NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F098201

Metagenome / Metatranscriptome Family F098201

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F098201
Family Type Metagenome / Metatranscriptome
Number of Sequences 104
Average Sequence Length 112 residues
Representative Sequence MEDIWDSVWDFIKMLFYIVIGASVRIMHYAKNNTVNKKRVIITFTFAVFVGVIVNHLLIIKGLQQWSGIAVSIAALLGESFVSYLLTNSNNIFRTFINSIFKVDVENEDKKDEK
Number of Associated Samples 79
Number of Associated Scaffolds 104

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Unclassified
% of genes with valid RBS motifs 34.62 %
% of genes near scaffold ends (potentially truncated) 19.23 %
% of genes from short scaffolds (< 2000 bps) 56.73 %
Associated GOLD sequencing projects 71
AlphaFold2 3D model prediction Yes
3D model pTM-score0.36

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Unclassified (50.962 % of family members)
NCBI Taxonomy ID N/A
Taxonomy N/A

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous
(26.923 % of family members)
Environment Ontology (ENVO) Unclassified
(61.538 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(77.885 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Transmembrane (alpha-helical) Signal Peptide: No Secondary Structure distribution: α-helix: 61.27%    β-sheet: 0.00%    Coil/Unstructured: 38.73%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.36
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 104 Family Scaffolds
PF08291Peptidase_M15_3 16.35
PF09374PG_binding_3 13.46
PF00182Glyco_hydro_19 7.69
PF01391Collagen 3.85
PF01841Transglut_core 2.88
PF08433KTI12 1.92
PF12760Zn_Tnp_IS1595 1.92
PF04473DUF553 0.96
PF13385Laminin_G_3 0.96

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 104 Family Scaffolds
COG3179Chitinase, GH19 familyCarbohydrate transport and metabolism [G] 7.69
COG3979ChitodextrinaseCarbohydrate transport and metabolism [G] 7.69
COG4088tRNA uridine 5-carbamoylmethylation protein Kti12 (Killer toxin insensitivity protein)Translation, ribosomal structure and biogenesis [J] 1.92


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
UnclassifiedrootN/A50.96 %
All OrganismsrootAll Organisms49.04 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000128|SA_S1_NOR08_45mDRAFT_c10005837All Organisms → cellular organisms → Bacteria5777Open in IMG/M
3300000947|BBAY92_10003529All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → unclassified Pelagibacterales → Pelagibacterales bacterium4019Open in IMG/M
3300001460|JGI24003J15210_10023186Not Available2337Open in IMG/M
3300002143|M3t6FKB2_10212873Not Available2498Open in IMG/M
3300002488|JGI25128J35275_1072000All Organisms → cellular organisms → Bacteria718Open in IMG/M
3300003409|JGI26088J50261_1026594All Organisms → Viruses → Predicted Viral1321Open in IMG/M
3300003409|JGI26088J50261_1045248Not Available831Open in IMG/M
3300003410|JGI26086J50260_1006943All Organisms → cellular organisms → Bacteria4839Open in IMG/M
3300004097|Ga0055584_101747656Not Available641Open in IMG/M
3300004829|Ga0068515_100090All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Parvibaculaceae → Parvibaculum → unclassified Parvibaculum → Parvibaculum sp.14236Open in IMG/M
3300004829|Ga0068515_100174All Organisms → cellular organisms → Bacteria8921Open in IMG/M
3300004829|Ga0068515_100799All Organisms → cellular organisms → Bacteria4079Open in IMG/M
3300004829|Ga0068515_101358All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Parvibaculaceae → Parvibaculum → unclassified Parvibaculum → Parvibaculum sp.3144Open in IMG/M
3300004829|Ga0068515_116675Not Available919Open in IMG/M
3300004829|Ga0068515_120401Not Available828Open in IMG/M
3300004951|Ga0068513_1013131Not Available878Open in IMG/M
3300004951|Ga0068513_1019430Not Available726Open in IMG/M
3300004951|Ga0068513_1019479Not Available726Open in IMG/M
3300005828|Ga0074475_10375459All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage746Open in IMG/M
3300006802|Ga0070749_10007944All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria6931Open in IMG/M
3300006802|Ga0070749_10008106All Organisms → cellular organisms → Bacteria6862Open in IMG/M
3300006802|Ga0070749_10444049Not Available711Open in IMG/M
3300006803|Ga0075467_10325067Not Available814Open in IMG/M
3300006810|Ga0070754_10019185All Organisms → cellular organisms → Bacteria4040Open in IMG/M
3300006810|Ga0070754_10380655Not Available620Open in IMG/M
3300006920|Ga0070748_1007483Not Available4826Open in IMG/M
3300007346|Ga0070753_1079909Not Available1297Open in IMG/M
3300007538|Ga0099851_1029714All Organisms → Viruses → Predicted Viral2191Open in IMG/M
3300007538|Ga0099851_1054406Not Available1568Open in IMG/M
3300007540|Ga0099847_1000690All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Parvibaculaceae → Parvibaculum → unclassified Parvibaculum → Parvibaculum sp.11476Open in IMG/M
