


| Basic Information | |
|---|---|
| Family ID | F098734 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 103 |
| Average Sequence Length | 46 residues |
| Representative Sequence | MKKKPPGVFSLIATAFTGFGAHLVALCATGRDRLLALQGRKARPGKR |
| Number of Associated Samples | 90 |
| Number of Associated Scaffolds | 103 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 78.64 % |
| % of genes near scaffold ends (potentially truncated) | 30.10 % |
| % of genes from short scaffolds (< 2000 bps) | 83.50 % |
| Associated GOLD sequencing projects | 88 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.40 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (96.117 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (18.447 % of family members) |
| Environment Ontology (ENVO) | Unclassified (40.777 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Subsurface (non-saline) (34.951 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 46.67% β-sheet: 0.00% Coil/Unstructured: 53.33% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.40 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 103 Family Scaffolds |
|---|---|---|
| PF07883 | Cupin_2 | 24.27 |
| PF16326 | ABC_tran_CTD | 23.30 |
| PF14833 | NAD_binding_11 | 6.80 |
| PF08240 | ADH_N | 1.94 |
| PF01177 | Asp_Glu_race | 0.97 |
| PF04909 | Amidohydro_2 | 0.97 |
| PF04185 | Phosphoesterase | 0.97 |
| PF07676 | PD40 | 0.97 |
| COG ID | Name | Functional Category | % Frequency in 103 Family Scaffolds |
|---|---|---|---|
| COG3511 | Phospholipase C | Cell wall/membrane/envelope biogenesis [M] | 0.97 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 96.12 % |
| Unclassified | root | N/A | 3.88 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000574|JGI1357J11328_10195327 | All Organisms → cellular organisms → Bacteria | 548 | Open in IMG/M |
| 3300003994|Ga0055435_10070800 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 878 | Open in IMG/M |
| 3300004156|Ga0062589_100103058 | All Organisms → cellular organisms → Bacteria | 1823 | Open in IMG/M |
| 3300004156|Ga0062589_102323458 | Not Available | 551 | Open in IMG/M |
| 3300004463|Ga0063356_101298590 | All Organisms → cellular organisms → Bacteria | 1064 | Open in IMG/M |
| 3300005218|Ga0068996_10065566 | All Organisms → cellular organisms → Bacteria | 748 | Open in IMG/M |
| 3300005295|Ga0065707_10874519 | All Organisms → cellular organisms → Bacteria | 574 | Open in IMG/M |
| 3300005345|Ga0070692_10562149 | All Organisms → cellular organisms → Bacteria | 749 | Open in IMG/M |
| 3300005440|Ga0070705_100374642 | All Organisms → cellular organisms → Bacteria | 1046 | Open in IMG/M |
| 3300005468|Ga0070707_101173083 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 734 | Open in IMG/M |
| 3300005468|Ga0070707_101184673 | All Organisms → cellular organisms → Bacteria | 730 | Open in IMG/M |
| 3300005530|Ga0070679_101779575 | All Organisms → cellular organisms → Bacteria | 564 | Open in IMG/M |
| 3300005546|Ga0070696_100404975 | All Organisms → cellular organisms → Bacteria | 1068 | Open in IMG/M |
| 3300005617|Ga0068859_102667580 | All Organisms → cellular organisms → Bacteria | 549 | Open in IMG/M |
| 3300005833|Ga0074472_10620843 | All Organisms → cellular organisms → Bacteria | 519 | Open in IMG/M |
| 3300007255|Ga0099791_10260695 | All Organisms → cellular organisms → Bacteria | 823 | Open in IMG/M |
| 3300007255|Ga0099791_10656019 | All Organisms → cellular organisms → Bacteria | 515 | Open in IMG/M |
| 3300007265|Ga0099794_10283140 | All Organisms → cellular organisms → Bacteria | 857 | Open in IMG/M |
| 3300009823|Ga0105078_1054150 | All Organisms → cellular organisms → Bacteria | 539 | Open in IMG/M |
| 3300010391|Ga0136847_11814901 | All Organisms → cellular organisms → Bacteria | 684 | Open in IMG/M |
| 3300011410|Ga0137440_1032242 | All Organisms → cellular organisms → Bacteria | 954 | Open in IMG/M |
| 3300011423|Ga0137436_1123393 | All Organisms → cellular organisms → Bacteria | 689 | Open in IMG/M |
| 3300011424|Ga0137439_1039713 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 870 | Open in IMG/M |
| 3300011429|Ga0137455_1038925 | All Organisms → cellular organisms → Bacteria | 1327 | Open in IMG/M |
