Basic Information | |
---|---|
Family ID | F098138 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 104 |
Average Sequence Length | 44 residues |
Representative Sequence | RVIVPAASGAPLERADGLSHLMQVQEVEDIRQALSAVLGAEP |
Number of Associated Samples | 94 |
Number of Associated Scaffolds | 104 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Unclassified |
% of genes with valid RBS motifs | 0.00 % |
% of genes near scaffold ends (potentially truncated) | 100.00 % |
% of genes from short scaffolds (< 2000 bps) | 96.15 % |
Associated GOLD sequencing projects | 92 |
AlphaFold2 3D model prediction | No |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Unclassified (58.654 % of family members) |
NCBI Taxonomy ID | N/A |
Taxonomy | N/A |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa (17.308 % of family members) |
Environment Ontology (ENVO) | Unclassified (20.192 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (47.115 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Fibrous | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 45.24% β-sheet: 0.00% Coil/Unstructured: 54.76% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 104 Family Scaffolds |
---|---|---|
PF00730 | HhH-GPD | 38.46 |
PF00392 | GntR | 1.92 |
PF10431 | ClpB_D2-small | 0.96 |
PF00633 | HHH | 0.96 |
COG ID | Name | Functional Category | % Frequency in 104 Family Scaffolds |
---|---|---|---|
COG0122 | 3-methyladenine DNA glycosylase/8-oxoguanine DNA glycosylase | Replication, recombination and repair [L] | 38.46 |
COG0177 | Endonuclease III | Replication, recombination and repair [L] | 38.46 |
COG1059 | Thermostable 8-oxoguanine DNA glycosylase | Replication, recombination and repair [L] | 38.46 |
COG1194 | Adenine-specific DNA glycosylase, acts on AG and A-oxoG pairs | Replication, recombination and repair [L] | 38.46 |
COG2231 | 3-Methyladenine DNA glycosylase, HhH-GPD/Endo3 superfamily | Replication, recombination and repair [L] | 38.46 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
Unclassified | root | N/A | 58.65 % |
All Organisms | root | All Organisms | 41.35 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300005167|Ga0066672_10510981 | All Organisms → cellular organisms → Bacteria | 780 | Open in IMG/M |
3300005332|Ga0066388_101996239 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1040 | Open in IMG/M |
3300005354|Ga0070675_100564193 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1030 | Open in IMG/M |
3300005434|Ga0070709_11133645 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 626 | Open in IMG/M |
3300005435|Ga0070714_101544374 | Not Available | 648 | Open in IMG/M |
3300005450|Ga0066682_10435851 | Not Available | 835 | Open in IMG/M |
3300005456|Ga0070678_101666880 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 599 | Open in IMG/M |
3300005598|Ga0066706_10686793 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 813 | Open in IMG/M |
3300005614|Ga0068856_101162237 | Not Available | 788 | Open in IMG/M |
3300005616|Ga0068852_100712099 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1014 | Open in IMG/M |
3300005843|Ga0068860_102191067 | Not Available | 574 | Open in IMG/M |
3300006028|Ga0070717_10609413 | Not Available | 990 | Open in IMG/M |
3300006163|Ga0070715_10242480 | Not Available | 938 | Open in IMG/M |
3300006174|Ga0075014_100502854 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 678 | Open in IMG/M |
3300006176|Ga0070765_100440040 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1220 | Open in IMG/M |
3300006237|Ga0097621_101577369 | Not Available | 624 | Open in IMG/M |
3300006804|Ga0079221_10411017 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 843 | Open in IMG/M |
3300006953|Ga0074063_14284414 | Not Available | 503 | Open in IMG/M |
3300006954|Ga0079219_10010351 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 3102 | Open in IMG/M |
3300009098|Ga0105245_12876621 | Not Available | 534 | Open in IMG/M |
3300009520|Ga0116214_1311010 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 605 | Open in IMG/M |
3300009683|Ga0116224_10100765 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1400 | Open in IMG/M |
3300009698|Ga0116216_10347393 | Not Available | 902 | Open in IMG/M |
3300009700|Ga0116217_10151704 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Frankiales → Frankiaceae → Frankia → unclassified Frankia → Frankia sp. | 1548 | Open in IMG/M |
3300010047|Ga0126382_10910869 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 762 | Open in IMG/M |
3300010341|Ga0074045_10330333 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 996 | Open in IMG/M |
3300010359|Ga0126376_11491938 | Not Available | 704 | Open in IMG/M |
3300010373|Ga0134128_12057863 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 629 | Open in IMG/M |
3300010401|Ga0134121_13274286 | Not Available | 501 | Open in IMG/M |
3300012207|Ga0137381_10273501 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1469 | Open in IMG/M |
3300012922|Ga0137394_10541532 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 987 | Open in IMG/M |
3300012929|Ga0137404_10466948 | Not Available | 1122 | Open in IMG/M |
3300012929|Ga0137404_10583016 | Not Available | 1004 | Open in IMG/M |
