-binding protein, contains EVE domainGeneral function prediction only [R] 0.97
COG4813Trehalose utilization proteinCarbohydrate transport and metabolism [G] 0.97

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms100.00 %
UnclassifiedrootN/A0.00 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300001972|GOS2216_10045514All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes856Open in IMG/M
3300001974|GOS2246_10004037All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales1849Open in IMG/M
3300002033|GOS24894_10457952All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes810Open in IMG/M
3300002040|GOScombined01_100158060All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes856Open in IMG/M
3300002231|KVRMV2_100488927All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes2823Open in IMG/M
3300003539|FS891DNA_10388544All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes1757Open in IMG/M
3300005239|Ga0073579_1190221All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes251146Open in IMG/M
3300005837|Ga0078893_12641933All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes906Open in IMG/M
3300005838|Ga0008649_10122370All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes1057Open in IMG/M
3300007236|Ga0075463_10141418All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes777Open in IMG/M
3300007236|Ga0075463_10289976All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium525Open in IMG/M
3300007756|Ga0105664_1019590All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Pirellulaceae → Rhodopirellula2345Open in IMG/M
3300007956|Ga0105741_1017626All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes1802Open in IMG/M
3300009058|Ga0102854_1041772All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes1320Open in IMG/M
3300009077|Ga0115552_1190588All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium845Open in IMG/M
3300009127|Ga0118724_1050587All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Pirellulaceae → Rhodopirellula2994Open in IMG/M
3300009127|Ga0118724_1253358All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium797Open in IMG/M
3300009373|Ga0118719_1171701All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes1131Open in IMG/M
3300009445|Ga0115553_1241608All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes709Open in IMG/M
3300009528|Ga0114920_10093258All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes1910Open in IMG/M
3300009528|Ga0114920_10458167All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium869Open in IMG/M
3300009528|Ga0114920_10618935All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium740Open in IMG/M
3300009528|Ga0114920_11196465All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes521Open in IMG/M
3300009529|Ga0114919_10008466All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Pirellulaceae → Rhodopirellula8126Open in IMG/M
3300009529|Ga0114919_10053707All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Pirellulaceae → Rhodopirellula2976Open in IMG/M
3300009550|Ga0115013_10220899All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes1143Open in IMG/M
3300009593|Ga0115011_10352272All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes1133Open in IMG/M
3300009703|Ga0114933_10781347All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium609Open in IMG/M
3300009790|Ga0115012_10019134All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Pirellulaceae → Rhodopirellula4295Open in IMG/M
3300009790|Ga0115012_10247257All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes1324Open in IMG/M
3300011013|Ga0114934_10006832All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Pirellulaceae → Rhodopirellula6783Open in IMG/M
3300012936|Ga0163109_11291381All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes532Open in IMG/M
3300012953|Ga0163179_10289921All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes1290Open in IMG/M
3300012954|Ga0163111_11080970All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes778Open in IMG/M
3300013101|Ga0164313_10833248All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes756Open in IMG/M
3300017824|Ga0181552_10332505All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes741Open in IMG/M
3300017950|Ga0181607_10409994All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium738Open in IMG/M
3300018036|Ga0181600_10399944All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes667Open in IMG/M
3300018420|Ga0181563_10696987All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes561Open in IMG/M
3300018876|Ga0181564_10028357All Organisms → cellular organisms → Bacteria4082Open in IMG/M
3300020165|Ga0206125_10025436All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae3379Open in IMG/M
3300020166|Ga0206128_1293728All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium581Open in IMG/M
3300020169|Ga0206127_1208501All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium703Open in IMG/M