3300007540|Ga0099847_1002346All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Parvibaculaceae → Parvibaculum → unclassified Parvibaculum → Parvibaculum sp.6588Open in IMG/M
3300007540|Ga0099847_1036439Not Available1571Open in IMG/M
3300007542|Ga0099846_1083890Not Available1183Open in IMG/M
3300007542|Ga0099846_1099374Not Available1072Open in IMG/M
3300009606|Ga0115102_10779467Not Available817Open in IMG/M
3300011128|Ga0151669_105706All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → unclassified Pelagibacterales → Pelagibacterales bacterium5970Open in IMG/M
3300011245|Ga0151673_100590All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Parvibaculaceae → Parvibaculum → unclassified Parvibaculum → Parvibaculum sp.12324Open in IMG/M
3300011248|Ga0151670_1014220All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → unclassified Pelagibacterales → Pelagibacterales bacterium3773Open in IMG/M
3300011252|Ga0151674_1008652Not Available922Open in IMG/M
3300011258|Ga0151677_1023020All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → unclassified Pelagibacterales → Pelagibacterales bacterium5641Open in IMG/M
3300012516|Ga0129325_1296797Not Available641Open in IMG/M
3300014903|Ga0164321_10024659Not Available2056Open in IMG/M
3300017714|Ga0181412_1003281All Organisms → cellular organisms → Bacteria → Proteobacteria5644Open in IMG/M
3300017727|Ga0181401_1019161All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → unclassified Pelagibacterales → Pelagibacterales bacterium2056Open in IMG/M
3300017741|Ga0181421_1200126Not Available511Open in IMG/M
3300017742|Ga0181399_1002934All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria5583Open in IMG/M
3300017748|Ga0181393_1002423All Organisms → cellular organisms → Bacteria6439Open in IMG/M
3300017751|Ga0187219_1192073Not Available568Open in IMG/M
3300017752|Ga0181400_1078621All Organisms → cellular organisms → Bacteria988Open in IMG/M
3300017770|Ga0187217_1292818Not Available525Open in IMG/M
3300017782|Ga0181380_1144737Not Available811Open in IMG/M
3300018420|Ga0181563_10197705Not Available1228Open in IMG/M
3300021335|Ga0213867_1057574All Organisms → Viruses → Predicted Viral1469Open in IMG/M
3300021347|Ga0213862_10015657All Organisms → Viruses → Predicted Viral2879Open in IMG/M
3300021356|Ga0213858_10050731Not Available2008Open in IMG/M
3300021373|Ga0213865_10024385All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → unclassified Saprospirales → Saprospirales bacterium TMED2143409Open in IMG/M
3300021425|Ga0213866_10135802All Organisms → cellular organisms → Bacteria1314Open in IMG/M
3300021957|Ga0222717_10004488All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Parvibaculaceae → Parvibaculum → unclassified Parvibaculum → Parvibaculum sp.10277Open in IMG/M
3300021957|Ga0222717_10436987Not Available716Open in IMG/M
3300021960|Ga0222715_10695089Not Available513Open in IMG/M
3300022200|Ga0196901_1000838All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Parvibaculaceae → Parvibaculum → unclassified Parvibaculum → Parvibaculum sp.15794Open in IMG/M
3300022200|Ga0196901_1094990Not Available1046Open in IMG/M
3300022200|Ga0196901_1120093Not Available899Open in IMG/M
(restricted) 3300023112|Ga0233411_10144139Not Available774Open in IMG/M
(restricted) 3300024059|Ga0255040_10195604Not Available827Open in IMG/M
3300024191|Ga0228636_1031449All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Autographiviridae → Studiervirinae → Minipunavirus1295Open in IMG/M
3300024335|Ga0228672_1001069All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Parvibaculaceae → Parvibaculum → unclassified Parvibaculum → Parvibaculum sp.11389Open in IMG/M
3300025120|Ga0209535_1014875All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → unclassified Pelagibacterales → Pelagibacterales bacterium4164Open in IMG/M
3300025151|Ga0209645_1034393Not Available1848Open in IMG/M
3300025543|Ga0208303_1015053All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → unclassified Pelagibacterales → Pelagibacterales bacterium2297Open in IMG/M
3300025608|Ga0209654_1002301All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria13377Open in IMG/M
3300025608|Ga0209654_1015266All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → unclassified Pelagibacterales → Pelagibacterales bacterium3061Open in IMG/M
3300025617|Ga0209138_1019104All Organisms → cellular organisms → Bacteria3172Open in IMG/M
3300025647|Ga0208160_1000690All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Parvibaculaceae → Parvibaculum → unclassified Parvibaculum → Parvibaculum sp.15401Open in IMG/M
3300025647|Ga0208160_1071028Not Available949Open in IMG/M
3300025671|Ga0208898_1002062All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria12591Open in IMG/M
