NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F098635

Metagenome Family F098635

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F098635
Family Type Metagenome
Number of Sequences 103
Average Sequence Length 43 residues
Representative Sequence ETKTHAKASGAAKKAVNVAIQYNVWCGGTVHTKTQFTK
Number of Associated Samples 72
Number of Associated Scaffolds 103

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Viruses
% of genes with valid RBS motifs 0.00 %
% of genes near scaffold ends (potentially truncated) 96.12 %
% of genes from short scaffolds (< 2000 bps) 82.52 %
Associated GOLD sequencing projects 70
AlphaFold2 3D model prediction Yes
3D model pTM-score0.37

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Duplodnaviria (82.524 % of family members)
NCBI Taxonomy ID 2731341
Taxonomy All Organisms → Viruses → Duplodnaviria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake
(42.718 % of family members)
Environment Ontology (ENVO) Unclassified
(73.786 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Water (non-saline)
(73.786 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 34.85%    β-sheet: 0.00%    Coil/Unstructured: 65.15%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.37
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 103 Family Scaffolds
PF12728HTH_17 3.88
PF12705PDDEXK_1 2.91
PF02467Whib 0.97
PF01930Cas_Cas4 0.97

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 103 Family Scaffolds
COG1468CRISPR/Cas system-associated exonuclease Cas4, RecB familyDefense mechanisms [V] 0.97


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms100.00 %
UnclassifiedrootN/A0.00 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300003277|JGI25908J49247_10000950All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage9087Open in IMG/M
3300003277|JGI25908J49247_10078104All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C440820Open in IMG/M
3300003277|JGI25908J49247_10171227All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C440502Open in IMG/M
3300003388|JGI25910J50241_10112932All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage736Open in IMG/M
3300003404|JGI25920J50251_10064950All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage915Open in IMG/M
3300003411|JGI25911J50253_10011040All Organisms → Viruses → Predicted Viral3424Open in IMG/M
3300005517|Ga0070374_10386304All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage705Open in IMG/M
3300005580|Ga0049083_10145122All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage815Open in IMG/M
3300005805|Ga0079957_1046013All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2715Open in IMG/M
3300008111|Ga0114344_1125969All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage902Open in IMG/M
3300008114|Ga0114347_1095100All Organisms → Viruses → Predicted Viral1164Open in IMG/M
3300008116|Ga0114350_1194496All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage507Open in IMG/M
3300008259|Ga0114841_1126985All Organisms → Viruses → Predicted Viral1055Open in IMG/M
3300008448|Ga0114876_1173189All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes761Open in IMG/M
3300009159|Ga0114978_10579141All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage651Open in IMG/M
3300009165|Ga0105102_10310231All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage819Open in IMG/M
3300009181|Ga0114969_10040696All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage3156Open in IMG/M
3300009183|Ga0114974_10791579All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C440509Open in IMG/M
3300010354|Ga0129333_10636442All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C440922Open in IMG/M
3300010885|Ga0133913_12188249All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C4401364Open in IMG/M
