NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F098705

Metagenome / Metatranscriptome Family F098705

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F098705
Family Type Metagenome / Metatranscriptome
Number of Sequences 103
Average Sequence Length 45 residues
Representative Sequence MQTVLGLLELAFYVVSILTLSAAVTYAVVKISPAKSAKRQPDKA
Number of Associated Samples 69
Number of Associated Scaffolds 103

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 5.83 %
% of genes near scaffold ends (potentially truncated) 16.50 %
% of genes from short scaffolds (< 2000 bps) 83.50 %
Associated GOLD sequencing projects 65
AlphaFold2 3D model prediction Yes
3D model pTM-score0.49

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (70.874 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment
(36.893 % of family members)
Environment Ontology (ENVO) Unclassified
(42.718 % of family members)
Earth Microbiome Project Ontology (EMPO) Unclassified
(40.777 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Transmembrane (alpha-helical) Signal Peptide: Yes Secondary Structure distribution: α-helix: 41.67%    β-sheet: 0.00%    Coil/Unstructured: 58.33%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.49
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 103 Family Scaffolds
PF01262AlaDh_PNT_C 31.07
PF05222AlaDh_PNT_N 9.71
PF08241Methyltransf_11 3.88
PF07883Cupin_2 3.88
PF01676Metalloenzyme 2.91
PF00248Aldo_ket_red 1.94
PF00535Glycos_transf_2 0.97
PF01609DDE_Tnp_1 0.97
PF11967RecO_N 0.97
PF00903Glyoxalase 0.97
PF01546Peptidase_M20 0.97
PF07831PYNP_C 0.97

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 103 Family Scaffolds
COG0213Thymidine phosphorylaseNucleotide transport and metabolism [F] 0.97
COG3039Transposase and inactivated derivatives, IS5 familyMobilome: prophages, transposons [X] 0.97
COG3293TransposaseMobilome: prophages, transposons [X] 0.97
COG3385IS4 transposase InsGMobilome: prophages, transposons [X] 0.97
COG5421TransposaseMobilome: prophages, transposons [X] 0.97
COG5433Predicted transposase YbfD/YdcC associated with H repeatsMobilome: prophages, transposons [X] 0.97
COG5659SRSO17 transposaseMobilome: prophages, transposons [X] 0.97

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms70.87 %
UnclassifiedrootN/A29.13 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2088090009|LWAnN_GIDYKCY01DETC4All Organisms → cellular organisms → Bacteria509Open in IMG/M
2140918007|ConsensusfromContig64308All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia4139Open in IMG/M
3300001213|JGIcombinedJ13530_108948785All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria976Open in IMG/M
3300004024|Ga0055436_10217229All Organisms → cellular organisms → Bacteria602Open in IMG/M
3300004071|Ga0055486_10050028All Organisms → cellular organisms → Bacteria837Open in IMG/M
3300004071|Ga0055486_10082354Not Available704Open in IMG/M
3300004081|Ga0063454_101472750All Organisms → cellular organisms → Bacteria581Open in IMG/M
3300004778|Ga0062383_10346504Not Available722Open in IMG/M
3300004778|Ga0062383_10443878All Organisms → cellular organisms → Bacteria644Open in IMG/M
3300004779|Ga0062380_10048455All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1425Open in IMG/M
3300004779|Ga0062380_10092981All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1106Open in IMG/M
3300004781|Ga0062379_10130006Not Available615Open in IMG/M
3300004782|Ga0062382_10168472Not Available938Open in IMG/M
3300005218|Ga0068996_10166341All Organisms → cellular organisms → Bacteria552Open in IMG/M
3300005833|Ga0074472_11342151All Organisms → cellular organisms → Bacteria1154Open in IMG/M
3300005955|Ga0073922_1056240Not Available506Open in IMG/M