3300025695|Ga0209653_1112329All Organisms → cellular organisms → Bacteria → Terrabacteria group → Deinococcus-Thermus → Deinococci → Deinococcales → Deinococcaceae → Deinococcus861Open in IMG/M
3300025853|Ga0208645_1007226All Organisms → cellular organisms → Bacteria7261Open in IMG/M
3300025853|Ga0208645_1066513Not Available1633Open in IMG/M
3300025853|Ga0208645_1236702Not Available619Open in IMG/M
3300025879|Ga0209555_10016427All Organisms → cellular organisms → Bacteria3733Open in IMG/M
3300025889|Ga0208644_1019137All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → unclassified Pelagibacterales → Pelagibacterales bacterium4362Open in IMG/M
3300025889|Ga0208644_1034147All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → unclassified Pelagibacterales → Pelagibacterales bacterium3007Open in IMG/M
3300026453|Ga0228644_1089678Not Available537Open in IMG/M
3300026506|Ga0228604_1049936Not Available670Open in IMG/M
3300027832|Ga0209491_10195352All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → unclassified Pelagibacterales → Pelagibacterales bacterium1744Open in IMG/M
3300027848|Ga0209390_10196813All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → unclassified Pelagibacterales → Pelagibacterales bacterium1744Open in IMG/M
3300027976|Ga0209702_10084460All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → unclassified Pelagibacterales → Pelagibacterales bacterium1556Open in IMG/M
3300027983|Ga0209284_10207639Not Available1014Open in IMG/M
3300028110|Ga0247584_1186904Not Available505Open in IMG/M
3300028125|Ga0256368_1022783All Organisms → Viruses → environmental samples → uncultured virus1110Open in IMG/M
3300028125|Ga0256368_1028065Not Available1003Open in IMG/M
3300031565|Ga0307379_11534967Not Available529Open in IMG/M
3300031566|Ga0307378_10417771All Organisms → cellular organisms → Bacteria → Proteobacteria1227Open in IMG/M
3300031578|Ga0307376_10294716Not Available1085Open in IMG/M
3300031602|Ga0307993_1003294All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → unclassified Pelagibacterales → Pelagibacterales bacterium4826Open in IMG/M
3300031629|Ga0307985_10010689Not Available4627Open in IMG/M
3300031631|Ga0307987_1094471Not Available816Open in IMG/M
3300031669|Ga0307375_10594402Not Available653Open in IMG/M
3300031669|Ga0307375_10720036Not Available573Open in IMG/M
3300031673|Ga0307377_11152662Not Available510Open in IMG/M
3300032274|Ga0316203_1009070Not Available3141Open in IMG/M
3300032462|Ga0335396_10912707Not Available518Open in IMG/M
3300033742|Ga0314858_116717Not Available681Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous26.92%
SeawaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Seawater9.62%
SeawaterEnvironmental → Aquatic → Marine → Strait → Unclassified → Seawater9.62%
MarineEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine7.69%
Marine WaterEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine Water5.77%
SoilEnvironmental → Terrestrial → Soil → Clay → Unclassified → Soil5.77%
FreshwaterEnvironmental → Aquatic → Freshwater → Ice → Glacial Lake → Freshwater4.81%
MarineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Marine4.81%
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine3.85%
Marine WaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine Water2.88%
Sea-Ice BrineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Sea-Ice Brine2.88%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine2.88%
Estuarine WaterEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water2.88%
SeawaterEnvironmental → Aquatic → Marine → Inlet → Unclassified → Seawater0.96%
Microbial MatEnvironmental → Aquatic → Marine → Coastal → Sediment → Microbial Mat0.96%
Salt MarshEnvironmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh0.96%
MarineEnvironmental → Aquatic → Marine → Intertidal Zone → Sediment → Marine0.96%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine0.96%
Pelagic MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine0.96%
Marine SedimentEnvironmental → Aquatic → Marine → Hydrothermal Vents → Sediment → Marine Sediment0.96%
Sediment (Intertidal)Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal)0.96%
MarineEnvironmental → Aquatic → Unclassified → Unclassified → Unclassified → Marine0.96%
Macroalgal SurfaceHost-Associated → Algae → Green Algae → Ectosymbionts → Unclassified → Macroalgal Surface0.96%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000128Marine microbial communities from chronically polluted sediments in Adventfjord, Norway : sample - Svalbard Archipelago station 1 sample NOR 08_45mEnvironmentalOpen in IMG/M
3300000947Macroalgal surface ecosystem from Botany Bay, Sydney, Australia - BBAY92Host-AssociatedOpen in IMG/M
3300001460Marine viral communities from the Pacific Ocean - LP-28EnvironmentalOpen in IMG/M
3300002143M3t6FKB2 (118f)EnvironmentalOpen in IMG/M
3300002488Marine viral communities from the Pacific Ocean - ETNP_2_60EnvironmentalOpen in IMG/M