3300011010|Ga0139557_1008337All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2091Open in IMG/M
3300011010|Ga0139557_1023314All Organisms → Viruses → Predicted Viral1121Open in IMG/M
3300011010|Ga0139557_1084259All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage528Open in IMG/M
3300011010|Ga0139557_1087148All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage518Open in IMG/M
(restricted) 3300013126|Ga0172367_10234672All Organisms → Viruses → Predicted Viral1126Open in IMG/M
3300013372|Ga0177922_11052516All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage544Open in IMG/M
(restricted) 3300014720|Ga0172376_10294415All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage973Open in IMG/M
3300017701|Ga0181364_1006172All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2065Open in IMG/M
3300017701|Ga0181364_1037885All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage773Open in IMG/M
3300017722|Ga0181347_1017345All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2293Open in IMG/M
3300017722|Ga0181347_1156950All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C440618Open in IMG/M
3300017723|Ga0181362_1008120All Organisms → Viruses → Predicted Viral2249Open in IMG/M
3300017723|Ga0181362_1019365All Organisms → Viruses → Predicted Viral1462Open in IMG/M
3300017723|Ga0181362_1125247All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage502Open in IMG/M
3300017736|Ga0181365_1000611All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage8137Open in IMG/M
3300017736|Ga0181365_1074486All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Alteromonadales → Pseudoalteromonadaceae → Pseudoalteromonas → unclassified Pseudoalteromonas → Pseudoalteromonas sp. TMED43835Open in IMG/M
3300017761|Ga0181356_1061085All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C4401281Open in IMG/M
3300017761|Ga0181356_1156771All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C440702Open in IMG/M
3300017774|Ga0181358_1049708All Organisms → Viruses → Predicted Viral1590Open in IMG/M
3300017774|Ga0181358_1093212All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Alteromonadales → Pseudoalteromonadaceae → Pseudoalteromonas → unclassified Pseudoalteromonas → Pseudoalteromonas sp. TMED431087Open in IMG/M
3300017774|Ga0181358_1138595All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C440840Open in IMG/M
3300017777|Ga0181357_1003741All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C4406135Open in IMG/M
3300017777|Ga0181357_1007796All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C4404286Open in IMG/M
3300017777|Ga0181357_1013535All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes3250Open in IMG/M
3300017777|Ga0181357_1093732All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1142Open in IMG/M
3300017777|Ga0181357_1279824All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C440572Open in IMG/M
3300017778|Ga0181349_1041813All Organisms → Viruses → Predicted Viral1816Open in IMG/M
3300017778|Ga0181349_1151315All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage834Open in IMG/M
3300017780|Ga0181346_1051946All Organisms → Viruses → Predicted Viral1657Open in IMG/M
3300017780|Ga0181346_1105746All Organisms → Viruses → Predicted Viral1089Open in IMG/M
3300017780|Ga0181346_1275996All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C440578Open in IMG/M
3300017785|Ga0181355_1280267All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage632Open in IMG/M
3300017785|Ga0181355_1367866All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage525Open in IMG/M
3300017785|Ga0181355_1396773All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C440500Open in IMG/M
3300018868|Ga0187844_10351629All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage608Open in IMG/M