3300020173|Ga0181602_10398133All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes541Open in IMG/M
3300020177|Ga0181596_10018639All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae4998Open in IMG/M
3300020187|Ga0206130_10199737All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes964Open in IMG/M
3300020276|Ga0211509_1059746All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium888Open in IMG/M
3300020337|Ga0211508_1071773All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium802Open in IMG/M
3300020347|Ga0211504_1018820All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae1880Open in IMG/M
3300020349|Ga0211511_1055681All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium975Open in IMG/M
3300020352|Ga0211505_1101681All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes685Open in IMG/M
3300020401|Ga0211617_10237655All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes757Open in IMG/M
3300020403|Ga0211532_10343164All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes569Open in IMG/M
3300020438|Ga0211576_10166556All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes1186Open in IMG/M
3300020439|Ga0211558_10296219All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes758Open in IMG/M
3300020439|Ga0211558_10323318All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes720Open in IMG/M
3300020442|Ga0211559_10522164All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes541Open in IMG/M
3300020451|Ga0211473_10689952All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes512Open in IMG/M
3300020453|Ga0211550_10589704All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes520Open in IMG/M
3300020454|Ga0211548_10112834All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes1302Open in IMG/M
3300020462|Ga0211546_10495195All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes616Open in IMG/M
3300020469|Ga0211577_10151863All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes1560Open in IMG/M
3300020469|Ga0211577_10359188All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes909Open in IMG/M
3300020595|Ga0206126_10061231All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae1987Open in IMG/M
3300020810|Ga0181598_1224055All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes706Open in IMG/M
3300021087|Ga0206683_10207004All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium1027Open in IMG/M
3300021087|Ga0206683_10252758All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes911Open in IMG/M
3300021185|Ga0206682_10177463All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes985Open in IMG/M
3300021365|Ga0206123_10171250All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium982Open in IMG/M
3300021375|Ga0213869_10181271All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium961Open in IMG/M
3300021378|Ga0213861_10247649All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes942Open in IMG/M
3300021389|Ga0213868_10219313All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes1129Open in IMG/M
(restricted) 3300022916|Ga0233431_1082918All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes1552Open in IMG/M
3300022923|Ga0255783_10117451All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes1360Open in IMG/M
(restricted) 3300024243|Ga0233436_1101133All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes937Open in IMG/M
(restricted) 3300024257|Ga0233442_1075611All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium963Open in IMG/M
3300024297|Ga0228658_1072560All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium865Open in IMG/M
3300024321|Ga0228626_1069546All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes808Open in IMG/M
(restricted) 3300024336|Ga0233447_1020248All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Pirellulaceae → Rhodopirellula2681Open in IMG/M
3300024429|Ga0209991_10276600All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes810Open in IMG/M
3300024429|Ga0209991_10370731All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium674Open in IMG/M
3300024432|Ga0209977_10017958All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Pirellulaceae → Rhodopirellula3366Open in IMG/M
3300024433|Ga0209986_10130343All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes1326Open in IMG/M
3300025696|Ga0209532_1212573All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium543Open in IMG/M
3300025810|Ga0208543_1126732All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium602Open in IMG/M
3300025870|Ga0209666_1281920All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes666Open in IMG/M
3300025890|Ga0209631_10015695All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae6385Open in IMG/M
3300026491|Ga0228641_1017743All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes1943Open in IMG/M
3300027553|Ga0208947_1013643All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Pirellulaceae → Rhodopirellula2393Open in IMG/M
3300027858|Ga0209013_10189131All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes1255Open in IMG/M