| 3300011429|Ga0137455_1191794 | All Organisms → cellular organisms → Bacteria | 610 | Open in IMG/M |
| 3300011436|Ga0137458_1070054 | All Organisms → cellular organisms → Bacteria | 970 | Open in IMG/M |
| 3300012096|Ga0137389_11135801 | All Organisms → cellular organisms → Bacteria | 669 | Open in IMG/M |
| 3300012203|Ga0137399_10486182 | All Organisms → cellular organisms → Bacteria | 1035 | Open in IMG/M |
| 3300012355|Ga0137369_10765296 | All Organisms → cellular organisms → Bacteria | 661 | Open in IMG/M |
| 3300012358|Ga0137368_10964811 | All Organisms → cellular organisms → Bacteria | 514 | Open in IMG/M |
| 3300012925|Ga0137419_10073172 | All Organisms → cellular organisms → Bacteria | 2291 | Open in IMG/M |
| 3300012925|Ga0137419_11114544 | All Organisms → cellular organisms → Bacteria | 658 | Open in IMG/M |
| 3300012929|Ga0137404_10078980 | All Organisms → cellular organisms → Bacteria | 2604 | Open in IMG/M |
| 3300012930|Ga0137407_10199393 | All Organisms → cellular organisms → Bacteria | 1794 | Open in IMG/M |
| 3300014326|Ga0157380_11071358 | All Organisms → cellular organisms → Bacteria | 843 | Open in IMG/M |
| 3300014873|Ga0180066_1001335 | All Organisms → cellular organisms → Bacteria | 3137 | Open in IMG/M |
| 3300014877|Ga0180074_1030442 | All Organisms → cellular organisms → Bacteria | 1091 | Open in IMG/M |
| 3300014885|Ga0180063_1009657 | All Organisms → cellular organisms → Bacteria | 2578 | Open in IMG/M |
| 3300015259|Ga0180085_1261130 | All Organisms → cellular organisms → Bacteria | 506 | Open in IMG/M |
| 3300018000|Ga0184604_10004350 | All Organisms → cellular organisms → Bacteria | 2517 | Open in IMG/M |
| 3300018052|Ga0184638_1169671 | All Organisms → cellular organisms → Bacteria | 780 | Open in IMG/M |
| 3300018053|Ga0184626_10005467 | All Organisms → cellular organisms → Bacteria | 4816 | Open in IMG/M |
| 3300018054|Ga0184621_10037792 | All Organisms → cellular organisms → Bacteria | 1571 | Open in IMG/M |
| 3300018059|Ga0184615_10131389 | All Organisms → cellular organisms → Bacteria | 1413 | Open in IMG/M |
| 3300018074|Ga0184640_10051318 | All Organisms → cellular organisms → Bacteria | 1706 | Open in IMG/M |
| 3300018077|Ga0184633_10570966 | All Organisms → cellular organisms → Bacteria | 538 | Open in IMG/M |
| 3300018422|Ga0190265_10022079 | All Organisms → cellular organisms → Bacteria | 5104 | Open in IMG/M |
| 3300018422|Ga0190265_10027482 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4664 | Open in IMG/M |
| 3300018429|Ga0190272_10150134 | All Organisms → cellular organisms → Bacteria | 1603 | Open in IMG/M |
| 3300018465|Ga0190269_11700051 | All Organisms → cellular organisms → Bacteria | 532 | Open in IMG/M |
| 3300019360|Ga0187894_10021295 | All Organisms → cellular organisms → Bacteria | 4559 | Open in IMG/M |
| 3300019377|Ga0190264_11556848 | All Organisms → cellular organisms → Bacteria | 578 | Open in IMG/M |
| 3300019458|Ga0187892_10062131 | All Organisms → cellular organisms → Bacteria | 2456 | Open in IMG/M |
| 3300019458|Ga0187892_10173395 | All Organisms → cellular organisms → Bacteria | 1181 | Open in IMG/M |
| 3300019872|Ga0193754_1004571 | All Organisms → cellular organisms → Bacteria | 1345 | Open in IMG/M |
| 3300019881|Ga0193707_1067897 | All Organisms → cellular organisms → Bacteria | 1111 | Open in IMG/M |
| 3300019882|Ga0193713_1002497 | All Organisms → cellular organisms → Bacteria | 6013 | Open in IMG/M |
| 3300019883|Ga0193725_1077402 | All Organisms → cellular organisms → Bacteria | 813 | Open in IMG/M |
| 3300019883|Ga0193725_1086010 | All Organisms → cellular organisms → Bacteria | 759 | Open in IMG/M |
| 3300019886|Ga0193727_1048016 | All Organisms → cellular organisms → Bacteria | 1388 | Open in IMG/M |
| 3300019886|Ga0193727_1078625 | All Organisms → cellular organisms → Bacteria | 1004 | Open in IMG/M |
| 3300020002|Ga0193730_1151194 | All Organisms → cellular organisms → Bacteria | 613 | Open in IMG/M |
| 3300020060|Ga0193717_1117426 | All Organisms → cellular organisms → Bacteria | 821 | Open in IMG/M |
| 3300020063|Ga0180118_1233975 | All Organisms → cellular organisms → Bacteria | 653 | Open in IMG/M |