3300006050|Ga0075028_100534876All Organisms → cellular organisms → Bacteria → Proteobacteria688Open in IMG/M
3300006059|Ga0075017_100562040All Organisms → cellular organisms → Bacteria869Open in IMG/M
3300007521|Ga0105044_10164421All Organisms → cellular organisms → Bacteria2318Open in IMG/M
3300009091|Ga0102851_13395959Not Available511Open in IMG/M
3300009120|Ga0117941_1007035All Organisms → cellular organisms → Bacteria3152Open in IMG/M
3300009153|Ga0105094_10833047Not Available543Open in IMG/M
3300009868|Ga0130016_10612520All Organisms → cellular organisms → Bacteria676Open in IMG/M
3300012212|Ga0150985_106900982All Organisms → cellular organisms → Bacteria1596Open in IMG/M
3300012668|Ga0157216_10165076All Organisms → cellular organisms → Bacteria1062Open in IMG/M
3300012964|Ga0153916_10029880All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes4726Open in IMG/M
3300012985|Ga0164308_11608381Not Available600Open in IMG/M
3300014299|Ga0075303_1099592Not Available564Open in IMG/M
3300014304|Ga0075340_1050573All Organisms → cellular organisms → Bacteria726Open in IMG/M
3300014323|Ga0075356_1019772All Organisms → cellular organisms → Bacteria1278Open in IMG/M
3300015159|Ga0167630_1001966All Organisms → cellular organisms → Bacteria4106Open in IMG/M
3300015163|Ga0167665_1024677All Organisms → cellular organisms → Bacteria1185Open in IMG/M
3300015163|Ga0167665_1086287All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia534Open in IMG/M
3300015189|Ga0167667_1001140All Organisms → cellular organisms → Bacteria9348Open in IMG/M
3300015189|Ga0167667_1002790All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria5835Open in IMG/M
3300015209|Ga0167629_1186427All Organisms → cellular organisms → Bacteria537Open in IMG/M
3300015360|Ga0163144_10019221All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria13754Open in IMG/M
3300018481|Ga0190271_11302313All Organisms → cellular organisms → Bacteria847Open in IMG/M
3300020186|Ga0163153_10008712All Organisms → cellular organisms → Bacteria10443Open in IMG/M
3300020195|Ga0163150_10443049Not Available587Open in IMG/M
3300025939|Ga0207665_10468291Not Available969Open in IMG/M
3300027735|Ga0209261_10046167Not Available1090Open in IMG/M
3300027778|Ga0209464_10127427Not Available884Open in IMG/M
3300027831|Ga0209797_10242548Not Available759Open in IMG/M
3300027840|Ga0209683_10250532Not Available815Open in IMG/M
3300027840|Ga0209683_10251279All Organisms → cellular organisms → Bacteria813Open in IMG/M
3300027843|Ga0209798_10166597Not Available1099Open in IMG/M
3300027843|Ga0209798_10339390All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium713Open in IMG/M
3300027843|Ga0209798_10436952All Organisms → cellular organisms → Bacteria607Open in IMG/M
3300027850|Ga0209591_10223565All Organisms → cellular organisms → Bacteria1477Open in IMG/M
3300027870|Ga0209023_10615712All Organisms → cellular organisms → Bacteria635Open in IMG/M
3300027897|Ga0209254_10091292All Organisms → cellular organisms → Bacteria2569Open in IMG/M
3300027902|Ga0209048_10026998All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes4909Open in IMG/M
3300028420|Ga0210366_10070125All Organisms → cellular organisms → Bacteria1173Open in IMG/M
3300028869|Ga0302263_10389039Not Available551Open in IMG/M
3300029984|Ga0311332_10935813Not Available694Open in IMG/M
3300030114|Ga0311333_10157556All Organisms → cellular organisms → Bacteria1740Open in IMG/M
3300030114|Ga0311333_10843392All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium771Open in IMG/M
3300030294|Ga0311349_11181100Not Available714Open in IMG/M
3300030294|Ga0311349_11566685All Organisms → cellular organisms → Bacteria611Open in IMG/M
3300031226|Ga0307497_10406541Not Available652Open in IMG/M