3300027906|Ga0209404_10517697All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium791Open in IMG/M
3300028135|Ga0228606_1030614All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes1467Open in IMG/M
3300028136|Ga0228608_1166737All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes587Open in IMG/M
3300028197|Ga0257110_1046169All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Pirellulaceae → Rhodopirellula1904Open in IMG/M
3300028297|Ga0228617_1120638All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes616Open in IMG/M
3300028397|Ga0228639_1037546All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes1441Open in IMG/M
3300028418|Ga0228615_1053817All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes1205Open in IMG/M
3300031773|Ga0315332_10352380All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium945Open in IMG/M
3300032011|Ga0315316_11249898All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes594Open in IMG/M
3300032011|Ga0315316_11536033All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium522Open in IMG/M
3300032032|Ga0315327_10538531All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes724Open in IMG/M
3300032088|Ga0315321_10151973All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes1547Open in IMG/M
3300032088|Ga0315321_10444731All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes796Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine16.50%
SeawaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Seawater10.68%
Deep SubsurfaceEnvironmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface9.71%
SeawaterEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater8.74%
Salt MarshEnvironmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh8.74%
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine6.80%
SeawaterEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Seawater5.83%
MarineEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine4.85%
SeawaterEnvironmental → Aquatic → Marine → Inlet → Unclassified → Seawater3.88%
MarineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Marine2.91%
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous2.91%
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine1.94%
Surface SeawaterEnvironmental → Aquatic → Marine → Oceanic → Photic Zone → Surface Seawater1.94%
Pelagic MarineEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine1.94%
Pelagic MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine1.94%
Deep SubsurfaceEnvironmental → Aquatic → Marine → Volcanic → Unclassified → Deep Subsurface1.94%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater0.97%
Background SeawaterEnvironmental → Aquatic → Marine → Oceanic → Aphotic Zone → Background Seawater0.97%
Marine Surface WaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Marine Surface Water0.97%
Estuary WaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water0.97%
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine0.97%
Diffuse Hydrothermal Flow Volcanic VentEnvironmental → Aquatic → Marine → Hydrothermal Vents → Diffuse Flow → Diffuse Hydrothermal Flow Volcanic Vent0.97%
Marine SedimentEnvironmental → Aquatic → Marine → Hydrothermal Vents → Sediment → Marine Sediment0.97%
Marine SedimentEnvironmental → Aquatic → Marine → Hydrothermal Vents → Sediment → Marine Sediment0.97%
MarineEnvironmental → Aquatic → Marine → Oil Seeps → Unclassified → Marine0.97%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
3300001972Marine microbial communities from the Sargasso Sea - GS000dEnvironmentalOpen in IMG/M
3300001974Marine microbial communities from Upwelling, Fernandina Island, Equador - GS031EnvironmentalOpen in IMG/M
3300002033Marine microbial communities from the Sargasso Sea - GS000a &bEnvironmentalOpen in IMG/M
3300002040GS000c - Sargasso Station 3EnvironmentalOpen in IMG/M
3300002231Marine sediment microbial communities from Santorini caldera mats, Greece - red matEnvironmentalOpen in IMG/M
3300003539Diffuse hydrothermal flow volcanic vent microbial communities from Axial Seamount, northeast Pacific ocean - Sample FS891_Anemone_DNAEnvironmentalOpen in IMG/M
3300005239Environmental Genome Shotgun Sequencing: Ocean Microbial Populations from the Gulf of MaineEnvironmentalOpen in IMG/M
3300005837Exploring phylogenetic diversity in Port Hacking ocean in Sydney, Australia - Port Hacking PH4 TJ4-TJ18EnvironmentalOpen in IMG/M
3300005838Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI037_S2LV_130m_DNAEnvironmentalOpen in IMG/M
3300007236Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_>0.8_DNAEnvironmentalOpen in IMG/M
3300007756Diffuse hydrothermal flow volcanic vent microbial communities from Axial Seamount, northeast Pacific ocean - Sample CTDBack_2015_DNA CLC_assemblyEnvironmentalOpen in IMG/M
3300007956Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1459A_0.2umEnvironmentalOpen in IMG/M
3300009058Estuarine microbial communities from the Columbia River estuary - metaG 1370A-02EnvironmentalOpen in IMG/M