3300019784|Ga0181359_1036290All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1910Open in IMG/M
3300020172|Ga0211729_10138708All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage844Open in IMG/M
3300020542|Ga0208857_1038832All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage747Open in IMG/M
3300021424|Ga0194117_10552784All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage507Open in IMG/M
3300021962|Ga0222713_10817885All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C440518Open in IMG/M
3300022407|Ga0181351_1189178All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage700Open in IMG/M
3300023179|Ga0214923_10371487All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage745Open in IMG/M
3300027141|Ga0255076_1058563All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage649Open in IMG/M
3300027153|Ga0255083_1063023All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage716Open in IMG/M
3300027563|Ga0209552_1119175All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C440696Open in IMG/M
3300027608|Ga0208974_1063315All Organisms → Viruses → Predicted Viral1038Open in IMG/M
3300027621|Ga0208951_1174525All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C440548Open in IMG/M
3300027679|Ga0209769_1258612All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C440528Open in IMG/M
3300027720|Ga0209617_10381611All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage516Open in IMG/M
(restricted) 3300027730|Ga0247833_1168206All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage856Open in IMG/M
3300027785|Ga0209246_10017032All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2710Open in IMG/M
3300027785|Ga0209246_10038475All Organisms → Viruses → Predicted Viral1831Open in IMG/M
3300027785|Ga0209246_10363917All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage548Open in IMG/M
3300027798|Ga0209353_10028223All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage2616Open in IMG/M
3300027798|Ga0209353_10110156All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1240Open in IMG/M
3300027808|Ga0209354_10092290All Organisms → Viruses → Predicted Viral1234Open in IMG/M
3300027956|Ga0209820_1186454All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage578Open in IMG/M
3300028392|Ga0304729_1047590All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1628Open in IMG/M
3300028393|Ga0304728_1129675All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C440935Open in IMG/M
(restricted) 3300028557|Ga0247832_1179346All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage779Open in IMG/M
3300031746|Ga0315293_10303334All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C4401281Open in IMG/M
3300031772|Ga0315288_10955822All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage769Open in IMG/M
3300031857|Ga0315909_10629607All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage710Open in IMG/M
3300031857|Ga0315909_10848470All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C440570Open in IMG/M
3300031951|Ga0315904_10386212All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C4401274Open in IMG/M
3300031951|Ga0315904_10652267All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C440894Open in IMG/M
3300031997|Ga0315278_11779426All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage583Open in IMG/M
3300032050|Ga0315906_10015107All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage8773Open in IMG/M
3300032116|Ga0315903_10022643All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage6922Open in IMG/M
3300032116|Ga0315903_10037653All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage5076Open in IMG/M
3300032116|Ga0315903_10627104All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage819Open in IMG/M