| 3300022756|Ga0222622_10533275 | All Organisms → cellular organisms → Bacteria | 842 | Open in IMG/M |
| 3300024330|Ga0137417_1093520 | All Organisms → cellular organisms → Bacteria | 1029 | Open in IMG/M |
| 3300025324|Ga0209640_10006390 | All Organisms → cellular organisms → Bacteria | 10321 | Open in IMG/M |
| 3300025324|Ga0209640_10084073 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2749 | Open in IMG/M |
| 3300025521|Ga0210083_1056505 | All Organisms → cellular organisms → Bacteria | 600 | Open in IMG/M |
| 3300025885|Ga0207653_10075822 | Not Available | 1156 | Open in IMG/M |
| 3300025912|Ga0207707_10728585 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae | 831 | Open in IMG/M |
| 3300025922|Ga0207646_10893084 | All Organisms → cellular organisms → Bacteria | 789 | Open in IMG/M |
| 3300025922|Ga0207646_11485158 | All Organisms → cellular organisms → Bacteria | 587 | Open in IMG/M |
| 3300025934|Ga0207686_10356190 | All Organisms → cellular organisms → Bacteria | 1103 | Open in IMG/M |
| 3300025955|Ga0210071_1005596 | All Organisms → cellular organisms → Bacteria | 1431 | Open in IMG/M |
| 3300026047|Ga0208658_1021635 | Not Available | 534 | Open in IMG/M |
| 3300026054|Ga0208659_1009130 | All Organisms → cellular organisms → Bacteria | 708 | Open in IMG/M |
| 3300026320|Ga0209131_1003264 | All Organisms → cellular organisms → Bacteria | 10803 | Open in IMG/M |
| 3300026360|Ga0257173_1003004 | All Organisms → cellular organisms → Bacteria | 1573 | Open in IMG/M |
| 3300026499|Ga0257181_1002198 | All Organisms → cellular organisms → Bacteria | 1946 | Open in IMG/M |
| 3300026507|Ga0257165_1049360 | All Organisms → cellular organisms → Bacteria | 755 | Open in IMG/M |
| 3300026535|Ga0256867_10033738 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2133 | Open in IMG/M |
| 3300027395|Ga0209996_1009271 | All Organisms → cellular organisms → Bacteria | 1296 | Open in IMG/M |
| 3300027815|Ga0209726_10184164 | All Organisms → cellular organisms → Bacteria | 1119 | Open in IMG/M |
| 3300027979|Ga0209705_10542446 | All Organisms → cellular organisms → Bacteria | 562 | Open in IMG/M |
| 3300028380|Ga0268265_10112435 | All Organisms → cellular organisms → Bacteria | 2226 | Open in IMG/M |
| 3300028673|Ga0257175_1018085 | All Organisms → cellular organisms → Bacteria | 1145 | Open in IMG/M |
| 3300028803|Ga0307281_10069236 | All Organisms → cellular organisms → Bacteria | 1142 | Open in IMG/M |
| 3300030006|Ga0299907_10272675 | All Organisms → cellular organisms → Bacteria | 1385 | Open in IMG/M |
| 3300030620|Ga0302046_10299700 | All Organisms → cellular organisms → Bacteria | 1322 | Open in IMG/M |
| 3300030990|Ga0308178_1105760 | All Organisms → cellular organisms → Bacteria | 603 | Open in IMG/M |
| (restricted) 3300031150|Ga0255311_1035527 | All Organisms → cellular organisms → Bacteria | 1041 | Open in IMG/M |
| (restricted) 3300031150|Ga0255311_1038037 | All Organisms → cellular organisms → Bacteria | 1008 | Open in IMG/M |
| (restricted) 3300031150|Ga0255311_1040708 | All Organisms → cellular organisms → Bacteria | 975 | Open in IMG/M |
| 3300031229|Ga0299913_10249238 | All Organisms → cellular organisms → Bacteria | 1759 | Open in IMG/M |
| (restricted) 3300031248|Ga0255312_1028415 | All Organisms → cellular organisms → Bacteria | 1336 | Open in IMG/M |
| 3300031720|Ga0307469_10028387 | All Organisms → cellular organisms → Bacteria | 3201 | Open in IMG/M |
| 3300031740|Ga0307468_101367807 | Not Available | 649 | Open in IMG/M |
| 3300031949|Ga0214473_10343285 | All Organisms → cellular organisms → Bacteria | 1696 | Open in IMG/M |
| 3300032174|Ga0307470_10096915 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla | 1677 | Open in IMG/M |
| 3300032180|Ga0307471_100714400 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla | 1167 | Open in IMG/M |
| 3300033233|Ga0334722_10483301 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 890 | Open in IMG/M |