3300009077Pelagic marine microbial communities from North Sea - COGITO_mtgs_110328EnvironmentalOpen in IMG/M
3300009127Combined Assembly of Gp0137036, Gp0137038EnvironmentalOpen in IMG/M
3300009373Combined Assembly of Gp0127950, Gp0127951EnvironmentalOpen in IMG/M
3300009445Pelagic marine microbial communities from North Sea - COGITO_mtgs_110331EnvironmentalOpen in IMG/M
3300009528Deep subsurface microbial communities from South Pacific Ocean to uncover new lineages of life (NeLLi) - Chile_00310 metaGEnvironmentalOpen in IMG/M
3300009529Deep subsurface microbial communities from Black Sea to uncover new lineages of life (NeLLi) - Black_00105 metaGEnvironmentalOpen in IMG/M
3300009550Marine eukaryotic phytoplankton communities from Atlantic Ocean - South Atlantic ANT15 MetagenomeEnvironmentalOpen in IMG/M
3300009593Marine eukaryotic phytoplankton communities from Atlantic Ocean - Tropical Atlantic ANT8 MetagenomeEnvironmentalOpen in IMG/M
3300009703Deep subsurface microbial communities from Kolumbo volcano to uncover new lineages of life (NeLLi) - 4SBTROV12_W25 metaGEnvironmentalOpen in IMG/M
3300009790Marine eukaryotic phytoplankton communities from Atlantic Ocean - Tropical Atlantic ANT10 MetagenomeEnvironmentalOpen in IMG/M
3300011013Deep subsurface microbial communities from Kolumbo volcano to uncover new lineages of life (NeLLi) - 4SBTROV10_white metaGEnvironmentalOpen in IMG/M
3300012936Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St13 metaGEnvironmentalOpen in IMG/M
3300012953Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Atlantic ANT 2 MetagenomeEnvironmentalOpen in IMG/M
3300012954Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St18 metaGEnvironmentalOpen in IMG/M
3300013101Subseafloor sediment microbial communities from Guaymas Basin, Gulf of California, Mexico - Guay4, Core 4569-4, 0-3 cmEnvironmentalOpen in IMG/M
3300017824Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011501BT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300017950Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041413US metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018036Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041406US metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018420Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011512CT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018876Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011513CT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300020165Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160331_1EnvironmentalOpen in IMG/M
3300020166Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160426_1EnvironmentalOpen in IMG/M
3300020169Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160419_1EnvironmentalOpen in IMG/M
3300020173Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041408US metaG (spades assembly)EnvironmentalOpen in IMG/M
3300020177Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041402US metaG (spades assembly)EnvironmentalOpen in IMG/M
3300020187Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160512_1EnvironmentalOpen in IMG/M
3300020276Marine microbial communities from Tara Oceans - TARA_E500000075 (ERX289007-ERR315858)EnvironmentalOpen in IMG/M
3300020337Marine microbial communities from Tara Oceans - TARA_E500000075 (ERX289009-ERR315861)EnvironmentalOpen in IMG/M
3300020347Marine microbial communities from Tara Oceans - TARA_B100000497 (ERX556109-ERR598994)EnvironmentalOpen in IMG/M
3300020349Marine microbial communities from Tara Oceans - TARA_E500000081 (ERX289006-ERR315859)EnvironmentalOpen in IMG/M
3300020352Marine microbial communities from Tara Oceans - TARA_B100000497 (ERX556084-ERR599144)EnvironmentalOpen in IMG/M
3300020401Marine microbial communities from Tara Oceans - TARA_B100000212 (ERX555985-ERR599139)EnvironmentalOpen in IMG/M
3300020403Marine microbial communities from Tara Oceans - TARA_B100000085 (ERX556015-ERR599145)EnvironmentalOpen in IMG/M
3300020438Marine microbial communities from Tara Oceans - TARA_B100001094 (ERX555907-ERR598942)EnvironmentalOpen in IMG/M
3300020439Marine microbial communities from Tara Oceans - TARA_B100001939 (ERX556062-ERR599029)EnvironmentalOpen in IMG/M
3300020442Marine microbial communities from Tara Oceans - TARA_B100002019 (ERX556121-ERR599162)EnvironmentalOpen in IMG/M
3300020451Marine microbial communities from Tara Oceans - TARA_B100001778 (ERX555927-ERR598996)EnvironmentalOpen in IMG/M
3300020453Marine microbial communities from Tara Oceans - TARA_B100001758 (ERX556003-ERR598963)EnvironmentalOpen in IMG/M
3300020454Marine microbial communities from Tara Oceans - TARA_B100001769 (ERX556037-ERR599170)EnvironmentalOpen in IMG/M
3300020462Marine microbial communities from Tara Oceans - TARA_B100001559 (ERX556040-ERR598986)EnvironmentalOpen in IMG/M
3300020469Marine microbial communities from Tara Oceans - TARA_B100001093 (ERX555967-ERR599052)EnvironmentalOpen in IMG/M
3300020595Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160412_1EnvironmentalOpen in IMG/M