3300031834|Ga0315290_10016230All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria5690Open in IMG/M
3300031834|Ga0315290_10025268All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria4646Open in IMG/M
3300031834|Ga0315290_10078706All Organisms → cellular organisms → Bacteria2741Open in IMG/M
3300031834|Ga0315290_10158642All Organisms → cellular organisms → Bacteria1950Open in IMG/M
3300031834|Ga0315290_10203053All Organisms → cellular organisms → Bacteria1723Open in IMG/M
3300031834|Ga0315290_10223982All Organisms → cellular organisms → Bacteria1638Open in IMG/M
3300031834|Ga0315290_10569510All Organisms → cellular organisms → Bacteria985Open in IMG/M
3300031834|Ga0315290_10581579All Organisms → cellular organisms → Bacteria973Open in IMG/M
3300031834|Ga0315290_10683036All Organisms → cellular organisms → Bacteria886Open in IMG/M
3300031862|Ga0315280_10180011All Organisms → cellular organisms → Bacteria1247Open in IMG/M
3300031873|Ga0315297_10317750All Organisms → cellular organisms → Bacteria1300Open in IMG/M
3300031873|Ga0315297_10631487Not Available899Open in IMG/M
3300031873|Ga0315297_11642095Not Available516Open in IMG/M
3300031902|Ga0302322_101555457All Organisms → cellular organisms → Bacteria808Open in IMG/M
3300031918|Ga0311367_10177381All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → unclassified Conexibacter → Conexibacter sp. S30A12236Open in IMG/M
3300031997|Ga0315278_10039601All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria4578Open in IMG/M
3300031997|Ga0315278_10843729All Organisms → cellular organisms → Bacteria923Open in IMG/M
3300031997|Ga0315278_11249207Not Available726Open in IMG/M
3300032018|Ga0315272_10265339All Organisms → cellular organisms → Bacteria829Open in IMG/M
3300032018|Ga0315272_10352175All Organisms → cellular organisms → Bacteria721Open in IMG/M
3300032018|Ga0315272_10581111All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales564Open in IMG/M
3300032143|Ga0315292_10154485All Organisms → cellular organisms → Bacteria1849Open in IMG/M
3300032143|Ga0315292_10311409All Organisms → cellular organisms → Bacteria1312Open in IMG/M
3300032143|Ga0315292_11658366All Organisms → cellular organisms → Bacteria514Open in IMG/M
3300032163|Ga0315281_10046301All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria5345Open in IMG/M
3300032164|Ga0315283_10393867All Organisms → cellular organisms → Bacteria1506Open in IMG/M
3300032164|Ga0315283_12061845All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes565Open in IMG/M
3300032164|Ga0315283_12290757All Organisms → cellular organisms → Bacteria529Open in IMG/M
3300032173|Ga0315268_11073565Not Available813Open in IMG/M
3300032173|Ga0315268_11893893Not Available610Open in IMG/M
3300032177|Ga0315276_12183369All Organisms → cellular organisms → Bacteria561Open in IMG/M
3300032256|Ga0315271_10942429All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium745Open in IMG/M
3300032256|Ga0315271_11127191All Organisms → cellular organisms → Bacteria678Open in IMG/M
3300032275|Ga0315270_10137967Not Available1458Open in IMG/M
3300032275|Ga0315270_10289346All Organisms → cellular organisms → Bacteria1025Open in IMG/M
3300032275|Ga0315270_10322267Not Available973Open in IMG/M
3300032275|Ga0315270_10995008Not Available556Open in IMG/M
3300032397|Ga0315287_11170879Not Available886Open in IMG/M
3300032516|Ga0315273_11108923All Organisms → cellular organisms → Bacteria1004Open in IMG/M
3300032516|Ga0315273_12395953All Organisms → cellular organisms → Bacteria612Open in IMG/M
3300033408|Ga0316605_11059983All Organisms → cellular organisms → Bacteria780Open in IMG/M
3300034155|Ga0370498_115562Not Available633Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Sediment36.89%