3300003409Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_161SG_22_DNAEnvironmentalOpen in IMG/M
3300003410Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_153SG_22_DNAEnvironmentalOpen in IMG/M
3300004097Pelagic marine sediment microbial communities from the LTER site Helgoland, North Sea, for post-phytoplankton bloom and carbon turnover studies - OSD3 (Helgoland) metaGEnvironmentalOpen in IMG/M
3300004829Marine water microbial communities from the Pohang Bay, Korea with extracellular vesicles - Pohang-EVsEnvironmentalOpen in IMG/M
3300004951Marine water microbial communities from the East Sea, Korea with extracellular vesicles - East-Sea-EVsEnvironmentalOpen in IMG/M
3300005828Microbial communities from Baker Bay sediment, Columbia River estuary, Washington - S.182_BBIEnvironmentalOpen in IMG/M
3300006802Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18EnvironmentalOpen in IMG/M
3300006803Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_>0.8_DNAEnvironmentalOpen in IMG/M
3300006810Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01EnvironmentalOpen in IMG/M
3300006920Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12EnvironmentalOpen in IMG/M
3300007346Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_31EnvironmentalOpen in IMG/M
3300007538Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaGEnvironmentalOpen in IMG/M
3300007540Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaGEnvironmentalOpen in IMG/M
3300007542Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaGEnvironmentalOpen in IMG/M
3300009606Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_5May14_M2_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300011128Seawater microbial communities from Japan Sea near Toyama Prefecture, Japan - 2014_2, 0.02EnvironmentalOpen in IMG/M
3300011245Seawater microbial communities from Japan Sea near Toyama Prefecture, Japan - 2014_4, 0.2EnvironmentalOpen in IMG/M
3300011248Seawater microbial communities from Japan Sea near Toyama Prefecture, Japan - 2014_2, 0.2EnvironmentalOpen in IMG/M
3300011252Seawater microbial communities from Japan Sea near Toyama Prefecture, Japan - 2014_4, permeateEnvironmentalOpen in IMG/M
3300011258Seawater microbial communities from Japan Sea near Toyama Prefecture, Japan - 2015_1, permeateEnvironmentalOpen in IMG/M
3300012516Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.2_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300014903Subseafloor sediment microbial communities from Guaymas Basin, Gulf of California, Mexico - Guay12, Core 4567-28, 21-24 cmEnvironmentalOpen in IMG/M
3300017714Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 35 SPOT_SRF_2012-08-15EnvironmentalOpen in IMG/M
3300017727Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 24 SPOT_SRF_2011-07-20EnvironmentalOpen in IMG/M
3300017741Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 44 SPOT_SRF_2013-06-19EnvironmentalOpen in IMG/M
3300017742Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 22 SPOT_SRF_2011-05-21EnvironmentalOpen in IMG/M
3300017748Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 16 SPOT_SRF_2010-10-21EnvironmentalOpen in IMG/M
3300017751Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 13 SPOT_SRF_2010-07-21 (version 2)EnvironmentalOpen in IMG/M
3300017752Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 23 SPOT_SRF_2011-06-22EnvironmentalOpen in IMG/M
3300017770Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 15 SPOT_SRF_2010-09-15 (version 2)EnvironmentalOpen in IMG/M
3300017782Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 3 SPOT_SRF_2009-08-19EnvironmentalOpen in IMG/M
3300018420Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011512CT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300021335Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO540EnvironmentalOpen in IMG/M
3300021347Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO266EnvironmentalOpen in IMG/M
3300021356Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO245EnvironmentalOpen in IMG/M
3300021373Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO282EnvironmentalOpen in IMG/M
3300021425Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO284EnvironmentalOpen in IMG/M
3300021957Estuarine water microbial communities from San Francisco Bay, California, United States - C33_18DEnvironmentalOpen in IMG/M
3300021960Estuarine water microbial communities from San Francisco Bay, California, United States - C33_9DEnvironmentalOpen in IMG/M
3300022200Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (v3)EnvironmentalOpen in IMG/M
3300023112 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_2_MGEnvironmentalOpen in IMG/M
3300024059 (restricted)Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_2EnvironmentalOpen in IMG/M