3300032116|Ga0315903_11068153All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C440557Open in IMG/M
3300032397|Ga0315287_12564081All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage546Open in IMG/M
3300033816|Ga0334980_0063577All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1552Open in IMG/M
3300033994|Ga0334996_0097016All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1724Open in IMG/M
3300034012|Ga0334986_0567796All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C440545Open in IMG/M
3300034092|Ga0335010_0414508All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage732Open in IMG/M
3300034101|Ga0335027_0111978All Organisms → Viruses → Predicted Viral2062Open in IMG/M
3300034104|Ga0335031_0254971All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1161Open in IMG/M
3300034106|Ga0335036_0221515All Organisms → Viruses → Predicted Viral1298Open in IMG/M
3300034112|Ga0335066_0712159All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage506Open in IMG/M
3300034122|Ga0335060_0372256All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage762Open in IMG/M
3300034122|Ga0335060_0513994All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage615Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake42.72%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater14.56%
FreshwaterEnvironmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater8.74%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake5.83%
Freshwater, PlanktonEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton3.88%
SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Sediment3.88%
FreshwaterEnvironmental → Aquatic → Freshwater → Ice → Unclassified → Freshwater3.88%
Freshwater LenticEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic2.91%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater2.91%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment1.94%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake1.94%
FreshwaterEnvironmental → Aquatic → Freshwater → River → Unclassified → Freshwater1.94%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater0.97%
Freshwater And SedimentEnvironmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater And Sediment0.97%
LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Lake0.97%
Freshwater To Marine Saline GradientEnvironmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient0.97%
Estuarine WaterEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water0.97%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
3300003277Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SDEnvironmentalOpen in IMG/M
3300003388Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.SNEnvironmentalOpen in IMG/M
3300003404Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM110.DCMDEnvironmentalOpen in IMG/M
3300003411Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.SDEnvironmentalOpen in IMG/M
3300005517Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (version 4)EnvironmentalOpen in IMG/M
3300005580Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG MI27MSRFEnvironmentalOpen in IMG/M
3300005805Microbial and algae communities from Cheney Reservoir in Wichita, Kansas, USAEnvironmentalOpen in IMG/M
3300008111Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-C-NAEnvironmentalOpen in IMG/M
3300008114Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-C-NAEnvironmentalOpen in IMG/M
3300008116Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-3-NAEnvironmentalOpen in IMG/M
3300008259Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0132-C-NAEnvironmentalOpen in IMG/M
3300008448Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - August 4, 2014 all contigsEnvironmentalOpen in IMG/M
3300009159Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaGEnvironmentalOpen in IMG/M