3300020810Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041404US metaG (spades assembly)EnvironmentalOpen in IMG/M
3300021087Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 80m 12015EnvironmentalOpen in IMG/M
3300021185Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 40m 12015EnvironmentalOpen in IMG/M
3300021365Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160316_1EnvironmentalOpen in IMG/M
3300021375Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO132EnvironmentalOpen in IMG/M
3300021378Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO131EnvironmentalOpen in IMG/M
3300021389Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO127EnvironmentalOpen in IMG/M
3300022916 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_118_April2016_200_MGEnvironmentalOpen in IMG/M
3300022923Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011507BT metaGEnvironmentalOpen in IMG/M
3300024243 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_122_August2016_150_MGEnvironmentalOpen in IMG/M
3300024257 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_123_September2016_150_MGEnvironmentalOpen in IMG/M
3300024297Seawater microbial communities from Monterey Bay, California, United States - 71DEnvironmentalOpen in IMG/M
3300024321Seawater microbial communities from Monterey Bay, California, United States - 31DEnvironmentalOpen in IMG/M
3300024336 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_124_October2016_135_MGEnvironmentalOpen in IMG/M
3300024429Deep subsurface microbial communities from South Pacific Ocean to uncover new lineages of life (NeLLi) - Chile_00310 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300024432Deep subsurface microbial communities from Indian Ocean to uncover new lineages of life (NeLLi) - Sumatra_00607 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300024433Deep subsurface microbial communities from Black Sea to uncover new lineages of life (NeLLi) - Black_00105 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025696Pelagic Microbial community sample from North Sea - COGITO 998_met_02 (SPAdes)EnvironmentalOpen in IMG/M
3300025810Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_>0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025870Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI037_S3LV_125m_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025890Pelagic Microbial community sample from North Sea - COGITO 998_met_08 (SPAdes)EnvironmentalOpen in IMG/M
3300026491Seawater microbial communities from Monterey Bay, California, United States - 52DEnvironmentalOpen in IMG/M
3300027553Ammonia-oxidizing marine microbial communities from Monterey Bay, California, USA - CAN11_04_M0_20 (SPAdes)EnvironmentalOpen in IMG/M
3300027858Oil polluted marine microbial communities from Coal Oil Point, Santa Barbara, California, USA - Sample 2 (SPAdes)EnvironmentalOpen in IMG/M
3300027906Marine eukaryotic phytoplankton communities from Atlantic Ocean - Tropical Atlantic ANT8 Metagenome (SPAdes)EnvironmentalOpen in IMG/M
3300028135Seawater microbial communities from Monterey Bay, California, United States - 7DEnvironmentalOpen in IMG/M
3300028136Seawater microbial communities from Monterey Bay, California, United States - 9DEnvironmentalOpen in IMG/M
3300028197Marine microbial communities from Northeast Subartic Pacific Ocean, Canada - LP_J_2015_P26_10mEnvironmentalOpen in IMG/M
3300028297Seawater microbial communities from Monterey Bay, California, United States - 18DEnvironmentalOpen in IMG/M
3300028397Seawater microbial communities from Monterey Bay, California, United States - 50DEnvironmentalOpen in IMG/M
3300028418Seawater microbial communities from Monterey Bay, California, United States - 16DEnvironmentalOpen in IMG/M
3300031773Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 100m 34915EnvironmentalOpen in IMG/M
3300032011Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 60m 3416EnvironmentalOpen in IMG/M
3300032032Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 100m 32315EnvironmentalOpen in IMG/M
3300032088Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 80m 21515EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
GOS2216_1004551413300001972MarineMNLCKTCLLCAGLVTTLGIIWMVGVPLQAGHAGSATGVGSVYAANVQQELVRHRRPVSLRMLARVLNDCEQKSKPIHPGLVRWASRALSLEEGQNTFQKSGDQLFGRPSFQSISSIAN*
GOS2246_1000403713300001974MarineMVGVPLQAGHAGSATGVGSVYATNVQQELVRHRRPLSLRMLARVLNDCEQKGKSIHPGLVRWASRAVSSEEGQNTFQESGDQLFGRPSFQSISSISN*
GOS24894_1045795213300002033MarineMNLRKTCLLCIGLGTTLGIIWMVGVPLQAGHAGSATGVGSVYAANVQQEIVRHRRPVSLRMLARVLNDCEQKGKPIHPGLVRWASRALSLEEGQNTFQKSGDQLFGRPSFQSISSIAN
GOScombined01_10015806013300002040MarineMNLCKTCLLCAGLGTTLGIIWMVGVPLQAGHAGSATGVGSVYAANVQQELVRHRRPVSLRMLARVLNDCEQKSKPIHPGLVRWASRALSLEEGQNTFQKSGDQLFGRPSFQSISSIAN*
KVRMV2_10048892733300002231Marine SedimentMNLRKTCLLCATLVTSLGVIWLVGLPLQAGHAVSATGVGSVYAANVQQETVRHRRPVSLRMLARVLNDCEQKGRPYHPGLVRWASRALSSEEGQNTFQKSGDHLFGRPSFQSMSSIAN*