3300024191Seawater microbial communities from Monterey Bay, California, United States - 45DEnvironmentalOpen in IMG/M
3300024335Seawater microbial communities from Monterey Bay, California, United States - 90DEnvironmentalOpen in IMG/M
3300025120Marine viral communities from the Pacific Ocean - LP-28 (SPAdes)EnvironmentalOpen in IMG/M
3300025151Marine viral communities from the Pacific Ocean - ETNP_6_30 (SPAdes)EnvironmentalOpen in IMG/M
3300025543Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300025608Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_161SG_22_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025617Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_153SG_22_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025647Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300025671Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4 (SPAdes)EnvironmentalOpen in IMG/M
3300025695Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_116LU_22_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025853Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 (SPAdes)EnvironmentalOpen in IMG/M
3300025879Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_85LU_5_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025889Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 (SPAdes)EnvironmentalOpen in IMG/M
3300026453Seawater microbial communities from Monterey Bay, California, United States - 56DEnvironmentalOpen in IMG/M
3300026506Seawater microbial communities from Monterey Bay, California, United States - 4DEnvironmentalOpen in IMG/M
3300027832Freshwater microbial communities from Lake Bonney liftoff mats and glacier meltwater in Antarctica - BON-02 (SPAdes)EnvironmentalOpen in IMG/M
3300027848Freshwater microbial communities from Lake Bonney liftoff mats and glacier meltwater in Antarctica - BON-01 (SPAdes)EnvironmentalOpen in IMG/M
3300027976Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - FRY-01 (SPAdes)EnvironmentalOpen in IMG/M
3300027983Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - FRY-03 (SPAdes)EnvironmentalOpen in IMG/M
3300028110Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 43R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028125Sea-ice brine viral communities from Beaufort Sea near Barrow, Alaska, United States - SBEnvironmentalOpen in IMG/M
3300031565Soil microbial communities from Risofladan, Vaasa, Finland - UN-2EnvironmentalOpen in IMG/M
3300031566Soil microbial communities from Risofladan, Vaasa, Finland - UN-1EnvironmentalOpen in IMG/M
3300031578Soil microbial communities from Risofladan, Vaasa, Finland - TR-2EnvironmentalOpen in IMG/M
3300031602Marine microbial communities from Ellis Fjord, Antarctic Ocean - #260EnvironmentalOpen in IMG/M
3300031629Marine microbial communities from Ellis Fjord, Antarctic Ocean - #80EnvironmentalOpen in IMG/M
3300031631Marine microbial communities from Ellis Fjord, Antarctic Ocean - #181EnvironmentalOpen in IMG/M
3300031669Soil microbial communities from Risofladan, Vaasa, Finland - TR-1EnvironmentalOpen in IMG/M
3300031673Soil microbial communities from Risofladan, Vaasa, Finland - TR-3EnvironmentalOpen in IMG/M
3300032274Microbial mat bacterial communities from mineral coupon in-situ incubated in ocean water Damariscotta River, Maine, United States - 6-month pyrrhotite 1EnvironmentalOpen in IMG/M
3300032462Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - FRY-02 (spades assembly)EnvironmentalOpen in IMG/M
3300033742Sea-ice brine viral communities from Beaufort Sea near Barrow, Alaska, United States - 2018 seawaterEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
SA_S1_NOR08_45mDRAFT_1000583743300000128MarineMAFYITIGAAVRIMHYAKKNAVNKKRVAITFTFAVFVGVLVNHLLMIKGLEQWSGIAVSIAALLGESFVSYLLTNSNNIFRTFINSIFKVDVKNEDKKNE*
BBAY92_1000352923300000947Macroalgal SurfaceMEDLIESFRQFIEIAFYITIGAAVRVMHYARKGVIDKKRVIITFTFAVFVGVIVNHLLILQDLEKYSGIAVSIAALLGESFVTYLLTNSNNIFRSFINSIFNIDVKNQVENNDENK*
JGI24003J15210_1002318643300001460MarineMKKRMEDILDSIWDFLKMMFYIIIGASVRIMHYAKKNAVNKKRVIITFTFAVFVGVIVNHLLIIKGLQDWSGIGVSIAALLGESFVSYLLTNSNNIFRTFINSIFKVDVKNEDKKDEK*
M3t6FKB2_1021287343300002143MarineMNEITESMRQFLEVAFYITIGAAVRIMYFAKKHAINKKMVIITFTFAVFVGVIVNHLLILRDLERYSGIAVSISALLGESFVTYLLTNSNNIFRSVINAMFKIDVDNKDEDK*
JGI25128J35275_107200013300002488MarineMHYAKKNTVNKKRVIITFTFAVFVGVIVNHLLIIKNLHEWSGIAVSIAALLGESFVSYLLTNSNNIFRTFINSIFKIDVDNKLENKEEDKVD*
JGI26088J50261_102659413300003409MarineMEDIWSSVEDFFKMAFYITIGAAVRIMHYAKKNTVDKKRVAITFTFAVFVGVIVNHIMIIKGWQEWSGIAVSIAALLGESFVSYLLTNSNNIFRTFINSIFKVDVKNEDKKDEGK*
JGI26088J50261_104524823300003409MarineMEDILSSVEDFIKMAFYITIGAAVRIMHYAKKNVVNKKRIAITFTFAVFVGVLVNHLLVIKGLEQWSGIAVSISALLGESFVSYLLTNSNNIFRTFINSIFKVDVKNEDEKND*
JGI26086J50260_100694343300003410MarineMAFYITIGAAVRIMHYAKKNVVNKKRIAITFTFAVFVGVLVNHLLVIKGLEQWSGIAVSISALLGESFVSYLLTNSNNIFRTFINSIFKVDVKNEDEKND*