Wetland SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment13.59%
FenEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Fen7.77%
Glacier Forefield SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil6.80%
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands3.88%
Freshwater Microbial MatEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Microbial Mat2.91%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil2.91%
Natural And Restored WetlandsEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands2.91%
Freshwater Lake SedimentEnvironmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment1.94%
FreshwaterEnvironmental → Aquatic → Freshwater → Ice → Glacial Lake → Freshwater1.94%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds1.94%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment0.97%
Freshwater And SedimentEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater And Sediment0.97%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Sediment0.97%
Freshwater WetlandsEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands0.97%
Freshwater WetlandsEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands0.97%
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine0.97%
WetlandEnvironmental → Aquatic → Marine → Wetlands → Sediment → Wetland0.97%
Sediment (Intertidal)Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal)0.97%
Lake SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Lake Sediment0.97%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Soil0.97%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil0.97%
Untreated Peat SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil0.97%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil0.97%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere0.97%
SandEnvironmental → Terrestrial → Soil → Sand → Unclassified → Sand0.97%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere0.97%
WastewaterEngineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Wastewater0.97%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2088090009Freshwater sediment microbial communities from Lake Washington, Seattle, for methane and nitrogen Cycles - SIP 13C-methane anaerobic+nitrateEnvironmentalOpen in IMG/M
2140918007Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Active_allEnvironmentalOpen in IMG/M
3300001213Combined assembly of wetland microbial communities from Twitchell Island in the Sacramento Delta (Jan 2013 JGI Velvet Assembly)EnvironmentalOpen in IMG/M
3300004024Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqB_D2EnvironmentalOpen in IMG/M
3300004071Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushMan_ThreeSqB_D2EnvironmentalOpen in IMG/M
3300004081Grasslands soil microbial communities from Hopland, California, USA - 2 (version 2)EnvironmentalOpen in IMG/M
3300004778Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare3FreshEnvironmentalOpen in IMG/M
3300004779Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T0Bare3FreshEnvironmentalOpen in IMG/M
3300004781Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T0Bare2FreshEnvironmentalOpen in IMG/M
3300004782Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare2FreshEnvironmentalOpen in IMG/M
3300005218Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_ThreeSqC_D2EnvironmentalOpen in IMG/M
3300005833Microbial communities from Cathlamet Bay sediment, Columbia River estuary, Oregon - S.174_CBKEnvironmentalOpen in IMG/M
3300005955Groundwater microbial communities from the Columbia River, Washington, USA, for microbe roles in carbon and contaminant biogeochemistry - GW-RW metaG T2_23-Sept-14EnvironmentalOpen in IMG/M
3300006050Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014EnvironmentalOpen in IMG/M