FS891DNA_1038854423300003539Diffuse Hydrothermal Flow Volcanic VentMNLRKRCLLCATLVTTLGMIWIVGLELQAGHAVSATGVGSVYVANVQQETVRHRRPLSLRTLAHVLHDCEQKGNPIHPGLVRWASRALSSEEGQNTFQKSGDQLFGRPSFQSMSSITN*
Ga0073579_11902211793300005239MarineMNLRKRCLLCATLVTTLGMIWMVGLPLQAGHAVSATGVGSVYAANVQQETVRHRRPLSLRTLAHVLHDCEQKGNPIHPGLVRWASRALSSEEGQNTFQKSGDHLFGRPSFQSMSSITN*
Ga0078893_1264193313300005837Marine Surface WaterMNMRKTCLLCVGGFTTLVVVWLSGLLLQTGHAGPAAGVGSVYATNVQQETGRHRRPVSLRMLAHVLHDCDQKSKPIHPGIVRWASRALPSEEVQKMSDHQLFGLASFQSVSRTSY*
Ga0008649_1012237023300005838MarineMNFRKTYLLCAGLFTTFVVVCVSGFRLQAGHASAATGVGSVYAANVQQEPVTHRQPLSLRMLARVLHDCDQKGKPIHPGLVRWASRALSSEEGQNTFQKSGDQLFGRPSFQSMSSITN*
Ga0075463_1014141813300007236AqueousMSGLLLEAGHAGPATGVGSVYAANVQQEKEQYRHPLSLRTLARVLHDCDKRGKPIHPGLVRWASRGLSSAEGQKVSDDQLFGLVSFQPVSNISH*
Ga0075463_1028997623300007236AqueousMNFRKTCLLCAGLVTTLGIIWMVGVPLQAGHASSAAGVGSVYAANVQQERVRHRRPLSLRMLARVLNDCEQKGKPIHPGLVRWASRSLSSEEGQNIFQKSGEQLFGRPSFQSISSITN*
Ga0105664_101959023300007756Background SeawaterMNLRKRCLLCATLVTTLGMIWIVGLTLQAGHAVSATGVGSVYVANVQQETVRHRRPLSLRTLAHVLHDCEQKGNPIHPGLVRWASRALSSEESQNTFQKSEDQLFGRLSFQSMSSITN*
Ga0105741_101762623300007956Estuary WaterMIWIVGLTLQAGHAVSATGVGSVYVANVQQETVRHRRPLSLRTLAHVLHDCEQKGNPIHPGLVRWASRALSSEEGQNTFQKSEDQLFGRPSFQSMSSITN*
Ga0102854_104177223300009058EstuarineMIWIVGLTLQAGHAVSATGVGSVYVANVQQETVRHRRPLSLRTLAHVLHDCEQKGNPIHPGLVRWASRALSSEEGQNTFQKSGDQLFGRPSFQSMSSITN*
Ga0115552_119058813300009077Pelagic MarineMNFRKTCLLCAGLVATLGIIWMVGVPLQAGHASSAAGVGSVYAANVQQERVRHRRPLSLRMLARVLNDCEQKGKPIHPGLVRWASRSLSSEEGQNIFQKSGEQLFGHPSFQSISSITN*
Ga0118724_105058723300009127MarineMNMRKTCLLCVGGFTTLVVVWLSGLLLQTGHAGPAAGVGSVYATNMQQETGRHRRPVSLRMLAHVLHDCEQKSKPIHPGVVRWASRALPTEEVQKVSDHQLFGLASFQSLPHTSY*
Ga0118724_125335823300009127MarineMVGLPLQARHAGSAAGVGSVYAANVQQELVRHRRPVSLRMLARVLNDCEQKGKPIHPGLVRWASRALSSEEGQNTFQKSGDQLFGRPSFQSISSIAN*
Ga0118719_117170113300009373MarineMNMRKTCLLCVGGFTTLVVVWLSGLLLQTGHAGPAAGVGSVYATNVQQETGRHRRPVSLRMLAHVLHDCEQKSKPIHPGVVRWASRALPTEEVQKVS
Ga0115553_124160823300009445Pelagic MarineQAGHAGSATGVGSVYAANVQQERVRHRRPLSLRMLARVLNDCEQKGKPIHPGLVRWASRSLSSEEGQNIFQKSGDQLFGHPSFQSISSITN*
Ga0114920_1009325813300009528Deep SubsurfaceMNFRKTCLLCAGLVTSLGMIWMVGVPLQAGHAGSATGVGSVFAAKVEQEPVTHRQPVSLRMLARVLHHCDENGKPIHAGFVRWASRAIPSGEGVDAFPHVSGDQLFGRDSFQSVSNKTR*
Ga0114920_1045816713300009528Deep SubsurfaceMIWMVGLTLQAGHAVSATGVGSVYAANVQQETVRHRRPLSLRTLAHVLHDCEQKGNPIHPGLVRWASRALSSEEGQNTFQKSGDQLFGRPSFQSMS
Ga0114920_1061893523300009528Deep SubsurfaceMNLRKTCLLCATLVTSLGVIWLVGLPLQAGHAVSATGVGSVYAANVQQELVRHRRPVSLRMLARVLNDCEQKGRPYHPGLVRWASRALSSEEGQNTFQKSG
Ga0114920_1119646513300009528Deep SubsurfaceAGLVTTFGMIWMVGLLLQTGHAGSATGVGSVYAANVQQKKVRHRRPLSLSTLARVLNDCEQKGNPIHPGLVRWASRALSSEEGQNTFQKSGDQLFGRPSFQSMSSITN*
Ga0114919_1000846623300009529Deep SubsurfaceMNFRKTCLLCAGLVATLGIIWMVGVPLQAGHASSAAGVGSVYAANVQQERVRHRRPLSLRMLARVLNDCEQKGKPIHPGLVRWASRSLSSEEGQNIFQKSGEQLFGRPSFQSISSITN*
Ga0114919_1005370723300009529Deep SubsurfaceMNLRKTCLLCATLVTSFGVIWLVGLPLQAGHAVSAAGVGSVYAANVQQELVRHRRPVSLRMLARVLNDCEQKGRPYHPGLVRWASRALSSEEGQNTFQKSGDHLFGRPSFQSMSSIAN*
Ga0115013_1022089923300009550MarineMNLRKTCLLCAGLVTTLGIIWMVGVPLQAGHAGSATGVGSVYATNVQQEPVRHRRPLSLRMLAHVLNDCEQKGRPIHPGLVRWASRALSSEEGQNTFQKSGDQLFGRPSFQSISSITN*
Ga0115011_1035227223300009593MarineMSLRKTCLLCAGLVTTLGISWMVRLPLQAGHAGSAAGVGSVYAANVQQELVRHRRPVSLRMLARVLNDCEQKGKPIHPGLVRWASRALSSEEGQNTFQKSGDQLFGRPSFQSISSIAN*
Ga0114933_1078134713300009703Deep SubsurfaceMNLRKTCLLCATLVTSLGVIWLVGLPLQAGHAVSATGVGSVYAANVQQETVRHRRPVSLRMLARVLNDCERKGRPYHPGLVRWASRALSSEEGQNTFQKSGDHLFGRPSFQSMSSIAN*
Ga0115012_1001913433300009790MarineMNLCKTCLLCAGLVTTLGIIWMVGVPLQAGHAGSATGVGSVYAANVQQELVRHRRPLSLRMLARVLNDCEQKCKPIHPGLVRWASRALSSEEGQNTFQKSGDQLFGRPSFQSISSIAN*
Ga0115012_1024725723300009790MarineMNFRKMFLLCGGASVMLFIVWVSGLLLQTGHAGSASGVGSVYATNIQQDMLTRRQPLSLRTLARVLHDCDQKGKRIHPGFVRWASRALSSEEVQKVSDSQLFGLASFQSVSHTSY*
Ga0114934_1000683233300011013Deep SubsurfaceMNLRKTCLLCATLVTSLGVIWLVGLPLQAGHAVSATGVGSVYAANVQQELVRHRRPVSLRMLARVLNDCEQKGRPYHPGLVRWASRALSSEEGQNTFQKSGDHLFGRPSFQSMSSIAN*
Ga0163109_1129138113300012936Surface SeawaterMNFRKIFLLCGGASVALFIVWVSGLLLQTGHAGSASGVGSVYATNIQQDMLTRRQPLSLRTLARVLHDCDQKGKRIHPGFVRWASRALSSEEV
Ga0163179_1028992123300012953SeawaterMNLRKTCLLCAGLVTTLGIIWMVGLPLQAGHAGSATGVGSVYAANVQQETVRHRRPLSLRMLAHVLNDCEQKGRPIHPGLVRWASRALSSEEGQNTFQTSGDQLFGRPSFQTMSSITN*
Ga0163111_1108097013300012954Surface SeawaterMNSRKMCLLCAGLVTTLGIFWMVGLPLQAGHAGSATGVGSVYATNVQQEPVRHRRPLSLRMLARVLNDCEQKCKPIHPGLVRWASRALSSEEGQNTFQKSGDQLFGHPSFQSISSIAN*
Ga0164313_1083324823300013101Marine SedimentMNLRKTCVLCVGGSTVLFIVWMSGLLLEAGHAGPATGVGSVYAANVQQEKELYRHPLSLRTLARVLHDCDKRGKPIHPGLVRWASRGLSSAEGQKVS
Ga0181552_1033250513300017824Salt MarshMNLRKTCLLCAGLVTTLGIIWMVGVPLQAGHVGSATGVGSVYAANVQQELVRHRRPVSLRMLARVLNDCEQKGKPIHPGLVRWASRALSSEEGQNTFQKSGDQLFGRPSFQSISSIAN
Ga0181607_1040999423300017950Salt MarshAGLVTTLGIIWMVGLPLQARHAGSAAGVGSVYAVNVQQELVRHRRPVSLRMLARVLNDCEQKGKPIHPGLVRWASRALSSEEGQNTSQKSGDQLFGRPSFQSISSIAN
Ga0181600_1039994413300018036Salt MarshMNLRKTCLLCAGLVTTLGIIWMVGVPLQAGHVGSATGVGSVYAANVQQELVRHRRPVSLRMLARVLNDCEQKGKPIHPGLVRWASRALSSEEGQNTSQKSGDQLFGRPSFQSISSIAN