| 3300034165|Ga0364942_0303907 | All Organisms → cellular organisms → Bacteria | 522 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 18.45% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 11.65% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 9.71% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 7.77% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 6.80% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 3.88% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 3.88% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 3.88% |
| Sandy Soil | Environmental → Terrestrial → Soil → Sand → Unclassified → Sandy Soil | 3.88% |
| Groundwater | Environmental → Aquatic → Freshwater → Groundwater → Contaminated → Groundwater | 1.94% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.94% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil | 1.94% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 1.94% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.94% |
| Soil | Environmental → Terrestrial → Soil → Loam → Unclassified → Soil | 1.94% |
| Bio-Ooze | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Bio-Ooze | 1.94% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.94% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 1.94% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 0.97% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.97% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 0.97% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Sediment | 0.97% |
| Sediment (Intertidal) | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal) | 0.97% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.97% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.97% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.97% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 0.97% |
| Microbial Mat On Rocks | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Microbial Mat On Rocks | 0.97% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 0.97% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.97% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.97% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000574 | Subsurface groundwater microbial communities from S. Glens Falls, New York, USA - GMW46 contaminated, 5.4 m | Environmental | Open in IMG/M |
| 3300003994 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqA_D2 | Environmental | Open in IMG/M |
| 3300004156 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1 | Environmental | Open in IMG/M |
| 3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
| 3300005218 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_ThreeSqC_D2 | Environmental | Open in IMG/M |
| 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 | Environmental | Open in IMG/M |
| 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Environmental | Open in IMG/M |
| 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Environmental | Open in IMG/M |
| 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
| 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
| 3300005833 | Microbial communities from Cathlamet Bay sediment, Columbia River estuary, Oregon - S.174_CBK | Environmental | Open in IMG/M |
| 3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
| 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
| 3300009823 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_40_50 | Environmental | Open in IMG/M |
| 3300010391 | Freshwater sediment microbial communities from Lake Superior, USA - Station SU-17. Combined Assembly of Gp0155404, Gp0155335, Gp0155336, Gp0155336, Gp0155403, Gp0155406 | Environmental | Open in IMG/M |
| 3300011410 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT222_2 | Environmental | Open in IMG/M |
| 3300011423 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT119_2 | Environmental | Open in IMG/M |
| 3300011424 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT200_2 | Environmental | Open in IMG/M |
| 3300011429 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT600_2 | Environmental | Open in IMG/M |
| 3300011436 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT642_2 | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012355 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaG | Environmental | Open in IMG/M |