3300006059Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012EnvironmentalOpen in IMG/M
3300007521Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - MAT-01EnvironmentalOpen in IMG/M
3300009091Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300009120Lake sediment microbial communities from Tanners Lake, St. Paul, MNEnvironmentalOpen in IMG/M
3300009153Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 10-12cm March2015EnvironmentalOpen in IMG/M
3300009868Activated sludge microbial diversity in wastewater treatment plant from Tai Wan - Bali plant Bali plantEngineeredOpen in IMG/M
3300012212Combined assembly of Hopland grassland soilHost-AssociatedOpen in IMG/M
3300012668Arctic soils microbial communities. Combined Assembly of 23 SPsEnvironmentalOpen in IMG/M
3300012964Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 4 metaGEnvironmentalOpen in IMG/M
3300012985Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MGEnvironmentalOpen in IMG/M
3300014299Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleC_D1EnvironmentalOpen in IMG/M
3300014304Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushMan_ThreeSqA_D1EnvironmentalOpen in IMG/M
3300014323Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - WestPond_CattailB_D1EnvironmentalOpen in IMG/M
3300015159Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G3C, Proglacial river margin, by glacier terminus)EnvironmentalOpen in IMG/M
3300015163Arctic soil microbial communities from a glacier forefield, Rabots glacier, Tarfala, Sweden (Sample Rb1b, glacier snout)EnvironmentalOpen in IMG/M
3300015189Arctic soil microbial communities from a glacier forefield, Rabots glacier, Tarfala, Sweden (Sample Rb2a, glacial moraine)EnvironmentalOpen in IMG/M
3300015209Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G3B, Proglacial river margin, by glacier terminus)EnvironmentalOpen in IMG/M
3300015360Freshwater microbial mat bacterial communities from Lake Vanda, McMurdo Dry Valleys, Antarctica - Oligotrophic Lake LV.19.BULKMAT1EnvironmentalOpen in IMG/M
3300018481Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 TEnvironmentalOpen in IMG/M
3300020186Freshwater microbial mat bacterial communities from Lake Vanda, McMurdo Dry Valleys, Antarctica - Oligotrophic Lake LV.19.MP6.IB-1EnvironmentalOpen in IMG/M
3300020195Freshwater microbial mat bacterial communities from Lake Vanda, McMurdo Dry Valleys, Antarctica - Oligotrophic Lake LV.19.P2.IBEnvironmentalOpen in IMG/M
3300025939Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027735Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T0Bare1Fresh (SPAdes)EnvironmentalOpen in IMG/M
3300027778Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare1Fresh (SPAdes)EnvironmentalOpen in IMG/M
3300027831Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T0Bare3Fresh (SPAdes)EnvironmentalOpen in IMG/M
3300027840Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare2Fresh (SPAdes)EnvironmentalOpen in IMG/M
3300027843Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare3Fresh (SPAdes)EnvironmentalOpen in IMG/M
3300027850Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - MAT-01 (SPAdes)EnvironmentalOpen in IMG/M
3300027870Freshwater and sediment microbial communities from Lake Erie, Canada (SPAdes)EnvironmentalOpen in IMG/M
3300027897Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - DIP11 DI (SPAdes)EnvironmentalOpen in IMG/M
3300027902Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - CRP12 CR (SPAdes)EnvironmentalOpen in IMG/M
3300028420Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Washington, United States ? S.641 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028869Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Fen_N1_4EnvironmentalOpen in IMG/M