Ga0055584_10174765623300004097Pelagic MarineVEDVFDFLKTVFYISIGAMVRIMHYAKKNTVNKKKVAITFTFAVFVGMIVNHIMIIKGWQEWSGIAVSISALLGESFVSYLLTNSNNIFRTFINSVFNIDVDNKLENKDED*
Ga0068515_100090263300004829Marine WaterMEDVFDFLKTIFYISLGAMVRIMHYAKTNVVNKKKVAITFTFAVFVGMIVNHIMIIKNWQQWSGIAVSISALLGESFVSYLLYNSNNIFRSFINSIFKIDVENKKDNKDEN*
Ga0068515_10017433300004829Marine WaterMEDIVDSIWDFVKMLFYIVIGASVRIMHYAKKNVVDKKRVVITFTFAVFVGVIVNHLLIIKGWQEWSGIAVSISALLGESFVSYLLTNSNNIFRTFINALFKIDVKNKEDKDGKL*
Ga0068515_10079953300004829Marine WaterMEDIWDSIWDFIKMLFYIIIGASVRIMHYAKNNTVNKKRVIITFTFAVFVGVIVNHLLIIKGLEQWSGIAVSIAALLGESFVSYLLTNSNNIFRTFINSIFKVDVEDKDKKDEK*
Ga0068515_10135863300004829Marine WaterMEDVWDFLKTIFYISIGAMVRIMHYAKNNTVNKKKVAITFTFAVFVGMIVNHLLIIKGLEQWSGIAVSISALLGESFVSYLLNNSNNIFRTVLNSIFKLDNDNKLKKDDED*
Ga0068515_11667523300004829Marine WaterMEDFYDLLKTIFYISIGAMVRLMHYAKKNTINKKRVIITFTFAVFVGMIVNHLLIIKGLEQWSGIAVSISALLGESFVSYLLTNSNNIFRSFINSIFKLDNDNKLKKEDEK*
Ga0068515_12040123300004829Marine WaterMEDAIDFLKTVFYISIGALVRIMYYAKKNTVNKKMVAITFTFAVFVGMIVNHVLIIKGWEQWSGIAVSISALLGESFVSYLLTNSNNIFRTFINSIFKLDNDNKLKKEDEND*
Ga0068513_101313113300004951Marine WaterMEDVWDFLKTIFYISIGAMVRIMHYAKNNTVNKKKVAITFTFAVFVGMIVNHLLIIKGLEQWSGIAVSISALLGESFVSYLLNNSNNIFRTVLNSIFKL
Ga0068513_101943023300004951Marine WaterVEDVFDFLKTVFYISIGAMVRIMHYAKKNTVNKKKVAITFTFAVFVGMIVNHIMIIKGWQEWSGIAVSISALLGESFVSYLLTNSNNIFRTFINSLFKIDVDNKLENKDED*
Ga0068513_101947923300004951Marine WaterVEDVFDFLKTVFYITIGAMVRIMHYAKKNTVNKKKVAITFTFAVFVGMIVNHIMIIKGWQEWSGIAVSISALLGESFVSYLLTNSNNIFRTFINSLFKIDVDNKLENKDED*
Ga0074475_1037545913300005828Sediment (Intertidal)MEDIIESLRQFLEIAFYITIGAAVRVMHYARKGVIDKKRVIITFTFAVFVGVIVNHFLILQDLEKYSGIAVSIAALLGESFVSYLLTNSNNIFRSVINAAFKIDVENKKD
Ga0070749_1000794493300006802AqueousMEDVYDFLKTIFYISIGALVRIMHYAKKNTVDKKRVAITFTFAVFVGMIVNHLLIIKGLEQWSGIAVSISALLGESFVSYLLTNSNNIFRTFINSIFKLDNDNKLKKEDEND*
Ga0070749_1000810633300006802AqueousMEDIWDSVWDFIKMLFYIVIGASVRIMHYAKNNTVNKKRVIITFTFAVFVGVIVNHLLIIKGLQQWSGIAVSIAALLGESFVSYLLTNSNNIFRTFINSIFKVDVENEDKKDEK*
Ga0070749_1044404923300006802AqueousMEDVFDFLKTIFYISLGAMVRIMHYAKTNVVNKKKVAITFTFAVFVGMIVNHIMIIKNWEQWSGIAVSISALLGESFVSYLLYNSNNIFRTFINSIFKIDVENKKDNKNEN*EIYCSYRYLLLVVHLKKDYLN*
Ga0075467_1032506723300006803AqueousMEDIIEAVRQFLEIAFYITIGAAVRVMHYARKGVIDKKRVIITFTFAVFVGVIVNHFLILKDLEKYSGIAVSIAALLGESLVSYLLTNSNNIFRSVINAAFKIDVKNKDEDQ*
Ga0070754_1001918563300006810AqueousMEDILDSIWDFLKMMFYIIIGASVRIMHYAKKNAVNKKRVIITFTFAVFVGVIVNHLLIIKGLQDWSGIGVSIAALLGESFVSYLLTNSNNIFRTFINSIFKVDVNNKLENKKEDKVD*
Ga0070754_1038065523300006810AqueousMKRMEEILDSLLGFLKMAFYITIGAAVRIMHYAKKNAVNKKRVAITFTFAVFVGVLVNHLLVIKGLEQWSGIAVSIAALLGESFVSYLLTNSNNIFRTFINSIFKVDIKNEDKKDE*
Ga0070748_100748393300006920AqueousMKKKMEDIIEAVRQFLEIAFYITIGAAVRVMHYARKGVIDKKRVIITFTFAVFVGVIVNHFLILKDLEKYSGIAVSIAALLGESFVSYLLTNSNNIFRSVINAAFKIDVKNKDEDQ*
Ga0070753_107990923300007346AqueousMEEILDSLLGFLKMAFYITIGAAVRIMHYAKKNAVNKKRVAITFTFAVFVGVLVNHLLVIKGLEQWSGIAVSIAALLGESFVSYLLTNSNNIFRTFINSIFKVDIKNEDKKDE*
Ga0099851_102971423300007538AqueousMEDIIESFRQFIEIAFYITIGAAVRVMHFARKGVIDKKRVIITFTFAVFVGVIVNHFLILKDLEKYSGIAVSIAALLGESFVSYLLTNSNNIFRSVINAAFKIDVENKKDDDK*
Ga0099851_105440633300007538AqueousMEDIIESLKQFIEIAFYITIGAAVKVMHQARKEAIDKKRVIITFTFAVFVGVIVNHLLILQDLEKYSGIAVSIAALLGESFVTYLLTNSNNIFRSFINSIFNIDVKNQVENNDENK*
Ga0099847_1000690203300007540AqueousMEDLIESLKQFIEIAFYITIGAAVKVMHQARKEAIDKKRVIITFTFAVFVGVIVNHLLILQDLEKYSGIAVSIAALLGESFVTYLLTNSNNIFRSFINSIFNIDVKNQVENNDENK*
Ga0099847_100234643300007540AqueousVEDVFDFLKTVFYISIGAMVRIMHYAKKNTVNKKKVAITFTFAVFVGMIVNHIMIIKGWQEWSGIAVSISALLGESFVSYLLTNSNNIFRTFINSVFKIDVDNKLENKDED*
Ga0099847_103643913300007540AqueousQFIEIAFYITIGAAVRVMHFARKGVIDKKRVIITFTFAVFVGVIVNHFLILKDLEKYSGIAVSIAALLGESFVSYLLTNSNNIFRSVINAAFKIDVENKKDDDK*
Ga0099846_108389013300007542AqueousMEDLIESFRQFIEIAFYITIGAAVRVMHFARKGVIDKKRVIITFTFAVFVGVIVNHFLILKDLEKYSGIAVSIAALLGESFVSYLLTNSNNIFRSVINAAFKIDVENKKDEDK*
Ga0099846_109937423300007542AqueousMEDIIESLKQFIEIAFYITIGAAVKVMHQARKGAIDKKRVIITFTFAVFVGVIVNHLLILQDLEKYSGIAVSIAALLGESFVTYLLTNSNNIFRSFINSIFNIDVKNQVENNDENK*
Ga0115102_1077946723300009606MarineVEDVFDFLKTVFYISIGAMVRIMHYAKKNTVNKKKVAITFTFAVFVGMIVNHVMIIKEWQEWSGIAVSISALLGESFVSYLLTNSNNIFRTFINSVFKIDVDNKLKNKDED*
Ga0151669_10570693300011128MarineMSKKMEEWGEAIIGVLKTAFYITIGAAVKLMHYAKKNTINKKRVVITFTFAVFVGVIVNHIMIIKGWHEWSGIAVSIAALLGESFVSYLLTNSNNIFRTFINSIFKIDVDNKLENKDDKE
Ga0151673_100590203300011245MarineMSKKMEEWGEAIVSFIKTAFYITIGARVKLMHYAKKNTIDKKRVAITFTFAVFVGVIVNHIMIIKGWHEWSGIAVSIAALLGESFVSYLLTNSNNIFRTFINSIFKIDVDNKLENKDDKE
Ga0151670_101422013300011248MarineIGAAVKLMHYAKKNTINKKRVVITFTFAVFVGVIVNHIMIIKGWHEWSGIAVSIAALLGESFVSYLLTNSNNIFRTFINSIFKIDVDNKLENKDDKE*
Ga0151674_100865213300011252MarineMSSRKNKMEDWIEGIIGFLKTAFYITIGASVKLMHYAKKNTIDKKRVAITFTFAVFLGVIVNHLLIIQDLEKWSGIAVSIAALLGDSFVSYLLTNSNNIFRTFINSIFKIDVDNKLENKDDKE*
Ga0151677_102302093300011258MarineMSKKMEEWGEAIVGFLKTAFYITIGAAVKLMHYAKKNTIDKKRVAITFTFAVFVGVIVNHIMIIKGWHEWSGIAVSIAALLGESFVSYLLTNSNNIFRTFINSIFKIDVDNKLENKDDKE