| 3300012358 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014873 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT200B_16_10D | Environmental | Open in IMG/M |
| 3300014877 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT366_16_10D | Environmental | Open in IMG/M |
| 3300014885 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLIBT47_16_10D | Environmental | Open in IMG/M |
| 3300015259 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT730_16_10D | Environmental | Open in IMG/M |
| 3300018000 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5_coex | Environmental | Open in IMG/M |
| 3300018052 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b2 | Environmental | Open in IMG/M |
| 3300018053 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_b1 | Environmental | Open in IMG/M |
| 3300018054 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_b1 | Environmental | Open in IMG/M |
| 3300018059 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_65_coex | Environmental | Open in IMG/M |
| 3300018074 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b2 | Environmental | Open in IMG/M |
| 3300018077 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b1 | Environmental | Open in IMG/M |
| 3300018422 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 T | Environmental | Open in IMG/M |
| 3300018429 | Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 T | Environmental | Open in IMG/M |
| 3300018465 | Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 IS | Environmental | Open in IMG/M |
| 3300019360 | White microbial mat communities from a lava cave in the Kipuka Kanohina Cave System on the Island of Hawaii, USA - GBC170108-1 metaG | Environmental | Open in IMG/M |
| 3300019377 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 112 T | Environmental | Open in IMG/M |
| 3300019458 | Bio-ooze microbial communities from a basaltic lava cave in the Kipuka Kanohina Cave System on the Island of Hawaii, USA - MA170107-3 metaG | Environmental | Open in IMG/M |
| 3300019872 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1a1 | Environmental | Open in IMG/M |
| 3300019881 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3c2 | Environmental | Open in IMG/M |
| 3300019882 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H3a2 | Environmental | Open in IMG/M |
| 3300019883 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2a2 | Environmental | Open in IMG/M |
| 3300019886 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2c2 | Environmental | Open in IMG/M |
| 3300020002 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1a1 | Environmental | Open in IMG/M |
| 3300020060 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2c2 | Environmental | Open in IMG/M |
| 3300020063 | Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLT730_16_1Ra (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300022756 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1 | Environmental | Open in IMG/M |
| 3300024330 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300025324 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 10_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300025521 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqB_D1 (SPAdes) | Environmental | Open in IMG/M |
| 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025955 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_TuleA_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300026047 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_ThreeSqA_D1_rd (SPAdes) | Environmental | Open in IMG/M |
| 3300026054 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_TuleC_D1 (SPAdes) | Environmental | Open in IMG/M |
| 3300026320 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026360 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-19-B | Environmental | Open in IMG/M |
| 3300026499 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-06-B | Environmental | Open in IMG/M |
| 3300026507 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - CO-12-B | Environmental | Open in IMG/M |
| 3300026535 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT150D86 (HiSeq) | Environmental | Open in IMG/M |