3300029984I_Fen_E1 coassemblyEnvironmentalOpen in IMG/M
3300030114I_Fen_E2 coassemblyEnvironmentalOpen in IMG/M
3300030294II_Fen_E3 coassemblyEnvironmentalOpen in IMG/M
3300031226Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 10_SEnvironmentalOpen in IMG/M
3300031834Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G12_0EnvironmentalOpen in IMG/M
3300031862Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G06_40EnvironmentalOpen in IMG/M
3300031873Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G15_0EnvironmentalOpen in IMG/M
3300031902Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_2EnvironmentalOpen in IMG/M
3300031918III_Fen_N3 coassemblyEnvironmentalOpen in IMG/M
3300031997Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G06_0EnvironmentalOpen in IMG/M
3300032018Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_middleEnvironmentalOpen in IMG/M
3300032143Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_0EnvironmentalOpen in IMG/M
3300032163Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G07_0EnvironmentalOpen in IMG/M
3300032164Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_0EnvironmentalOpen in IMG/M
3300032173Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C1_topEnvironmentalOpen in IMG/M
3300032177Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G05_0EnvironmentalOpen in IMG/M
3300032256Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_topEnvironmentalOpen in IMG/M
3300032275Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C1_bottomEnvironmentalOpen in IMG/M
3300032397Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_0EnvironmentalOpen in IMG/M
3300032516Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_0EnvironmentalOpen in IMG/M
3300033408Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day20_noCTEnvironmentalOpen in IMG/M
3300034155Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_05D_17EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
LWAnN_092344602088090009Freshwater SedimentMQTVLGLFELTFYVVSILTLSAAVTYAVVKISPAKSAKRQTDKT
A_all_C_008213202140918007SoilMKTVLGLFELAFYVVSILSLSAAVTFAVVKISPVKPAKRQADKA
JGIcombinedJ13530_10894878523300001213WetlandMDTILGLLELVLYVCTILALSAAVTYAVVRISPSQSAKQSSGKS*
Ga0055436_1021722923300004024Natural And Restored WetlandsMQTIFGLAELAFYVCSILGLSAAVTYAVVRISPSQSAKQSADKA*
Ga0055486_1005002823300004071Natural And Restored WetlandsMRTVLGLIELVFYVCSILALSAAVTYLVVKISPMKTAKPQPDKG*
Ga0055486_1008235423300004071Natural And Restored WetlandsMTTVLGLIELALYVVSILTLSAAITYAVVKISPAKSAKRQPEKS*
Ga0063454_10147275023300004081SoilMPVVYAWMQTVLGLFELLFYVVSILALSAGVTYAVVRISPAKSSKPKPEEA*
Ga0062383_1034650413300004778Wetland SedimentMQTVLGLLELAFYVVSILTLSAAVTYAVVKISPAKSAKRQPDKA*
Ga0062383_1044387823300004778Wetland SedimentMETVLGLIELALYVVSILTLSAAVTYAVVRISPAKSAKRQPDKT*
Ga0062380_1004845513300004779Wetland SedimentMDTALGLVELALYVVVILTLSAAVTYVVVRISPAKPAKRQADKS*
Ga0062380_1009298113300004779Wetland SedimentPMDTILGLVELVFYVCCILALSAAVTYAVVRISPSQAAKQSTDKS*
Ga0062379_1013000613300004781Wetland SedimentMDTILGLVELVFYVCCILALSAAVTYAVVRISPSQAAKQSTDKS*
Ga0062382_1016847213300004782Wetland SedimentMSSILGLVELAVYVCSILALSSAVTYAVVRISPSQSAKQSPEKT*
Ga0068996_1016634113300005218Natural And Restored WetlandsMDTILGLLELTFYVCSILALSAAVTYAVVRISPSQSAKRSAGKS*
Ga0074472_1134215123300005833Sediment (Intertidal)MKTVLGLIELAFYVVSILTLSAAVTYAVVRISPAKSAKRQPDKT*
Ga0073922_105624013300005955SandMRTVLGLLELVFYVCSILALSAGVTYLVVKISPLKTAKPKPD
Ga0075028_10053487623300006050WatershedsMETVLGLLALALYVAGILALSAAITYAVVKISPAKPAKRAPDKA*
Ga0075017_10056204023300006059WatershedsMHTVFGLLELAFYVVAILALSATVTFLVVKVSPSSSKKPKAEKA*