Ga0129325_129679713300012516AqueousMEDIIESFRQFIEIAFYITIGAAVRVMHFARKGVIDKKRVIITFTFAVFVGVIVNHFLILKDLEKYSGIAVSIAALLGESFVSYLLTNSNNIFRSVINAA
Ga0164321_1002465933300014903Marine SedimentMKKRMEDILDSIWDFLKMMFYIIIGASVRIMHYAKKNTVNKKRVIITFTFAVFVGVIVNHLLIIKNLHEWSGIAVSIAALLGESFVSYLLTNSNNIFRTFINSIFKIDVDNKLENKEEDKVD*
Ga0181412_100328123300017714SeawaterMEDIWDSIWDFIKMLFYIIIGASVRIMHYAKNNTVNKKRVIITFTFAVFVGVIVNHLLIIKGLQQWSGIAVSIAALLGESFVSYLLTNSNNIFRTFINSIFKVDVENKDKKDEK
Ga0181401_101916113300017727SeawaterKVKNRMEDIWNSVEDFLKMAFYITIGAAVRIMHYAKNNVVNKKRVAITFTFAVFVGVLVNHLLVIKGLQQWSGIAVSIAALLGESFVSYLLTNSNNIFRTFINSIFKVDVKDKDVDND
Ga0181421_120012623300017741SeawaterVEDVFDFLKTVFYISIGAMVRIMHYAKKNTVNKKKVAITFTFAVFVGMIVNHIMIIKGWQEWSGIAVSISALLGESFVSYLLTNSNNIFRTFINSLFKIDVDNKLKNKDED
Ga0181399_100293493300017742SeawaterVEDVFDFLKTVFYISIGAMVRIMHYAKKNTVNKKKVAITFTFAVFVGMIVNHVMIIKGWQEWSGIAVSISALLGESFVSYLLTNSNNIFRTFINSVFKIDVNNKLENKNED
Ga0181393_100242343300017748SeawaterMKKRMEDILDSIWDFLKMMFYIIIGASVRIMHYAKKNAVNKKRVIITFTFAVFVGVIVNHLLIIKGLQDWSGIGVSIAALLGESFVSYLLTNSNNIFRTFINSIFKVDVKNENKKDEK
Ga0187219_119207323300017751SeawaterVEDVFDFLKTVFYISIGAMVRIMHYAKKNTVNKKKVAITFTFAVFVGMIVNHVMIIKEWQEWSGIAVSISALLGESFVSYLLTNSNNIFRTFIN
Ga0181400_107862123300017752SeawaterMEDIWNSVEDFLKMAFYITIGAAVRIMHYAKNNVVNKKRVAITFTFAVFVGVLVNHLLVIKGLQQWSGIAVSIAALLGESFVSYLLTNSNNIFRTFINSIFKVDVKDKDVDND
Ga0187217_129281813300017770SeawaterRMMHYAKKNTVNKKKVAITFTFAVFVGMIVNHVMIIKGWQEWSGIAVSISALLGESFVSYLLTNSNNIFRTFINSVFKIDVNNKLENKNED
Ga0181380_114473713300017782SeawaterMEDAIDFLKTVFYISIGALVRIMYYAKKNTVNKKMVAITFTFAVFVGMIVNHVLIIKGWEQWSGIAVSISALLGESFVSYLLTNSNNIFRTFINSIFKLDNDNKL
Ga0181563_1019770523300018420Salt MarshMEDILDSIWDFLKMMFYIIIGASVRIMHYAKKNTVNKKRVIITFTFAVFVGVIVNHLLIIKNLHEWSGIAVSIAALLGESFVSYLLTNSNNIFRTFINSIFKIDVDNKLENKEEDKVD
Ga0213867_105757423300021335SeawaterVEDVFDFLKTVFYISIGAMVRIMHYAKKNTVNKKKVAITFTFAVFVGMIVNHIMIIKGWQEWSGIAVSISALLGESFVSYLLTNSNNIFRTFINSVFKIDVDNKLENKDED
Ga0213862_1001565753300021347SeawaterMEDILDSIWDFLKMMFYIIIGASVRIMHYAKKNTVNKKRVIITFTFAVFVGVIVNHLLIIKNLHEWSGIAVSIAALLGESFVSYLLTNSNNIFRTFINSIFKIDVDNKLENKKEDKVD
Ga0213858_1005073143300021356SeawaterMKKRMEDILDSIWDFLKMMFYIIIGASVRIMHYAKKNTVNKKRVIITFTFAVFVGVIVNHLLIIKNLHEWSGIAVSIAALLGESFVSYLLTNSNNIFRTFINSIFKIDVDNKLENKEEDKVD
Ga0213865_1002438533300021373SeawaterMEDIWDSIWDFIKMLFYIIIGASVRIMHYAKNNTVNKKRVIITFTFAVFVGVIVNHLLIIKGLEQWSGIAVSIAALLGESFVSYLLTNSNNIFRTFINSIFKVDVENKDKKDEK
Ga0213866_1013580223300021425SeawaterMEDILDSIWDFLKMMFYIIIGASVRIMHYAKKNTVNKKRVIITFTFAVFVGVIVNHLLIIKNLHEWSGIAVSIAALLGESFVSYLLTNSNNIFRTFINSIFKIDVDNKLENKDKEDEK
Ga0222717_10004488183300021957Estuarine WaterMEDAIDFLKTVFYISIGALVRIMYYAKKNTVNKKMVAITFTFAVFVGMIVNHVLIIKGWEQWSGIAVSISALLGESFVSYLLTNSNNIFRSFINSIFKLDNDNKLEKEDEND
Ga0222717_1043698723300021957Estuarine WaterMEDAIDFLKTVFYISIGALVRIMYYAKKNTVNKKMVAITFTFAVFVGMIVNHVLIIKGWEQWSGIAVSISALLGESFVSYLLTNSNNIFRSFINSIFKLDNDNKLKKEDEKD
Ga0222715_1069508913300021960Estuarine WaterTVFYISIGALVRIMYYAKKNTVNKKMVAITFTFAVFVGMIVNHVLIIKGWEQWSGIAVSISALLGESFVSYLLTNSNNIFRSFINSIFKLDNDNKLKKEDEKD
Ga0196901_100083863300022200AqueousMKKKMEDIIEAVRQFLEIAFYITIGAAVRVMHYARKGVIDKKRVIITFTFAVFVGVIVNHFLILKDLEKYSGIAVSIAALLGESFVSYLLTNSNNIFRSVINAAFKIDVKNKDEDQ
Ga0196901_109499033300022200AqueousIESLKQFIEIAFYITIGAAVKVMHQARKGAIDKKRVIITFTFAVFVGVIVNHLLILQDLEKYSGIAVSIAALLGESFVTYLLTNSNNIFRSFINSIFNIDVKNQVENNDENK
Ga0196901_112009313300022200AqueousVKRMEDIIESFRQFIEIAFYITIGAAVRVMHFARKGVIDKKRVIITFTFAVFVGVIVNHFLILKDLEKYSGIAVSISALLGESFVSYLLTNSNNIFRSVINEAFKIDVENKKDEDK
(restricted) Ga0233411_1014413913300023112SeawaterMEDAFDFFKTVFYIVIGAAVKIMHYAKTGTVNKKKVAITFTFAVFVGMIVNHIMIIQEWYEWSGIAVSISALLGESFVSYLLTNSNNIFRTFINSIFKIDVKNKDE
(restricted) Ga0255040_1019560433300024059SeawaterMEDAIDFFKTVFYIVIGAAVKIMHYAKTGTVNKKRVAITFTFAVFVGMIVNHIMIIKEWHEWSGIAVSISALLGESFVSYLLTNSNNIFRSFINSIFKIDVKNKDE
Ga0228636_103144933300024191SeawaterMEDAIDFLKTVFYISIGALVRIMYYAKKNTVNKKMVAITFTFAVFVGMIVNHVLIIKGWEQWSGIAVSISALLGESFVSYLLTNSNNIFRTFINSIFKLDNDNKLKKEDEKD
Ga0228672_1001069253300024335SeawaterMEDAIDFLKTVFYISIGALVRIMYYAKKNTVNKKMVAITFTFAVFVGMIVNHVLIIKGWEQWSGIAVSISALLGESFVSYLLTNSNNIFRTFINSI
Ga0209535_101487543300025120MarineMKKRMEDILDSIWDFLKMMFYIIIGASVRIMHYAKKNAVNKKRVIITFTFAVFVGVIVNHLLIIKGLQDWSGIGVSIAALLGESFVSYLLTNSNNIFRTFINSIFKVDVKNEDKKDEK
Ga0209645_103439323300025151MarineMFYIIIGASVRIMHYAKKNTVNKKRVIITFTFAVFVGVIVNHLLIIKNLHEWSGIAVSIAALLGESFVSYLLTNSNNIFRTFINSIFKIDVDNKLENKEENKVD
Ga0208303_101505343300025543AqueousMEDIIESLKQFIEIAFYITIGAAVKVMHQARKEAIDKKRVIITFTFAVFVGVIVNHLLILQDLEKYSGIAVSIAALLGESFVTYLLTNSNNIFRSFINSIFNIDVKNQVENNDENK
Ga0209654_1002301203300025608MarineMEDIWSSVEDFFKMAFYITIGAAVRIMHYAKKNTVDKKRVAITFTFAVFVGVIVNHIMIIKGWQEWSGIAVSIAALLGESFVSYLLTNSNNIFRTFINSIFKVDVKNEDKKDEGK
Ga0209654_101526653300025608MarineMAFYITIGAAVRIMHYAKKNVVNKKRIAITFTFAVFVGVLVNHLLVIKGLEQWSGIAVSISALLGESFVSYLLTNSNNIFRTFINSIFKVDVKNEDEKND