3300009165Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 1-3cm September2015EnvironmentalOpen in IMG/M
3300009181Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaGEnvironmentalOpen in IMG/M
3300009183Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaGEnvironmentalOpen in IMG/M
3300010354Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNAEnvironmentalOpen in IMG/M
3300010885northern Canada Lakes Co-assemblyEnvironmentalOpen in IMG/M
3300011010Freshwater microbial communities from Western Basin Lake Erie, Ontario, Canada - Station 970 - Surface IceEnvironmentalOpen in IMG/M
3300013126 (restricted)Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_022012_10mEnvironmentalOpen in IMG/M
3300013372Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPsEnvironmentalOpen in IMG/M
3300014720 (restricted)Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_35mEnvironmentalOpen in IMG/M
3300017701Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.S.NEnvironmentalOpen in IMG/M
3300017722Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.NEnvironmentalOpen in IMG/M
3300017723Freshwater viral communities from Lake Michigan, USA - Su13.ND.MM110.S.NEnvironmentalOpen in IMG/M
3300017736Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.D.NEnvironmentalOpen in IMG/M
3300017761Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.NEnvironmentalOpen in IMG/M
3300017774Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.DEnvironmentalOpen in IMG/M
3300017777Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.D.NEnvironmentalOpen in IMG/M
3300017778Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.DEnvironmentalOpen in IMG/M
3300017780Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.D.NEnvironmentalOpen in IMG/M
3300017785Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.D.NEnvironmentalOpen in IMG/M
3300018868Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - SP09_SKY_50EnvironmentalOpen in IMG/M
3300019784Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.DEnvironmentalOpen in IMG/M
3300020172Freshwater lake microbial communities from Lake Erken, Sweden - P4710_102 megahit1EnvironmentalOpen in IMG/M
3300020542Freshwater microbial communities from Lake Mendota, WI - 05NOV2012 deep hole epilimnion (SPAdes)EnvironmentalOpen in IMG/M
3300021424Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015009 Mahale N1 surfaceEnvironmentalOpen in IMG/M
3300021962Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649DEnvironmentalOpen in IMG/M
3300022407Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.S.DEnvironmentalOpen in IMG/M
3300023179Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1510EnvironmentalOpen in IMG/M
3300027141Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Law_RepB_8hEnvironmentalOpen in IMG/M
3300027153Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Colum_RepC_8hEnvironmentalOpen in IMG/M
3300027563Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.SD (SPAdes)EnvironmentalOpen in IMG/M
3300027608Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF (SPAdes)EnvironmentalOpen in IMG/M
3300027621Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG MI27MSRF (SPAdes)EnvironmentalOpen in IMG/M
3300027679Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.DN (SPAdes)EnvironmentalOpen in IMG/M
3300027720Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB epilimnion July 2011 (SPAdes)EnvironmentalOpen in IMG/M
3300027730 (restricted)Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_8mEnvironmentalOpen in IMG/M
3300027785Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SN (SPAdes)EnvironmentalOpen in IMG/M
3300027798Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD (SPAdes)EnvironmentalOpen in IMG/M