Ga0105044_1016442123300007521FreshwaterMRTVFGLLELVFYVCSILALSAGVTYLVVRISPMKPAKRQPDKT*
Ga0102851_1339595923300009091Freshwater WetlandsMETVLGLIELALYVVGILTLSAAVTYAVVRISPAKSAKRQPDKG*
Ga0117941_100703533300009120Lake SedimentMDTILGLLELVLYVCSILALSAAVTYAVVRISPSQSAKQSAGKD*
Ga0105094_1083304723300009153Freshwater SedimentMDTILGLLELTLYVCSILALSVAAASSKIRITPSQSAKQSAGKD*
Ga0130016_1061252013300009868WastewaterMDTILGLLELALYVCSILALSAAVTFAVVKISPSQSAKQPIGKS*
Ga0150985_10690098223300012212Avena Fatua RhizosphereMPVVYARMQTVLGLFELLFYVVSILALSAGVTYAVVRISPAKSSKPKPEEA*
Ga0157216_1016507623300012668Glacier Forefield SoilMRTVLGLLELLVYVLTILALSAAVTFLVVKISPAKSKKGSAVTDKN*
Ga0153916_1002988023300012964Freshwater WetlandsMDTILGLVELAFYVCCILGLSAAVTYAVVRISPSQSAKQSADKT*
Ga0164308_1160838123300012985SoilMPVVYARMRTALGLLELAFYVGAILLLSAGVTYVVVKISPTKTDKQQPDKA*
Ga0075303_109959223300014299Natural And Restored WetlandsMRTVLGLIELVFYVCSILALSAGVTYLVVRVSPLKSAKSQPDKG*
Ga0075340_105057323300014304Natural And Restored WetlandsMDTALGLLELALYVVSILALSAGMTFAVVKISPAQSAKKRKQADSA*
Ga0075356_101977223300014323Natural And Restored WetlandsMRTVLGLVELVFYVCSILALSAGVTYLVVKISPMKPAKRQPDKT*
Ga0167630_100196633300015159Glacier Forefield SoilMKTVLGLVELALYVASILTLSAAVTFAVVRISPAKSAQPADKT*
Ga0167665_102467723300015163Glacier Forefield SoilMRTVLGLIELAFYVISILTLSAAVTWAVVKISPTKTAKRQPDKA*
Ga0167665_108628723300015163Glacier Forefield SoilMRTVLGLIELVFYVVSILALSAAVTFAVVRISPTKSAKQTDKA*
Ga0167667_100114063300015189Glacier Forefield SoilMRTVLGLLELVFYVCAILALSAGVTYLVVRISPMKTAKPKPDKG*
Ga0167667_100279063300015189Glacier Forefield SoilMRTVLGLLELTFYVCAILALSAGVTYLVVKISPLKTAKPKPDKT*
Ga0167629_118642723300015209Glacier Forefield SoilHQMKTVLGLVELALYVASILTLSAAVTFAVVRISPAKSAQPADKT*
Ga0163144_1001922123300015360Freshwater Microbial MatMRTVLGLLELVFYVCAILALSAGVTYLVVRISPMKTAKRQPDKT*
Ga0190271_1130231333300018481SoilMRTVLGLIELVFYVCSILALSAGVTYLVVKVSPMKTAKSQPDKS
Ga0163153_1000871223300020186Freshwater Microbial MatMRTVLGLLELVFYVCAILALSAGVTYLVVRISPMKTAKRQPDKT
Ga0163150_1044304913300020195Freshwater Microbial MatSTHEMRTVLGLLELVFYVCAILALSAGVTYLVVRISPMKTAKRQPDKT
Ga0207665_1046829123300025939Corn, Switchgrass And Miscanthus RhizosphereMPVVYARMRTALGLLELAFYVGAILLLSAGVTYVVVKISPTKTDKPQPDKA
Ga0209261_1004616723300027735Wetland SedimentMDTILGLVELVFYVCCILALSAAVTYAVVRISPSQAAKQSTDKS
Ga0209464_1012742713300027778Wetland SedimentMDTILGLVELVFYVCCILALSAAVTYAVVRISPSQAAKQS
Ga0209797_1024254823300027831Wetland SedimentILGLVELAVYVCSILALSSAVTYAVVRISPSQSAKQSPEKT
Ga0209683_1025053223300027840Wetland SedimentMSSILGLVELAVYVCSILALSSAVTYAVVRISPSQSAKQSPEKT
Ga0209683_1025127923300027840Wetland SedimentMETVLGLIELALYVVSILTLSAAVTYAVVRISPAKSAKRQPDKT
Ga0209798_1016659713300027843Wetland SedimentMKTVLGLIELAFYVVSILTLSAAVTYAVVRISPAKSAKRQPDKT
Ga0209798_1033939023300027843Wetland SedimentMQTVLGLLELAFYVVSILTLSAAVTYAVVKISPAKSAKRQPDKA
Ga0209798_1043695213300027843Wetland SedimentHRMETVLGLIELALYVVSILTLSAAVTYAVVRISPAKSAKRQPDKT
Ga0209591_1022356523300027850FreshwaterMRTVFGLLELVFYVCSILALSAGVTYLVVRISPMKPAKRQPDKT
Ga0209023_1061571223300027870Freshwater And SedimentMRTVLGLLELVFYVCSILALSAGVTYLVVKISPMKSAKRQPDKT
Ga0209254_1009129223300027897Freshwater Lake SedimentMETVLGLIELALYVVGILALSAAITYAVVRISPAKSAKRQPDKT
Ga0209048_1002699823300027902Freshwater Lake SedimentMDTVFGLLELAFYVVAILALSAAVTFLVVRVSPSSSKKPKAEKA
Ga0210366_1007012523300028420EstuarineVDTILGLVELAAYVLAILALSAATTLAVIKISPAQSAKKPKQSDSS
Ga0302263_1038903923300028869FenMDTVLGLIELAFYVVSILVLSATITYLVVKFSPSNSKKRKAEKA
Ga0311332_1093581323300029984FenMQTVLGLLELTFYVLAILGLSAGVTFAVVKISPTKTAKPQSDKS
Ga0311333_1015755613300030114FenMDTVLGLIELAFYVVSILVLSATITYLVVKISPSNSKKAKAEKA
Ga0311333_1084339213300030114FenMDTVLGLIELAFYVVSILVLSATITYLVVKISPSNSKKRKAEKA
Ga0311349_1118110013300030294FenMPVVYARMQTVLGLLELTFYVLAILGLSAGVTFAVVKISPTKTA