Ga0181563_1069698713300018420Salt MarshHVGSATGVGSVYAANVQQELVRHRRPVSLRMLARVLNDCEQKGKPIHPGLVRWASRALSSEEGQNTSQKSGDQLFGRPSFQSISSIAN
Ga0181564_1002835723300018876Salt MarshMNLRKTCLLCAGLVTTLGIIWMVGLPLQARHAGSAAGVGSVYAANVQQELVRHRRPVSLRMLARVLNDCEQKGKPIHPGLVRWASRALSSEEGQNTSQKSGDQLFGHPSFQSISSIAN
Ga0206125_1002543623300020165SeawaterMNFRKTCLLCAGLVATLGIIWMVGVPLQAGHASSATGVGSVYAANVQQERVRHRRPLSLRMLARVLNDCEQKGKPIHPGLVRWASRSLSSEEGQNIFQKSGEQLFGHPSFQSISSITN
Ga0206128_129372813300020166SeawaterFFRRTCLLCAGLVATLGIIWMVGVPLQAGHAGSATGVGSVYAANVQQERVRHRRPLSLRMLARVLNDCEQKGKPIHPGLVRWASRSLSSEEGQNIFQKSGEQLFGHPSFQSISSITN
Ga0206127_120850113300020169SeawaterMNFRKTCLLCAGLVATLGIIWMVGVPLQAGHASSATGVGSVYAANVQQERVRHRRPLSLRMLARVLNDCEQKGKPIHPGLVRWASRSLSSEEGQNIFQKSGEQLFGRPSFQSISSITN
Ga0181602_1039813313300020173Salt MarshMNLRKTCLLCAGLVTTLGIIWMVGVPLQAGHVGSATGVGSVYAANVQQELVRHRRPVSLRMLARVLNDCEQKGKPIHPGLVRWASRALSSEEGQN
Ga0181596_1001863913300020177Salt MarshMNLRKTCLLCAGLVTTLGIIWMVGVPLQAGHVGSATGVGSVYAANVQQELVRHRRPVSLRMLARVLNDCEQKGKPIHPGLVRWASRALSSEEGQNTSQKSGDQLFGRP
Ga0206130_1019973713300020187SeawaterMNFRRTCLLCAGLVATLGIIWMVGVPLQAGHASSATGVGSVYAANVQQERVRHRRPLSLRMLARVLNDCEQKGKPIHPGLVRWASRSLSSEEGQNIFQKSGEQLFGRPSFQSISSITN
Ga0211509_105974623300020276MarineMNLRKTCLLCATLVTSLGVIWLVGLPLQAGHAVSATGVGSVYAANVQQELVRHRRPVSLRMLARVLNDCEQKGRPYHPGLVRWASRALSSEEGQNTFQKSGDHLFGRPSFQSMSSIAN
Ga0211508_107177313300020337MarineMNLRKTCLLCATLVTSLGVIWLVGLPLQAGHAVSATGVGSVYAANVQQELVRHRRPVSLRMLARVLNDCEQKGRPYHPGLVRWASRALSSEEGQNT
Ga0211504_101882023300020347MarineMNLRKRCLLCAALVTTLGMIWMVGLTLQAGHAVSATGVGSVYVANVQQETVRHRRPLSLRTLARVLHDCEEKGNPIHPGLVRWASRALSSEEGQNTFQKSGNQLFGRPSFQSMSSITN
Ga0211511_105568113300020349MarineMNLRKTCLLCATLVTSLGVIWLVGLPLQAGHAVSATGVGSVYAANVQQETVRHRRPVSLRMLARVLNDCEQKGRPYHPGLVRWASRALSSEEGQNTFQKSGDHLFGRPSFQSMSSIAN
Ga0211505_110168113300020352MarineTTFVVVCVSGFRLQAGHASAATGVGSVYAANVQQEPVTHRQPLSLRMLARVLHDCDQKGKPIHPGLVRWASRALSSEEGQNTFQKSGNQLFGRPSFQSMSSITN
Ga0211617_1023765523300020401MarineMLFIVWVSGLLLQTGHAGSASGVGSVYATNIQQDMLTRRQPLSLRTLARVLHDCDQKGKRIHPGFVRWASRALSSEEVQKVSDSQLFGLASFQS
Ga0211532_1034316413300020403MarineQTGHAGPAAGVGSVYATNVQQETGRHRRPVSLRMLAHVLHDCDQKSKPIHPGIVRWASRALPTEEVQKMSDHQLFGLASFQSVSRTSY
Ga0211576_1016655623300020438MarineMNLRKRCLLCATLVTTLGMIWIVGLTLQAGHAVSATGVGSVYVANVQQETVRHRRPLSLRTLAHVLHDCEQKGNPIHPGLVRWASRALSSEEGQNTFQKSGDQLFGRPSFQSISSRTN
Ga0211558_1029621913300020439MarineMNMRKTCLLCVGGFTTLVVVWLSGLLLQTGHAGPAAGVGSVYATNMQQETGRHRRPVSLRMLAHVLHDCEQKSKPIHPGVVRWASRALPTEEVQKVSDHQLFGLASFQSLPHTSY
Ga0211558_1032331813300020439MarineMNLRKTCLLCAGLVTTLGIIWMVGVPLQAGHAGSATGVGSVYAANVQQELVRHRRPVSLRMLARVLNDCEQKSKPIHPGLVRWASRALSLEEGQNTFQK
Ga0211559_1052216413300020442MarineVVVWLSGLLLQTGHAGPAAGVGSVYATNVQQETGRHRRPVSLRMLARVLHDCDQKSKPIHPGFVRWASRALPSEEVQKVSDHQLFGLASFQSVSRTSY
Ga0211473_1068995213300020451MarineMNLRKTCLLCAGLVTTLGIIWMVGLPLQAGHAGSATGVGSVYAANVQQETVRHRRPLSLRMLAHVLNDCEQKGRPIHPGLVRWASRALSSEEGQNTFQKSGDQL
Ga0211550_1058970413300020453MarineMNLCKTCLLCAGLVTTLGIIWMVGVPLQAGHAGSATGVGSVYAANVQQELVRHRRPVSLRMLARVLNDCEQKGKPIHPGLVRWASRALSSEEGQNTFQKSGDQLFGRPSFQSISSIAN
Ga0211548_1011283413300020454MarineMNLRKTCLLCAGLVTTLGIIWMVGLPLQAGHAGSATGVGSVYAANVQQETVRHRRPLSLRMLAHVLNDCEQKGRPIHPGLVRWASRALSSEEGQNTFQTSGDQLFGRPSFQTMSSITN
Ga0211546_1049519523300020462MarineMNLRKTCLLCAGLVTTLGIIWMVGLPLQAGHAGSATGVGSVYTANVQQETVRHRRPLSLRMLARVLNDCEQKGRPYHPGLVRWASRALSSEEGQNTFQKSGDHLFGRPSFQSMSSIAN
Ga0211577_1015186323300020469MarineIQRPNLFSVFLFRGLPMNLRKRCLLCATLVTTLGMIWIVGLTLQAGHAVSATGVGSVYVANVQQETVRHRRPLSLRTLAHVLHDCEQKGNPIHPGLVRWASRALSSEEGQNTFQKSGDQLFGRPSFQSMSSITN
Ga0211577_1035918823300020469MarineMNLRKTCLLCAGLVTTLGIIWMVVLPLQAGHAGSATGVGSVYAANVQQETVRHRRPLSLRSLAHVLNDCEQKGRPIHPGLVRWASRALSSEEGQNTFQTSGDQLFGRPSFQSMSSITN
Ga0206126_1006123133300020595SeawaterMNFRKTCLLCAGLVATLGIIWMVGVPLQAGHASSAAGVGSVYAANVQQERVRHRRPLSLRMLARVLNDCEQKGKPIHPGLVRWASRSLSSEEGQNIFQKSGEQLFGHPSFQSISSITN
Ga0181598_122405513300020810Salt MarshPFRGIPMNLRKTCLLCAGLVTTLGIIWMVGVPLQAGHVGSATGVGSVYAANVQQELVRHRRPVSLRMLARVLNDCEQKGKPIHPGLVRWASRALSSEEGQNTSQKSGDQLFGRPSFQSISSIAN
Ga0206683_1020700413300021087SeawaterMNLRKTCLLCAGLVTTLGIIWMVGLPLQAGHAGSATGVGSVYAANVQQETVRHRRPLSLRMLAHVLNDCEQKGRPIHPGLVRWASRALSSEEGQNTFQKSGDQLFGRPSFQSMSSTTN
Ga0206683_1025275813300021087SeawaterMNFRKTYLLCAGLFTTFVVVCVSGFRLQAGHASAATGVGSVYAANVQQEPVTHRQPLSLRMLARVLHDCDQKGKPIHPGLVRWASRALSSEEGQNTFQKSGDQLFGRPSFQSMSSITN
Ga0206682_1017746313300021185SeawaterMNFRKTYLLCAGLFTTFVVVCVSGFRLQAGHASAATGVGSVYAANVQQEPVTHRQPLSLRMLARVLHDCDQKGKPIHPGLVRWASRALSSEEGQNTFQKSGDQLFGRPSFQSISSRTN
Ga0206123_1017125013300021365SeawaterMNFRKTCLLCAGLVTTLGIIWMVGVPLQAGHASSATGVGSVYAGNVQQERVRHRRPLSLRMLVRVLNDCEKNGKPIHPGLVRWASRALSSEDGQNTLQKSGDQLFGRPSFQSISSITN
Ga0213869_1018127113300021375SeawaterMNFRKTCLLCAGLVTTLGIIWMVGVPLQAGHASSATGVGSVYAGNVQQERVRHRRPLSLRMLARVLNDCEQKGKPIHPGLVRWASRSLSSEEGQNIFQKSGEQLFGRPSFQSISSITN
Ga0213861_1024764923300021378SeawaterMNFRKTCLLCAGLVATLGIIWMVGVPLQAGHASSAAGVGSVYAANVQQERVRHRRPLSLRMLARVLNDCEQKGKPIHPGLVRWASRSLSSEEGQNIFQKSGEQLFGRPSFQSISSITN