3300027808Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.DD (SPAdes)EnvironmentalOpen in IMG/M
3300027956Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm May2015 (SPAdes)EnvironmentalOpen in IMG/M
3300028392Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_MF_MetaG (v2)EnvironmentalOpen in IMG/M
3300028393Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_MF_MetaG (v2)EnvironmentalOpen in IMG/M
3300028557 (restricted)Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_4mEnvironmentalOpen in IMG/M
3300031746Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_20EnvironmentalOpen in IMG/M
3300031772Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_20EnvironmentalOpen in IMG/M
3300031857Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125EnvironmentalOpen in IMG/M
3300031951Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA120EnvironmentalOpen in IMG/M
3300031997Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G06_0EnvironmentalOpen in IMG/M
3300032050Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA122EnvironmentalOpen in IMG/M
3300032116Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA119EnvironmentalOpen in IMG/M
3300032397Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_0EnvironmentalOpen in IMG/M
3300033816Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME16Sep2004-rr0005EnvironmentalOpen in IMG/M
3300033994Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME25Jul2006D11-rr0046EnvironmentalOpen in IMG/M
3300034012Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Aug2017-rr0027EnvironmentalOpen in IMG/M
3300034092Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Aug2012-rr0069EnvironmentalOpen in IMG/M
3300034101Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME19Sep2005-rr0107EnvironmentalOpen in IMG/M
3300034104Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Aug2005-rr0120EnvironmentalOpen in IMG/M
3300034106Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23Aug2013-rr0131EnvironmentalOpen in IMG/M
3300034112Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Aug2014-rr0191EnvironmentalOpen in IMG/M
3300034122Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Aug2014-rr0181EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
JGI25908J49247_1000095053300003277Freshwater LakeMMETETKTHAKASGAAKKAVHVAIQYNVWCGGPVYTKTQFTK*
JGI25908J49247_1007810413300003277Freshwater LakeLALGAIATMENEIKTHAKATSAAKKAIAIAIQYNIWCGGSINVKTQFTK*
JGI25908J49247_1017122723300003277Freshwater LakeLAMMETETKTHAKASGAAKKAINVAVQYNVWCGGPVHTKTQFTK*
JGI25910J50241_1011293233300003388Freshwater LakeETEVKTHAKATSAAKKAVNIAIQYNIWCGGTANVKTQFTK*
JGI25920J50251_1006495013300003404Freshwater LakeGLALGALAMMEXETKTHAKASGAAKKAVHVAIQYNIWCGGPVHTKTQFTK*
JGI25911J50253_1001104083300003411Freshwater LakeTETITHTKATSAAKKAINIAIQYNVWCGGTPSIKTQFTK*
Ga0070374_1038630413300005517Freshwater LakeTHAKASGAAKKAVNVAIQYNVWCGGPDHTKTQFTK*
Ga0049083_1014512213300005580Freshwater LenticETKTHAKASGAAKKAVHVAIQYNVWCGGPVYTKTQFTK*
Ga0079957_104601313300005805LakeLGALAALESETKTHAKASGAAKKAINIAIQYNVWCGGTATVKTQFTK*
Ga0114344_112596913300008111Freshwater, PlanktonDTKTHAKAASAAKKAINIAIQYNIWCGGTVSIKTQFTK*
Ga0114347_109510013300008114Freshwater, PlanktonAMESETKTHAKASSAAKKAVNIAIQYNVWCGGAVNVKTQFTK*
Ga0114350_119449633300008116Freshwater, PlanktonKTHAKASSAAKKAINIAIQYNIWCGGTVSVKTQFTK*
Ga0114841_112698533300008259Freshwater, PlanktonGALSAMESETKTHAKASGAAKKAINIAIQYNVWCGGTANVKTQFTK*
Ga0114876_117318913300008448Freshwater LakeALVALDGDTKTHAKASSAAKKAINIAIQYNIWCGGTVSVKTQFTK*
Ga0114978_1057914123300009159Freshwater LakeDAETKTHTKATSAAKKAVNIAIQYNVWCGGTPSIKTQFTK*
Ga0105102_1031023113300009165Freshwater SedimentTETRTHAKAASAAKKAINIAIQYNVWCGGVANIKTQFTK*
Ga0114969_1004069633300009181Freshwater LakeLGALVSMETETKTHARATGAAKKAINIAIQYNIWCGGTANIKTQFTK*