| 3300027395 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027815 | Subsurface groundwater microbial communities from S. Glens Falls, New York, USA - GMW46 contaminated, 5.4 m (SPAdes) | Environmental | Open in IMG/M |
| 3300027979 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 10-12cm September2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028673 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-69-B | Environmental | Open in IMG/M |
| 3300028803 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_120 | Environmental | Open in IMG/M |
| 3300030006 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT152D67 | Environmental | Open in IMG/M |
| 3300030620 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT147D111 | Environmental | Open in IMG/M |
| 3300030990 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_149 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031150 (restricted) | Sandy soil microbial communities from University of British Columbia, Vancouver, Canada - EtOH4_T0_E4 | Environmental | Open in IMG/M |
| 3300031229 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT155D38 | Environmental | Open in IMG/M |
| 3300031248 (restricted) | Sandy soil microbial communities from University of British Columbia, Vancouver, Canada - EtOH5_T0_E5 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031949 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT98D197 | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300033233 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_bottom | Environmental | Open in IMG/M |
| 3300034165 | Sediment microbial communities from East River floodplain, Colorado, United States - 19_s17 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI1357J11328_101953272 | 3300000574 | Groundwater | MKKKPAGVFSLIASGLTGFGAHLVTLCATARDRLLALQSGKARSGKR* |
| Ga0055435_100708003 | 3300003994 | Natural And Restored Wetlands | MKKKPPGVFSLLATGVTGFGAHLVHLCATARDRLLALQSRKARPGKR* |
| Ga0062589_1001030585 | 3300004156 | Soil | MKKKPPGVFSLIVTAFTGFGAHLVALCATGRDRLLAFQGRKTRPGKR* |
| Ga0062589_1023234582 | 3300004156 | Soil | MVKKQPGVLSLIVTAFTGFGTHLVALCVTGRDRLLALPGRKGRSGKR* |
| Ga0063356_1012985902 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MKKKSPGVLSLIVTAFTGFGAHIVALCVTGRDRLLALQGRKVRHGKR* |
| Ga0068996_100655662 | 3300005218 | Natural And Restored Wetlands | MKKKPPGVFSLIVTAFTGFGSHIMTLCVTGRDRLLALQGRKARNGKR* |
| Ga0065707_108745192 | 3300005295 | Switchgrass Rhizosphere | MKKKPPGVFSLIVTAFTGFGVHLVALCATGRDRLLALQGRKARPGKR* |
| Ga0070692_105621493 | 3300005345 | Corn, Switchgrass And Miscanthus Rhizosphere | VSRPVSKGAPMKKKPPGVFSLIVTAFTGFGAHLVALCATGRDRLLAFQGRKTRPGKR* |
| Ga0070705_1003746424 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | MKKQPGVFSLIVTAFTGFGAHIVSLCVTGRDRLLALPGRKKQTGKR* |
| Ga0070707_1011730833 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | MKKPPGVLSLIVTAFTGFGAHIVALCVSGRDRLLAHPGRKARNGKR* |
| Ga0070707_1011846731 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | MKKQPGVFSLIATAFTGFGAHIVTLCGTARDRLLALQGRKARPGKR* |
| Ga0070679_1017795751 | 3300005530 | Corn Rhizosphere | MKKKPPGVFSLIVTAFTGFGAHLVALCATGRDRLLALQGRKTRPGKR* |
| Ga0070696_1004049751 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | MKKKQPGVFSLIATAFTGFGAHIVTLCGTARDRLLALQGRKARPGKR* |
| Ga0068859_1026675801 | 3300005617 | Switchgrass Rhizosphere | PVSRPVSKGAPMKKKPPGVFSLIVTAFTGFGAHLVALCATGRDRLLAFQGRKTRPGKR* |
| Ga0074472_106208432 | 3300005833 | Sediment (Intertidal) | MKKPPGAFSLIVTAFTGFGAHIVALCVTGRDRLLALQSRKVRPGKR* |
| Ga0099791_102606952 | 3300007255 | Vadose Zone Soil | MKKKPAGVFSLIVTAFTGFGAHLLALCATGRDRLLALQSRKARPGKR* |
| Ga0099791_106560193 | 3300007255 | Vadose Zone Soil | GVFSLIATAFTGFGAHIVTLCGTARDRLLALQGRKARPGKR* |
| Ga0099794_102831402 | 3300007265 | Vadose Zone Soil | MKKKSPGVFSLIATGFTGFGAHLVSLCATARDRLLALQSRKARSGKR* |
| Ga0105078_10541501 | 3300009823 | Groundwater Sand | PMKKKQPGVFSLIATAFTGFGAHLVTLCGTARDRLLALQGRKARPGKR* |
| Ga0136847_118149012 | 3300010391 | Freshwater Sediment | MKKKPPGVLSLIVTAFTGFGAHIVALCVTGRDRLLALQGRKVRPGKR* |
| Ga0137440_10322423 | 3300011410 | Soil | MKKKPPGVFSLIVTAFTGFGAHIVALCVTGRDRLLAFQGRKARPGKR* |