Ga0311349_1156668523300030294FenGLIELAFYVVSILVLSATITYLVVKISPSNSKKRKAEKA
Ga0307497_1040654123300031226SoilMPVVYARMQTVLGLVELTFYVAGILLLSAGVTYAVVKISPTKTSKPQADKG
Ga0315290_1001623073300031834SedimentMHTIFGLAELTFYVCSILGLSAAVTYAVVRISPSQSAKQSSDKA
Ga0315290_1002526863300031834SedimentMQTVLGLIELALYVISILTLSAAVTYAVVKISPAKSAKRQPDKV
Ga0315290_1007870633300031834SedimentMQTVLGLIELALYVISILTLSAAVTYGVVKISPAKSAKRQPDKT
Ga0315290_1015864223300031834SedimentMRTVFGLIELAFYVASILTLSAAVTWAVVKISPTKTAQRQTDKA
Ga0315290_1020305323300031834SedimentMKTVLGLLELAFYVVSILTLSAAVTFAVVKISPMKPAKRQTDKT
Ga0315290_1022398223300031834SedimentMQTVFGLIELVFYVASILTLSAAVTYAVVKISPTKTAKRQTDKA
Ga0315290_1056951023300031834SedimentMQTVLGLIELAFYVVSILTLSAAVTYAVVKISPTKTAKRQADKA
Ga0315290_1058157923300031834SedimentMRTVLGLVELVFYVASILTLSAAVTWAVVKISPTKTAKPQPDKA
Ga0315290_1068303623300031834SedimentTIFGLAELTFYVCSILGLSAAVTYAVVRISPSQSAKQSTDKA
Ga0315280_1018001123300031862SedimentMQTVLGLIELTFYVVSILTLSAAVTYAVVKISPTKTAKRQADKA
Ga0315297_1031775023300031873SedimentMPVVYVRMQTVLGLLELAFYVISILTLSAAVTFAVVKISPAKSAKRQPDKT
Ga0315297_1063148723300031873SedimentMQTVFGLIELVFYVVSILSLSAAVTYAVVKISPTKTAQRRADKA
Ga0315297_1164209513300031873SedimentMQTVLGLIELALYVISILTLSAAVTYAVVKISPAKSAKRQPDKT
Ga0302322_10155545723300031902FenMRTVLGLIELVFYVLSILTLSAAVTWTVVKISPTKTAKRQPDKA
Ga0311367_1017738133300031918FenMPVVYARMQTVLGLLELTFYVLAILGLSAGVTFAVVKISPTKTAKPQSDKS
Ga0315278_1003960123300031997SedimentMPVVYARMQTVLGLLELAFYVISILTLSAAVTYAVVKISPAKSAKRQPDKV
Ga0315278_1084372923300031997SedimentMQTVLGLLELAFYVISILTLSAAVTYAVVKISPAKSAKRQPDKA
Ga0315278_1124920713300031997SedimentMRTVLGLLELVFYVCSILALSAGVTYLVVKISPMKPAKRQPDKT
Ga0315272_1026533923300032018SedimentMHTILGLLELAFYVISILTLSAAVTYAVVKISPAKSAKRQPDKV
Ga0315272_1035217523300032018SedimentMQTVLGLIELAFYVVSILTLSAAVTYAVVKISPTKTAKRQTDKA
Ga0315272_1058111123300032018SedimentMRTVLGLLELAFYVCSILALSAGVTFLVVKISPTKTAKQQPDKT
Ga0315292_1015448523300032143SedimentMQTVLGLLELAFYVISILTLSAAVTYAVVKISPAKSAKRQPDKT
Ga0315292_1031140923300032143SedimentMQTVLGLIELAFYVISILTLSAAVTYAVVKISPAKSAKRQPDES
Ga0315292_1165836623300032143SedimentMQTVFGLIELVFYVASILTLSAAVTYAVVKISPTKTAQRQTDKA
Ga0315281_1004630173300032163SedimentMHTFFGLAELTFYVCSILGLSAAVTYAVVRISPSQSAKQSADKA
Ga0315283_1039386723300032164SedimentPAAHRYPTSRMHTIFGLAELTFYVCSILGLSAAVTYAVVRISPSQSAKQSTDKA
Ga0315283_1206184523300032164SedimentMETVLGLIELTLYVVGILTLSAAVTYAVVRISPAKSTKRQPDKT
Ga0315283_1229075723300032164SedimentMRTVLGLVELVFYVCSILALSAGVTYLVVKISPLKSAKRQPDKT
Ga0315268_1107356523300032173SedimentMDTVLGLIELAFYVVSILALSATITFVVVKISPSNSKKAKAEKA
Ga0315268_1189389323300032173SedimentMHTFFGLAELAFYVCSILGLSAAVTYAVVRISPSQSAKQSADKT
Ga0315276_1218336913300032177SedimentTVFGLIELVFYVASILTLSAAVTYAVVKISPTKTAKRQTDKA
Ga0315271_1094242923300032256SedimentMPVVYARMQTVLGLLELAFYVISILTLSAAVTYAVVKISPAKSAKRQPDKT
Ga0315271_1112719113300032256SedimentMDTVLGLIELAFYVVSILVLSATVTYVVVRFSPSRLRKARAEKA
Ga0315270_1013796713300032275SedimentMQTVLGLIELTFYVVSILTLSAAVTYAVVKISPTKTAKRQTDKA
Ga0315270_1028934623300032275SedimentMRTVFGLIELVFYVASILTLSAAVTYAVVKISPTKTAQRQTDKA
Ga0315270_1032226713300032275SedimentMHTIFGLAELTFYVCSILGLSAAVTYAVVRISPSQSAKQ
Ga0315270_1099500823300032275SedimentMPVVYARMQTVLGLLELAFYVISILTLSAAVTYAVVKISPAKSAKRQPDKA
Ga0315287_1117087923300032397SedimentMQTVLGLLELAFYVISILTLSAAVTYAVVKISPAKSAKRQP
Ga0315273_1110892323300032516SedimentTCGMQTVLGLIELALYVISILTLSAAVTYAVVKISPAKSAKRQPDKT
Ga0315273_1239595323300032516SedimentMQTAFGLIELVFYVVSILSLSAAVTWAVVKISPTKTAQRQTDKA
Ga0316605_1105998323300033408SoilMDTILGLLELALYVCTILALSAAVTYAVVRISPSQSAKQSAGKS
Ga0370498_115562_498_6323300034155Untreated Peat SoilMETVLGLLELALYVVGILSLSAAVTYAVVRISPAKSAKRQPDKA

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.