Ga0114974_1079157913300009183Freshwater LakeMMETETKTHAKASGAAKKAVNIAIQYNVWCGGPVHTKTQFTK*
Ga0129333_1063644243300010354Freshwater To Marine Saline GradientALGALAAMDMERRTHAKAASAAKKAVNIAIQYNVWCGGTANVKTQFTK*
Ga0133913_1218824933300010885Freshwater LakeLASMEIETKTHAKATSAAKKAIGVAIQYNIWCGGTINIKTQFTK*
Ga0139557_100833713300011010FreshwaterLALGALAMMETETKTHAKASGAAKKAVNVAIQYNVWCGGPVHTKTQFTK*
Ga0139557_102331433300011010FreshwaterTHAKASGAAKKAVHVAIQYNVWCGGPVYTKTQFTK*
Ga0139557_108425913300011010FreshwaterLALGALAMMETETKTHAKASGAAKKAVHVAIQYNIWCGGPVHTKTQFTK*
Ga0139557_108714823300011010FreshwaterLALGALAMMETETKTHAKASGAAKKAVHVAIQYNVWCGGTVHVKTQFTK*
(restricted) Ga0172367_1023467213300013126FreshwaterHAKASAAAKKAINISIEYNVWCGGTANVKTQFTK*
Ga0177922_1105251623300013372FreshwaterGLALGALAMMETETKTHAKASGAAKKAVNVAIQYNIWCGGPVYTKTQFTK*
(restricted) Ga0172376_1029441513300014720FreshwaterTRTHAKAASAAKKAINIAIQYNVWCGGTASVKTQFTK*
Ga0181364_100617233300017701Freshwater LakeTLCALAMMETETKTHAKASGAAKKAINVAIQYNVWCGGPVHTKTQFTK
Ga0181364_103788513300017701Freshwater LakeLGALSAMEIETKTHAKASSAAKKAVSIAIQYNIWCGGPVHTKTQFTK
Ga0181347_101734513300017722Freshwater LakeETKTHAKASGAAKKAVHVAIQYNIWCGGPVHTKTQFTK
Ga0181347_115695033300017722Freshwater LakeETKTHAKATSAAKKAVTVAIQYNVWCGGPIHIKTQFTK
Ga0181362_100812033300017723Freshwater LakeLGALAMMETETKTHAKASGAAKKAVHVAIQYNVWCGGPVHVKTQFTK
Ga0181362_101936513300017723Freshwater LakeGLALGALAMMETETKTHAKASGAAKKAVHVAIQYNVWCGGPVHVKTQFTK
Ga0181362_112524723300017723Freshwater LakeLALGALAIMENEVKTHAKATSAAKKAVNIAIQYNVWCGGTASVKTQFTK
Ga0181365_100061153300017736Freshwater LakeMEIETKTHAKASGAAKKAVHVAIQYNIWCGGPVHTKTQFTK
Ga0181365_107448633300017736Freshwater LakeKKGAHAKATAAAKKAINIAIQYNIWCGGTVNVKTQFTK
Ga0181356_106108513300017761Freshwater LakeTKTHAKASGAAKKAVNVAIQYNVWCGGPVYTKTQFTK
Ga0181356_115677113300017761Freshwater LakeMEIETKTHTKATSAAKKAVNIAIQYNVWCGGTPSIKTQFTK
Ga0181358_104970813300017774Freshwater LakeETETKTHAKASGAAKKAVHVAIQYNVWCGGTIHTKTQFTK
Ga0181358_109321213300017774Freshwater LakeKTHAKASGAAKKAVHVANQYNVWCGGPVYTKTQFTK
Ga0181358_113859513300017774Freshwater LakeGALAAMDMERRTHAKATSVAKKAINIAIQYNIWCGGTANIKTQFTK
Ga0181357_100374153300017777Freshwater LakeALGALAMMETETKTHAKASGAAKKAINVAVQYNVWCGGPVHTKTQFTK
Ga0181357_100779613300017777Freshwater LakeTKTHAKATSAAKKAINIAIQYNVWCGGTVNIKTQFTK
Ga0181357_101353513300017777Freshwater LakeETKTHAKASGAAKKAVNVAIQYNVWCGGTVHTKTQFTK
Ga0181357_109373213300017777Freshwater LakeGLALGALAMMETETKTHAKASGAAKKAVHVAIQYNVWCGGPVYTKTQFTK
Ga0181357_127982423300017777Freshwater LakeENEIKTHAKATSAAKKAIAIAIQYNIWCGGSINVKTQFTK
Ga0181349_104181333300017778Freshwater LakeGALAMMETETKTHAKASGAAKKAVHVAIQYNVWCGGPVYTKTQFTK
Ga0181349_115131513300017778Freshwater LakeKTHAKASGAAKKAVNVAIQYNVWCGGPVHTKTQFTK
Ga0181346_105194613300017780Freshwater LakeGTLALGALVALESETKTHAKASGAAKKAINIAIEYNVWCGGTATVKTQFTK
Ga0181346_110574613300017780Freshwater LakeIETETKTHAKASGAAKKAVHVAIQYNVWCGGTIHTKTQFTK
Ga0181346_127599623300017780Freshwater LakeGGLALGALAMMEVETKTHAKASGAAKKAVHVAIQYNIWCGGPVHTKTQFTK
Ga0181355_128026733300017785Freshwater LakeDTKTHAKAASAAKKAINIAIQYNIWCGGTVSIKTQFTK
Ga0181355_136786623300017785Freshwater LakeLGALAVIEIETKTHAKASGAAKKAVNVAIQYNVWCGGTVHTKTQFTK
Ga0181355_139677313300017785Freshwater LakeGGGLALGALAMMETETKTHAKASGAAKKAVHVAIQYNVWCGGPVHVKTQFTK
Ga0187844_1035162933300018868FreshwaterKTHAKATSAAKKAINVAIQYNIWCGGTANIKTQFTK
Ga0181359_103629013300019784Freshwater LakeIKTHAKATSAAKKAVNIAIQYNVWCGGTASVKTQFTK
Ga0211729_1013870833300020172FreshwaterLAMGALVALDNDTKTHAKATSAAKKAINIAIQYNIWCGGTVSVKTQFTK
Ga0208857_103883213300020542FreshwaterTHTKATSAAKKAVNIAIAYNVWCGGTPSIKTQFTK
Ga0194117_1055278423300021424Freshwater LakeLTRHARAASVAKKAINIAIQYNVWCGGTPNIKTQFRK
Ga0222713_1081788513300021962Estuarine WaterKTHAKASSAAKKAVNAAIQYNIWCGGPVNVKTQFTK