| Ga0137436_11233933 | 3300011423 | Soil | MKKKSPGVFSLIATGFTGFGAHLVSLCAAARDRLLALQSRKARSGKR* |
| Ga0137439_10397133 | 3300011424 | Soil | MKKKSPGVFSLIVTGFTGFGAHLVSLCATARDRLLALQ |
| Ga0137455_10389253 | 3300011429 | Soil | MKKKPPGVFSLIATGFTGFGAHLVTLCAAARDRLLALQ |
| Ga0137455_11917942 | 3300011429 | Soil | LEGSPMKKKSRRVFSLIATGFTGFGAHLVSLCATARDRLLALQSRKARSGKR* |
| Ga0137458_10700542 | 3300011436 | Soil | MKKKPPGVFSLIVTAFTGFGAHIVALCVTGRDRLLAFQGRKARHGKR* |
| Ga0137389_111358011 | 3300012096 | Vadose Zone Soil | IATGFTGFGAHLVSLCATARDRLLALQSRKARSGKR* |
| Ga0137399_104861822 | 3300012203 | Vadose Zone Soil | MKKPPGVFSLIATAFTGFGAHIVTLCGTARDRLLALQGRKARPGKR* |
| Ga0137369_107652962 | 3300012355 | Vadose Zone Soil | MKKPSGVFSLIVTAFTGFGARIVTLCGTARDRLLALQGRKARPRKR* |
| Ga0137368_109648112 | 3300012358 | Vadose Zone Soil | MKKPSGVFSLIVTAFTGFGAHIVTLCGTARDRLLALQGRKARPRKR* |
| Ga0137419_100731725 | 3300012925 | Vadose Zone Soil | MKKPPGVFSLIATAFTGFGAHMVTLCGTARDRLLALQGRKARPGKR* |
| Ga0137419_111145442 | 3300012925 | Vadose Zone Soil | MKKKPAGVFSLIVTAFSGFGAHLLALCATGRDRLLALQSRKARPGKR* |
| Ga0137404_100789802 | 3300012929 | Vadose Zone Soil | MKKKQPGVFSLIATAFTGFGAHIATLCGTARDRLLALQGRKARPGKR* |
| Ga0137407_101993932 | 3300012930 | Vadose Zone Soil | MKKKQPGVFSLTATAFTGFGAHIATLCGTARDRLLALQGRKARPGKR* |
| Ga0157380_110713582 | 3300014326 | Switchgrass Rhizosphere | MKKKPPGVFSLIATAFTGFGAHLVALCATGRDRLLALQGRKTRPGKR* |
| Ga0180066_10013355 | 3300014873 | Soil | MKKKPPGVFSLIATGFTGFGAHLVTLCATARDRLLALQSRKARSGKR* |
| Ga0180074_10304423 | 3300014877 | Soil | MKKKPPGVLSLIVTAFTGFGAHLVALCVTGRDRLLALQGRKVRHGKR* |
| Ga0180063_10096573 | 3300014885 | Soil | MKKKSPGVFSLIATGVTGFGAHLVTLCATARDRLLALQSRKARSGKR* |
| Ga0180085_12611301 | 3300015259 | Soil | KSPGVFSLIATGVTGFGAHLVTLCATARDRLLALQSRKARSGKR* |
| Ga0184604_100043503 | 3300018000 | Groundwater Sediment | MKKPPGVFSLIATAFTGFGAHLVTLCGTARDRLRALQGRKARPGKR |
| Ga0184638_11696713 | 3300018052 | Groundwater Sediment | MKKKLPGVFSLIATGFTGFGAHLVSLCATARDRLLALQSRKARSG |
| Ga0184626_100054673 | 3300018053 | Groundwater Sediment | MKKKSPGVFSLIATGFTGFGAHLVSLCATARDRLLALQSRKARSGKR |
| Ga0184621_100377924 | 3300018054 | Groundwater Sediment | MKKKQPGVFSLIATAFTGFGAHIVTLCGTARDRLLALQGRKARPGKR |
| Ga0184615_101313893 | 3300018059 | Groundwater Sediment | MKKKSPGVFSLIATGFTGFGAHLVSLCATARDRLLALQGRKARSGKR |
| Ga0184640_100513184 | 3300018074 | Groundwater Sediment | MKKKPPGVFSLIATGFTGFGAHLVTLCAAARDRLLALQSRKVRSGKR |
| Ga0184633_105709663 | 3300018077 | Groundwater Sediment | FSLIATGFTGFGAHLVSLCATARDRLLALQSRKVRSGKR |
| Ga0190265_100220795 | 3300018422 | Soil | MKKKSPGVFSLIVTAFSGFGVHILSLCVTGRDRLLALQGRKARPGKR |
| Ga0190265_100274823 | 3300018422 | Soil | MKKKPPGVFSLIVTAFTGLGAHLVALCVTGRDRVLAFQGRKARPGKR |
| Ga0190272_101501343 | 3300018429 | Soil | MKKKQPGVFSLIVTAFTGFGAHVVALCLTGRDRLRALQGRKVRQHGKR |
| Ga0190269_117000511 | 3300018465 | Soil | MKKKQPGVFSLIATAFTGFGAHIATLCGTARDRLLALQGRKARPGKR |
| Ga0187894_100212952 | 3300019360 | Microbial Mat On Rocks | MKKKSPGVFSLLVAGFSGFGAHLVTVCATARDRLLALQSRKARSRKR |
| Ga0190264_115568481 | 3300019377 | Soil | GVFSLLVAGFSGFGAHLVTLCATARDRLLALQSRKARSGKR |
| Ga0187892_100621312 | 3300019458 | Bio-Ooze | MKKKSPGVFSLLVAGFSGFGAHLVTLCATARDRLLALQSRKARSRKR |
| Ga0187892_101733954 | 3300019458 | Bio-Ooze | MKKKPPGVFSLLVAGFSGFGAHLVTVCATARDRLLALQSRKARSRKR |
| Ga0193754_10045713 | 3300019872 | Soil | MKKKPPGVFSLIATAFTGFGAHLVALCATGRDRLLALQGRKARPGKR |
| Ga0193707_10678971 | 3300019881 | Soil | VFSLIATAFTGFGAHLVTLCGTARDRLRALQGRKARPGKR |
| Ga0193713_10024976 | 3300019882 | Soil | MKKKPPGVFSLIATAFSGFGAHLVALCATGRDRLLALQGRKARPGKR |
| Ga0193725_10774022 | 3300019883 | Soil | MKKKLPGVFSLIATGFTGFGAHLVSLCATARDRLLALQSRKARSGKR |
| Ga0193725_10860102 | 3300019883 | Soil | MKKPAGVFSLIATAFTGFGAHLVTLCGTARDRLRALQGRKARPGKR |
| Ga0193727_10480161 | 3300019886 | Soil | FALIATAFTGFGAHIVTLCGTARDRLLALQGRKARPGKR |
| Ga0193727_10786251 | 3300019886 | Soil | PMKKKPPGVFSLIATAFTGFGAHLVALCATGRDRLLALQGRKARPGKR |
| Ga0193730_11511941 | 3300020002 | Soil | ASRLEGSPMKKPPGVFSLIATAFTGFGAHLVTLCGTARDRLLALQGRKARPGKR |
| Ga0193717_11174262 | 3300020060 | Soil | MKRKQPGVFSLIVTVFTGFGAHVVALCLSGRDRLLALQGRKVRHGKR |