Ga0209138_101910423300025617MarineMEDILSSVEDFIKMAFYITIGAAVRIMHYAKKNVVNKKRIAITFTFAVFVGVLVNHLLVIKGLEQWSGIAVSISALLGESFVSYLLTNSNNIFRTFINSIFKVDVKNEDEKND
Ga0208160_100069033300025647AqueousMEDIIEAVRQFLEIAFYITIGAAVRVMHYARKGVIDKKRVIITFTFAVFVGVIVNHFLILKDLEKYSGIAVSIAALLGESFVSYLLTNSNNIFRSVINAAFKIDVKNKDEDQ
Ga0208160_107102823300025647AqueousMEDIIESLKQFIEIAFYITIGAAVKVMHQARKGAIDKKRVIITFTFAVFVGVIVNHLLILQDLEKYSGIAVSIAALLGESFVTYLLTNSNNIFRSFINSIFNIDVKNQVENNDENK
Ga0208898_1002062103300025671AqueousVKKRMEDIWDSVWDFIKMLFYIVIGASVRIMHYAKNNTVNKKRVIITFTFAVFVGVIVNHLLIIKGLQQWSGIAVSIAALLGESFVSYLLTNSNNIFRTFINSIFKVDVENEDKKDEKXVMFQVLQHSKKTI
Ga0209653_111232913300025695MarineLFYIVIGASVRIMHYAKNNTVNKKRVIITFTFAVFVGVIVNHLLIIKGLEQWSGIAVSIAALLGESFVSYLLTNSNNIFRTFINSIFKVDVENKDKKDEKXVMFQVLQHSKKTI
Ga0208645_100722693300025853AqueousMEDIWDSVWDFIKMLFYIVIGASVRIMHYAKNNTVNKKRVIITFTFAVFVGVIVNHLLIIKGLQQWSGIAVSIAALLGESFVSYLLTNSNNIFRTFINSIFKVDVENEDKKDEK
Ga0208645_106651343300025853AqueousMEDILDSIWDFLKMMFYIIIGASVRIMHYAKKNAVNKKRVIITFTFAVFVGVIVNHLLIIKGLQDWSGIGVSIAALLGESFVSYLLTNSNNIFRTFINSIFKVDVNNKLENKKEDKVD
Ga0208645_123670223300025853AqueousMEEILDSLLGFLKMAFYITIGAAVRIMHYAKKNAVNKKRVAITFTFAVFVGVLVNHLLVIKGLEQWSGIAVSIAALLGESFVSYLLTNSNNIFRTFINSIFKVDVKNEDKKDE
Ga0209555_1001642733300025879MarineMEDIWDSFWDFIKMLFYIVIGASVRIMHYAKNNTVNKKRVIITFTFAVFVGVIVNHLLIIKGLEQWSGIAVSIAALLGESFVSYLLTNSNNIFRTFINSIFKVDVENKDKKDEK
Ga0208644_1019137103300025889AqueousVEDVFDFLKTVFYISIGAMVRIMHYAKKNTVNKKKVAITFTFAVFVGMIVNHIMIIKGWQEWSGIAVSISALLGESFVSYLLTNSNNIFRTFINSLFKIDVDNKLENKDED
Ga0208644_103414753300025889AqueousMEDVYDFLKTIFYISIGALVRIMHYAKKNTVDKKRVAITFTFAVFVGMIVNHLLIIKGLEQWSGIAVSISALLGESFVSYLLTNSNNIFRTFINSIFKLDNDNKLKKEDEND
Ga0228644_108967813300026453SeawaterDAIDFLKTVFYISIGALVIIMYYAKKNTVNKKMVAITFTFAVFVGMIVNHVLIIKGWEQWSGIAVSISALLGESFVSYLLTNSNNIFRTFINSIFKLDNDNKLKKEDEKD
Ga0228604_104993613300026506SeawaterMEDAIDFLKTVFYISIGALVRIMYYAKKNTVNKKMVAITFTFAVFVGMIVNHVLIIKGWEQWSGIAVSISALLGESFVSYLLTNSNNIFRTFINSIFKLDNDNKFKKEDEKD
Ga0209491_1019535233300027832FreshwaterMNKMEDWTEAVIGFLKTAFYIAIGASVRLMHYAKNNTLNKKKVAITFTFAVFLGVIVNHILIIRDMEQWSGIAVSIAALLGDSFVSYLLTNSNNIFRTFINSIFKIDVDNKLENKDDTE
Ga0209390_1019681333300027848FreshwaterMSKMEYWTEAVIGFLKTAFYITIGASVRLMHYAKNNTLNKKKVAITFTFAVFLGVIVNHILIIRDMEQWSGIAVSIAALLGDSFVSYLLTNSNNIFRTFINSIFKIDVDNKLENKDDTE
Ga0209702_1008446023300027976FreshwaterMEDWTEAVIGFLKTAFYITIGASVRLMHYAKNNTLNKKKVAITFTFAVFLGVIVNHILIIRDMEQWSGIAVSIAALLGDSFVSYLLTNSNNIFRTFINSIFKIDVDNKLENKDDTE
Ga0209284_1020763923300027983FreshwaterMEYWTEAVIGFLKTAFYITIGASVRLMHYAKNNTLNKKKVAITFTFAVFLGVIVNHILIIRDMEQWSGIAVSIAALLGDSFVSYLLTNSNNIFRTFINSIFKIDVDNKLENKDDTE
Ga0247584_118690423300028110SeawaterMEDAIDFLKTVFYISIGALVRIMYYAKKNTVNKKMVAITFTFAVFVGMIVNHVLIIKGWEQWSGIAVSISALLGESFVSYLLTNSNDIFRTFINSIFKLDNDNKLK
Ga0256368_102278343300028125Sea-Ice BrineMEDWGEAIIGVLKTAFYITIGAAVKLMHYAKKNTIDKKRVVITFTFAVFVGVIVNHIMIIKGWHEWSGIAVSIAALLGESFVSYLLTNSNNIFRTFINSIFKIDVDNKIENKDDKE
Ga0256368_102806523300028125Sea-Ice BrineMEEWGEAVIGVLKTAFYITIGAAVKLMHYAKKNTIDKKRVVITFTFAVFVGVIVNHIMIIKGWHEWSGIAVSIAALLGESFVSYLLTNSNNIFRTFINSIFKIDVENKDDKE
Ga0307379_1153496723300031565SoilFYITIGAAVRIMYFAKKHAINKKMVIITFTFAVFVGVIVNHLLILRDLERYSGIAVSISALLGESFVTYLLTNSNNIFRSVINAMFKIDVDNKDEDK
Ga0307378_1041777133300031566SoilMNDIIESMKQFIEIAFYITIGAAVRVMHYAKKHTIDKKRVIITFTFAVFVGVIVNHLLILRDLEKYSGIAVSISALLGESFVTYLLTNSNNIFRSVINAMFKIDVDNKDEDK
Ga0307376_1029471623300031578SoilMNEITESMRQFLEVAFYITIGAAVRIMYFAKKHAINKKMVIITFTFAVFVGVIVNHLLILRDLERYSGIAVSISALLGESFVTYLLTNSNNIFRSVINAMFKIDVDNKDEDK
Ga0307993_100329443300031602MarineMEDWTEAVIGFLKTAFYITIGASVRLMHYAKKNTIDKKRVAITFTFAVFVGVIVNHLLIIQEMEQWSGIAVSIAALLGDSFVSYLLTNSNNIFRSFINSIFKIDVDNKIENKDDKK
Ga0307985_1001068943300031629MarineMEEILDSLVGFLKMAFYITIGAAVRIMHYAKKNTVNKKRVAITFTFAVFVGVLVNHLLVIKGLEQWSGIAVSIAALLGENFVSYLLKNSNNIFRTFINSIFKVDVKNEDKKDE
Ga0307987_109447133300031631MarineMGDWTEAVIGFLKTAFYITIGASVRLMHYAKKNTVDKKRVAITFTFAVFVGVIVNHLLIIQDMEQWSGIAVSIAALLGDSFVSYLLTNSNNIFRSFINSI
Ga0307375_1059440233300031669SoilMEDIIESIKQFIEIAFYITIGAAVRVMHYARKGVIDKKRVIITFTFAVFVGVIVNHLLILQDLEKYSGIAVSIAALLGESFVSYLLTNSNNIFRSFINSIFNIDVKNQVENNDENK
Ga0307375_1072003623300031669SoilKRNMNDIIESMKQFIEIAFYITIGAAVRVMHYAKKHTIDKKRVIITFTFAVFVGVIVNHLLILRDLEKYSGIAVSISALLGESFVTYLLTNSNNIFRSVINAMFKIDVDNKNEDDENK
Ga0307377_1115266223300031673SoilMDDIIESMKQFIEIAFYITIGAAVRVMHYAKKHTIDKKRVIITFTFAVFVGVIVNHLLILRDLEKYSGIAVSISALLGESFVTYLLTNSNNIFRSVINAMFKIDVDNKNEDDENK
Ga0316203_100907023300032274Microbial MatMEDIWSSVEDFIKMAFYITIGAAVRIMHYAKNNVVNKKRVVITFTFAVFVGVLVNHLLIIKGLQQWSGIAVSIAALLGESFVSYLLTNSNNIFRTFINSIFKVDVKNKKEDDTE
Ga0335396_1091270723300032462FreshwaterMEDWTEAVIGFIKTAFYITIGASVRLMHYAKNNTLNKKKVAITFTFAVFLGVIVNHILIIRDMEQWSGIAVSIAALLGDSFVSYLLTNSNNIFRTFINSIFKIDVDNKLENKDDTE
Ga0314858_116717_250_6123300033742Sea-Ice BrineMSKRMEEWGEAIVSFIKTAFYITIGASVKLMHYAKKNTVDKKRVAITFTFAVFVGVIVNHIMIIKGWHEWSGIAVSIAALLGESFVSYLLTNSNNIFRTFINSIFKIDVDNKLENKDDKE


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.