Ga0181351_118917833300022407Freshwater LakeVETKTHAKASGAAKKAVNVAIQYNVWCGGPVHTKTQFTK
Ga0214923_1037148733300023179FreshwaterETKTHAKASSAAKKAVNIAIQYNVWCGGAVNVKTQFTK
Ga0255076_105856333300027141FreshwaterSLGALVALDNDTKTHAKATSAAKKAINIAIQYNIWCGGTVSVKTQFTK
Ga0255083_106302333300027153FreshwaterLVALDNDTKTHAKATSAAKKAINIAIQYNIWCGGTVSVKTQFTK
Ga0209552_111917533300027563Freshwater LakeMMETETKTHAKASGAAKKAVHVAIQYNVWCGGPVYTKTQFTK
Ga0208974_106331543300027608Freshwater LenticMENEVKTHAKATSAAKKAVNIAIQYNVWCGGTASVKTQFTK
Ga0208951_117452513300027621Freshwater LenticALGALAMMEVETKTHAKASGAAKKAVHVAIQYNIWCGGPVHTKTQFTK
Ga0209769_125861213300027679Freshwater LakeMEVETKTHAKASGAAKKAVHVAIQYNIWCGGPVHTKTQFTK
Ga0209617_1038161123300027720Freshwater And SedimentTKTHAKASGAVKKAVHVAIQYNVWCGGPVHVKTQFTK
(restricted) Ga0247833_116820643300027730FreshwaterDTKTHAKASSAAKKAINIAIQYNIWCGGTVSVRTQFTK
Ga0209246_1001703213300027785Freshwater LakeAMMETETKTHAKASGAAKKAINVAIQYNVWCGGPVHTKTQFTK
Ga0209246_1003847533300027785Freshwater LakeEIKTHAKATSAAKKAIAVAIQYNIWCGGTINVKTQFTK
Ga0209246_1036391723300027785Freshwater LakeLGALAMMETETKTHAKASGAAKKAVNVAIQYNVWCGGPVYTKTQFTK
Ga0209353_1002822313300027798Freshwater LakeMMETETKTHAKASGAAKKAVHVAIQYNVWCGGTVHVKTQFTK
Ga0209353_1011015633300027798Freshwater LakeVETKTHAKASGAAKKAVHVAIQYNIWCGGPVHTKTQFTK
Ga0209354_1009229013300027808Freshwater LakeGGLALGALAMMEVEIKTHAKASGAAKKAVNVAIQYNVWCGGPVHTKTQFTK
Ga0209820_118645423300027956Freshwater SedimentTHAKAASAAKKAINIAIQYNVWCGGTPSIKTQFTK
Ga0304729_104759033300028392Freshwater LakeLGALVSMEIETKTHARATGAAKKAINVAIQYNIWCGGTANIKTQFTK
Ga0304728_112967533300028393Freshwater LakeLALGALASMEIETKTHAKATSAAKKAIGVAIQYNIWCGGTINIKTQFTK
(restricted) Ga0247832_117934613300028557FreshwaterLAMGALVALDGDTKTHAKASSAAKKAINIAIQYNIWCGGTVSVRTQFTK
Ga0315293_1030333413300031746SedimentLALGALAMMETETKTHAKASGAAKKAVNIAIQYNVWCGGPVHTKTQFTK
Ga0315288_1095582233300031772SedimentLGALAMMETETKTHAKASGAAKKAVNVAIQYNVWCGGPVHTKTQFTK
Ga0315909_1062960713300031857FreshwaterALENDTKTHTKATGAAKKAINIAIQYNVWCGGTASIKTQFTK
Ga0315909_1084847043300031857FreshwaterLDGDTKTHAKASSAAKKAINIAIQYNIWCGGTVSVKTQFTK
Ga0315904_1038621243300031951FreshwaterIALGALASMDTEIKTHAKASSAAKKSINIAIQYNIWCGGTANVKTQFTK
Ga0315904_1065226713300031951FreshwaterGTLALGALAAMESEVKTHAKASGAVKKAINIAIEYNVWCGGTANIKTQFTK
Ga0315278_1177942613300031997SedimentLGALVAMDAETKTHTKATSAAKKAVNIAIQYNVWCGGTPSIKTQFTK
Ga0315906_1001510713300032050FreshwaterTHAKASGAVKKAINIAIEYNVWCGGTANIKTQFTK
Ga0315903_1002264313300032116FreshwaterALAAMESETRTHAKASSAAKKAVNIAIQYNVWCGGAVNVKTQFTK
Ga0315903_1003765313300032116FreshwaterLALGALAAMESEVKTHAKASGAVKKAINIAIEYNVWCGGTANIKTQFTK
Ga0315903_1062710413300032116FreshwaterLAAMESEVKTHAKASGAVKKAINIAIEYNVWCGGTANIKTQFTK
Ga0315903_1106815313300032116FreshwaterSMESEVKTHAKASGAAKKAINIAIEYNVWCGGTANVKTQFTK
Ga0315287_1256408123300032397SedimentALAMMEIEIKTHAKATGAAKKAVNIAIQYNVWCGGTVHTKTQFTK
Ga0334980_0063577_1439_15523300033816FreshwaterTKTHAKAASAAKKAINIAIQYNVWCGGTPSIKTQFTK
Ga0334996_0097016_2_1273300033994FreshwaterLESETKTHAKAASAAKKAINIAIQYNVWCGGTPSIKTQFTK
Ga0334986_0567796_391_5343300034012FreshwaterMGALVALDGDTKTHAKASSAAKKAINIAIQYNIWCGGTVSIKTQFTK
Ga0335010_0414508_3_1253300034092FreshwaterDGDTKTHAKASSAAKKAINIAIQYNIWCGGTVSVKTQFTK
Ga0335027_0111978_1917_20423300034101FreshwaterMESETKAHAKASGAAKKAINIAIQYNVWCGGTANVKTQFTK
Ga0335031_0254971_1027_11523300034104FreshwaterMELETKTHAKASSAAKKAVNIAIQYNIWCGGPVHIKTQFTK
Ga0335036_0221515_3_1463300034106FreshwaterLGALVALDNDTKTHAKAASAAKKAVNIAIQYNIWCGGTVSVKTQFTK
Ga0335066_0712159_1_1083300034112FreshwaterTHAKASGAAKKAINIAIQYNVWCGGTANVKTQFTK
Ga0335060_0372256_640_7623300034122FreshwaterELETKTHAKASGAAKKAINIAIQYNVWCGGTANVKTQFTK
Ga0335060_0513994_461_6133300034122FreshwaterTLALGALAALESETKTHAKASGAAKKAINIAIQYNVWCGGTATVKTQFTK


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.