| Ga0180118_12339751 | 3300020063 | Groundwater Sediment | MKKKSPGVFSLIATGFTGFGAHLVSLCATARNRLLALQSRKARSGKR |
| Ga0222622_105332753 | 3300022756 | Groundwater Sediment | GVFSLIATAFTGFGAHLVTLCGTARDRLRALQGRKARPGKR |
| Ga0137417_10935203 | 3300024330 | Vadose Zone Soil | MKKPPGVFSLIATAFTGFGAHIVTLCGTARDRLLALQGRKARPGKR |
| Ga0209640_100063905 | 3300025324 | Soil | MKKPPGVFSLMAAALTGFGAHLVNLCSTARARLLALQSRKARPGKR |
| Ga0209640_100840732 | 3300025324 | Soil | MKKKSPGVFSLIATGVTGFGAHLVTLCATARDRLLALQSRKARSGKR |
| Ga0210083_10565052 | 3300025521 | Natural And Restored Wetlands | VSSHLEGSPMKKKPPGVFSLLATGVTGFGAHLVHLCATARDRLLALQSRKARPGKR |
| Ga0207653_100758221 | 3300025885 | Corn, Switchgrass And Miscanthus Rhizosphere | MKKKPPGVFSLIVTAFTGFGAHLVALCATGRDRLLAFQGRKTRPGKR |
| Ga0207707_107285853 | 3300025912 | Corn Rhizosphere | MVKKQPGVLSLIVTAFTGFGTHLVALCVTGRDRLLALPGRKGRSGKR |
| Ga0207646_108930842 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MKKQPGVFSLIATAFTGFGAHIVTLCGTARDRLLALQGRKARPGKR |
| Ga0207646_114851581 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MKKPPGVLSLIVTAFTGFGAHIVALCVSGRDRLLAHPGRKARNGK |
| Ga0207686_103561903 | 3300025934 | Miscanthus Rhizosphere | MKKKPPGVFSLIVTAFTGFGAHLVALCATGRDRLLAFQG |
| Ga0210071_10055963 | 3300025955 | Natural And Restored Wetlands | MKKKPPGVFSLLATGVTGFGAHLVHLCATARDRLLALQSRKARPGKR |
| Ga0208658_10216351 | 3300026047 | Natural And Restored Wetlands | MKKKPPGVFSLIVTAFTGFGSHIMTLCVTGRDRLLAL |
| Ga0208659_10091301 | 3300026054 | Natural And Restored Wetlands | LLATGVTGFGAHLVHLCATARDRLLALQSRKARPGKR |
| Ga0209131_10032646 | 3300026320 | Grasslands Soil | MKKKPAGVFSLIVTAFSGFGAHLLALCATGRDRLLALQSRKARPGKR |
| Ga0257173_10030041 | 3300026360 | Soil | LEGSPMKKKSPRVFSLIATGFTGFGAHLVSLCATARDRLLALQSRKARSGKR |
| Ga0257181_10021982 | 3300026499 | Soil | MKKKSPGVFSLIATGFTGFGAHLVSMCATARDRLLALQSRKARSGKR |
| Ga0257165_10493602 | 3300026507 | Soil | KKKSPGVFSLIATGFTGFGAHLVSLCATARDRLLALQSRKARSGKR |
| Ga0256867_100337385 | 3300026535 | Soil | MKKKPPGVFSLLATGVTGFGAHLVTLCATARDRLLALQSRKVRPGKR |
| Ga0209996_10092711 | 3300027395 | Arabidopsis Thaliana Rhizosphere | MAKPPGVFSLLVTAVTGFGNHLVGLCAAGRDRLLGR |
| Ga0209726_101841642 | 3300027815 | Groundwater | MKKKPAGVFSLIASGLTGFGAHLVTLCATARDRLLALQSGKARSGKR |
| Ga0209705_105424461 | 3300027979 | Freshwater Sediment | MKKKPPGVFSLIVTAFTGFGAHIVALCVTGRDRLLALQGRKVRHGKR |
| Ga0268265_101124351 | 3300028380 | Switchgrass Rhizosphere | MKKKPPGVFSLIVTAFTGFGAHLVALCATGRDRLLALQGRKTRPGKR |
| Ga0257175_10180851 | 3300028673 | Soil | VFSLIATGFTGFGAHLVSLCATARDRLLALQSRKARSGKR |
| Ga0307281_100692363 | 3300028803 | Soil | MKKKPPGVFSLIATGFTGFGAHLVSLCATARDRLLALQSRKARSGKR |
| Ga0299907_102726753 | 3300030006 | Soil | MKKKPPGVFSLLTTGVTGFGAHLVTLCATARDRLLALQSRKVRPGKR |
| Ga0302046_102997005 | 3300030620 | Soil | MSRLEGSPMKKKSPGVFSLIAAGFTGFGAHLVSLCATARDRLLALQSRKARSGKR |
| Ga0308178_11057602 | 3300030990 | Soil | MKKKQPGVFSLIATAFTGFGAHLVTLCGTARDRLRALQGRKARPGKR |
| (restricted) Ga0255311_10355271 | 3300031150 | Sandy Soil | MKKKPPGVFSLIVTAFTGFGAHLVALCATGRDRLL |
| (restricted) Ga0255311_10380373 | 3300031150 | Sandy Soil | MKKKPPGVFSLIVTAFTGFGAHLVALCATGRDRLLALPGRKARPGKR |
| (restricted) Ga0255311_10407082 | 3300031150 | Sandy Soil | MKKKPPGVFSLIVTAFTGFGAHLVTLCVTGRDRLLTLQSRKIRPGKR |
| Ga0299913_102492385 | 3300031229 | Soil | MKKKLPGVFSLLATGVTGFGAHLVTLCATARDRLLALQGRKVRPGKR |
| (restricted) Ga0255312_10284151 | 3300031248 | Sandy Soil | MKKKPPGVFSLIVTAFTGFGAHLVTLCVTGRDRLLTLQSRKIRP |
| Ga0307469_100283875 | 3300031720 | Hardwood Forest Soil | MKKKPPGVFSLIVTAFTGFGAHLVALCATGRDRLLALQGRKARPGKR |
| Ga0307468_1013678072 | 3300031740 | Hardwood Forest Soil | TSRLEGSPMKKKPPGVFSLIVTAFTGFGAHIVSLCVTGRDRLLALQGRKARHGKR |
| Ga0214473_103432855 | 3300031949 | Soil | MKKKSPGVFSLIVAGFSGFGAHLVTLCATARDRLLALQSRKVRSRKR |
| Ga0307470_100969152 | 3300032174 | Hardwood Forest Soil | MKKKQPGVFSLIVTAFTGFGAHIVSLCVTGRDRLLALQGRKARHGKR |
| Ga0307471_1007144002 | 3300032180 | Hardwood Forest Soil | MKKQPGVFSLIVTAFTGFGAHIVSLCATGRDRLLALPGRKKQTGKR |
| Ga0334722_104833013 | 3300033233 | Sediment | MKKKPPGVFSLIVTAFTGFGAHIMALCVTGRDRLLALQNRKVRPGKR |
| Ga0364942_0303907_2_121 | 3300034165 | Sediment | FSLIATGFTGFGAHLVTLCAAARDRLLALQSRKARSGKR |
| ⦗Top⦘ |