Ga0213868_1021931313300021389SeawaterSVFLFRGLPMNFRKTCLLCAGLVTTLGIIWMVGVPLQAGHASSATGVGSVYAGNVQQERVRHRRPLSLRMLARVLNDCEQKGKPIHSGLVRWASRALSSEEGQNTFQKSGDQLFGRPSFQSISSITN
(restricted) Ga0233431_108291823300022916SeawaterMNLRKRCLLCATLVTTLGMIWIVGLTLQAGHAVSATGVGSVYVANVQQETVRHRRPLSLRTLAHVLHDCEQKGNPIHPGLVRWASRALSSEEGQNTFQKSGDQLFGRSSFQSMSSITN
Ga0255783_1011745113300022923Salt MarshMNLRKTCLLCAGLVTTLGIIWMVGVPLQAGHVGSATGVGSVYAANVQQELVRHRRPVSLRMLARVLNDCEQKGKPIHPGLVRWASRALSSEE
(restricted) Ga0233436_110113313300024243SeawaterMNFRKTYLLCAGLFTTFVVVCVSGFRLQAGHASAATGVGSVYAANVQQEPVTHRQPLSLRMLARVLHDCDQKGKPIHPGLVRWASRALSSEEGQNTFQKSGDQLFGRPSFQSISSITN
(restricted) Ga0233442_107561113300024257SeawaterMNFRKTYLLCAGLFTTFVVVCVSGFRLQAGHASAATGVGSVYAANVQQEPVTHRQPLSLRMLARVLHDCDQKGKPIHPGLVRWASRALSSEEGQNTFQKSGDQLFGRPS
Ga0228658_107256023300024297SeawaterMNLRKRCLLCATLVTTLGMIWIVGLTLQAGHAVSATGVGSVYVANVQQETVRHRRPLSLRTLAHVLHDCEQKGNPIHPGLVRWASRALSSEEGQNTFQKSGDQLFGRPSFQSMSSITN
Ga0228626_106954613300024321SeawaterMNLRKTCLLCAGLVTTLGIIWMVGLPLQAGHAGSATGVGSVYAANVQQETVRHRRPLSLRMLAHVLNDCEQKGRPIHPGLVRWASRALSSEEGQNTFQKSGDQLFGRPSFQSISSRTN
(restricted) Ga0233447_102024823300024336SeawaterMNFRKTYLLCAGLFTTFVVVCVSGFRLQAGHASAATGVGSVYAANVQQEPVTHRQPLSLRMLARVLHDCDQKGKPIHPGLVRWASRALSSEERQNTFQKSGDQLFGRPSFQSMSSITN
Ga0209991_1027660013300024429Deep SubsurfaceMNFRKTCLLCAGLVTSLGVILMVGVPLQAGHAGSATGVGSVFAAKAEQEPVTHRQPVSLRMLARVLHHCDENGKPIHAGFVRWASRAIPSGEGVDAFPHVSGDQLFGRDSFQSVSNKTR
Ga0209991_1037073123300024429Deep SubsurfaceLFRGLPMNLRKKCLLCATLVTTLGMIWMVGLTLQAGHAVSATGVGSVYAANVQQETVRHRRPLSLRTLAHVLHDCEQKGNPIHPGLVRWASRALSSEEGQNTFQKSGDQLFGRPSFQSMSSITN
Ga0209977_1001795823300024432Deep SubsurfaceMNMRKTCLLCVGGFTTLVVVWLSGLLLQTGHAGPAAGVGSVYATNVQQETGRHRRPVSLRMLAHVLHDCDQKSKPIHPGIVRWASRALPSEEVQKMSDHQLFGLASFQSVSRTSY
Ga0209986_1013034323300024433Deep SubsurfaceMNLRKTCLLCATLVTSFGVIWLVGLPLQAGHAVSAAGVGSVYAANVQQELVRHRRPVSLRMLARVLNDCEQKGRPYHPGLVRWASRALSSEEGQNTFQKSGDHLFGRPSFQSMSSIAN
Ga0209532_121257313300025696Pelagic MarineCLLCAGLVTTLGIIWMVGVPLQAGHASSATGVGSVYAGNVQQERVRHRRPLSLRMLARVLNDCEQKGKPIHPGLVRWASRSLSSEEGQNIFQKSGEQLFGRPSFQSISSITN
Ga0208543_112673213300025810AqueousMNFRKTCLLCAGLVTTLGIIWMVGVPLQAGHASSAAGVGSVYAANVQQERVRHRRPLSLRMLARVLNDCEQKGKPIHPGLVRWASRSLSSEEGQNIFQKSGEQLFGRPSFQSISSITN
Ga0209666_128192013300025870MarineKTYLLCAGLFTTFVVVCVSGFRLQAGHASAATGVGSVYAANVQQEPVTHRQPLSLRMLARVLHDCDQKGKPIHPGLVRWASRALSSEEGQNTFQKSGDQLFGRPSFQSMSSITN
Ga0209631_1001569553300025890Pelagic MarineMNFRKTCLLCAGLVTTLGIIWMVGVPLQAGHASSATGVGSVYAGNVQQERVRHRRPLSLRMLARVLNDCEQKGKPIHPGLVRWASRSLSSEEGQNIFQKSGEQLFGHPSFQSISSITN
Ga0228641_101774313300026491SeawaterMVGLPLQAGHAGSATGVGSVYAANVQQETVRHRRPLSLRMLAHVLNDCEQKGRPIHPGLVRWASRALSSEEGQNTFQKSGDQLFGRPSFQSMSSITN
Ga0208947_101364323300027553MarineMVGLPLQAGHAGSATGVGSVYAANVQQETVRHRRPLSLRMLAHVLNDCEQKGRPIHPGLVRWASRALSSEEGQNTFQKSGDQLFGRPSFQSMSSTTN
Ga0209013_1018913123300027858MarineMNLRKTCLLCAGLVTTLGIIWMVGLPLQAGHAGSATGVGSVYAANVQQETVRHRRPLSLRMLAHVLNDCEQKGRPIHPGLVRWASRALSSEEGQNTFQKSGDQLFGRPSFQSMSSITN
Ga0209404_1051769723300027906MarineMSLRKTCLLCAGLVTTLGISWMVRLPLQAGHAGSAAGVGSVYAANVQQELVRHRRPVSLRMLARVLNDCEQKGKPIHPGLVRWASRALSSEEGQNTFQKSGDQLFGRPSFQSISSIAN
Ga0228606_103061413300028135SeawaterMNLRKTCLLCAGLVTTLGIIWMVGLPLQAGHAGSATGVGSVYAANVQQETVRHRRPLSLRMLAHVLNDCEQKGRPIHPGLVRWASRALSSEEGQNTFQKSGDKLFGSPSFQSMSSITN
Ga0228608_116673723300028136SeawaterNLRKTCLLCAGLVTTLGIIWMVGLPLQAGHAGSATGVGSVYAANVQQETVRHRRPLSLRMLAHVLNDCEQKGRPIHPGLVRWASRALSSEEGQNTFQKSGDKLFGRPSFQSISSRTN
Ga0257110_104616923300028197MarineMNLRKRCLLCATLVTTLGMIWIVGLTLQAGHAVSATGVGSVYVANVQQETVRHRRPLSLRTLAHVLHDCEQKGNPIHPGLVRWASRALSSEEGQNTFQKSGDQLFGRPSFQSMSSIIN
Ga0228617_112063813300028297SeawaterMNFRKTYLLCAGLFTTFVVVCVSGFRLQAGHASAATGVGSVYAANVQQEPVTHRQPLSLRMLARVLHDCDQKGKPIHPGLVRWASRALSSEEGQNTFQKSGDQLFGRPSFQSMSSIT
Ga0228639_103754623300028397SeawaterMNLRKTCLLCAGLVTTLGIIWMVGLPLQAGHAGSATGVGSVYAANVQQETVRHRRPLSLRMLAHVLNDCEQKGRPIHPGLVRWASRALSSEEGQNTFQKSGDQLFGRPSFQSMSST
Ga0228615_105381723300028418SeawaterMNLRKRCLLCATLVTTLGMIWIVGLTLQAGHAVSATGVGSVYVANVQQETVRHRRPLSLRTLAHVLHDCEQKGNPIHPGLVRWASRALSSEEGQNT
Ga0315332_1035238013300031773SeawaterMNLRKTCLLCAGLVTTLGIIWMVGLPLQAGHAGSATGVGSVYAANVQQETVRHRRPLSLRMLAHVLNDCEQKGRPIHPGLVRWASRALSSEEGQNTFQKSGDQLFGRPS
Ga0315316_1124989813300032011SeawaterMNLRKTCVLCVGGSTVLFIVWMSGLLLEAGHAGPATGVGSVYAANVQQEKEQYRHPLSLRTLARVLHDCDKRGKPIHPGLVRWASRGLSSAEGQKVSEDQLFGLVSFQSVSNISH
Ga0315316_1153603313300032011SeawaterSLKPALFSVYLLRGLPMNLRKTCLLCAGLVTTLGIIWMVGLPLQAGHAGSATGVGSVYAANVQQETVRHRRPLSLRMLAHVLNDCEQKGRPIHPGLVRWASRALSSEEGQNTFQKSGDQLFGRPSFQSMSSTTN
Ga0315327_1053853123300032032SeawaterRVSLKHALFSVYLLRGLPMNLRKTCLLCAGLVTTLGIIWMVGLPLQAGHAGSATGVGSVYAANVQQETVRHRRPLSLRMLAHVLNDCEQKGRPIHPGLVRWASRALSSEEGQNTFQTSGDQLFGRPSFQSMSSITN
Ga0315321_1015197323300032088SeawaterMNLRKTCLLCAGLVTTLGIIWMVGLPLQAGHAGSATGVGSVYAANVQQETVRHRRPLSLRMLAHVLNDCEQKGRPIHPGLVRWASRALSSEEGQNTFQKSGDQLFGRPSFQ
Ga0315321_1044473123300032088SeawaterMNFRKTYLLCAGLFTTFVVVCVSGFRLQAGHASAATGVGSVYAANVQQEPVTHRQPLSLRMLARVLHDCDQKGKPIHPGLVRWASRALSSEEGQ

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.