3300012989|Ga0164305_11807571 | Not Available | 552 | Open in IMG/M |
3300013296|Ga0157374_10998981 | Not Available | 856 | Open in IMG/M |
3300015371|Ga0132258_11410821 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Thermomonospora → Thermomonospora curvata | 1759 | Open in IMG/M |
3300016319|Ga0182033_11291491 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 655 | Open in IMG/M |
3300016445|Ga0182038_10773270 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 840 | Open in IMG/M |
3300017924|Ga0187820_1220106 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 599 | Open in IMG/M |
3300017933|Ga0187801_10453541 | Not Available | 538 | Open in IMG/M |
3300017937|Ga0187809_10187636 | Not Available | 729 | Open in IMG/M |
3300017959|Ga0187779_10504780 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 800 | Open in IMG/M |
3300017974|Ga0187777_11177162 | Not Available | 560 | Open in IMG/M |
3300017994|Ga0187822_10182500 | Not Available | 691 | Open in IMG/M |
3300018037|Ga0187883_10685163 | Not Available | 535 | Open in IMG/M |
3300018038|Ga0187855_10585073 | Not Available | 650 | Open in IMG/M |
3300018044|Ga0187890_10182042 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1195 | Open in IMG/M |
3300018085|Ga0187772_11350169 | Not Available | 528 | Open in IMG/M |
3300018433|Ga0066667_10557666 | Not Available | 951 | Open in IMG/M |
3300020170|Ga0179594_10351991 | Not Available | 559 | Open in IMG/M |
3300020581|Ga0210399_10407854 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1133 | Open in IMG/M |
3300021171|Ga0210405_10129703 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1993 | Open in IMG/M |
3300021180|Ga0210396_11344746 | Not Available | 593 | Open in IMG/M |
3300021374|Ga0213881_10564288 | Not Available | 518 | Open in IMG/M |
3300021401|Ga0210393_11106540 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 639 | Open in IMG/M |
3300021432|Ga0210384_11259064 | Not Available | 644 | Open in IMG/M |
3300021432|Ga0210384_11602968 | Not Available | 556 | Open in IMG/M |
3300021478|Ga0210402_11857509 | Not Available | 528 | Open in IMG/M |
3300021560|Ga0126371_13689625 | Not Available | 516 | Open in IMG/M |
3300025898|Ga0207692_10466329 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 797 | Open in IMG/M |
3300025901|Ga0207688_10185817 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1241 | Open in IMG/M |
3300025901|Ga0207688_10335883 | Not Available | 929 | Open in IMG/M |
3300025912|Ga0207707_10317598 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1345 | Open in IMG/M |
3300025915|Ga0207693_10704374 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 782 | Open in IMG/M |
3300025916|Ga0207663_11228349 | Not Available | 603 | Open in IMG/M |
3300025924|Ga0207694_10961131 | Not Available | 723 | Open in IMG/M |
3300025928|Ga0207700_10241159 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1541 | Open in IMG/M |
3300027504|Ga0209114_1110285 | Not Available | 514 | Open in IMG/M |
3300027696|Ga0208696_1232856 | Not Available | 576 | Open in IMG/M |
3300027824|Ga0209040_10352493 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 698 | Open in IMG/M |
3300027895|Ga0209624_10632480 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 709 | Open in IMG/M |
3300028047|Ga0209526_10374324 | Not Available | 950 | Open in IMG/M |
3300028536|Ga0137415_11025920 | Not Available | 637 | Open in IMG/M |
3300028781|Ga0302223_10224757 | Not Available | 619 | Open in IMG/M |
3300028808|Ga0302228_10097163 | Not Available | 1381 | Open in IMG/M |
3300028828|Ga0307312_11122936 | Not Available | 520 | Open in IMG/M |
3300028877|Ga0302235_10146111 | Not Available | 1056 | Open in IMG/M |
3300028879|Ga0302229_10044934 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2229 | Open in IMG/M |
3300028879|Ga0302229_10154578 | Not Available | 1061 | Open in IMG/M |
3300028879|Ga0302229_10421175 | Not Available | 593 | Open in IMG/M |
3300029999|Ga0311339_10160960 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2615 | Open in IMG/M |
3300030007|Ga0311338_11945199 | Not Available | 524 | Open in IMG/M |
3300030056|Ga0302181_10364048 | Not Available | 629 | Open in IMG/M |
3300030503|Ga0311370_11048029 | Not Available | 903 | Open in IMG/M |
3300030509|Ga0302183_10194829 | Not Available | 791 | Open in IMG/M |
3300030524|Ga0311357_10107185 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2793 | Open in IMG/M |
3300030524|Ga0311357_10523632 | Not Available | 1101 | Open in IMG/M |
3300030524|Ga0311357_11031946 | Not Available | 721 | Open in IMG/M |
3300031233|Ga0302307_10115640 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1400 | Open in IMG/M |
3300031525|Ga0302326_10896927 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1261 | Open in IMG/M |
3300031525|Ga0302326_12551333 | Not Available | 640 | Open in IMG/M |
3300031525|Ga0302326_12847057 | Not Available | 596 | Open in IMG/M |
3300031778|Ga0318498_10071567 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae | 1558 | Open in IMG/M |
3300031781|Ga0318547_11027926 | Not Available | 515 | Open in IMG/M |
3300031996|Ga0308176_12174449 | Not Available | 593 | Open in IMG/M |
3300032001|Ga0306922_12090450 | Not Available | 549 | Open in IMG/M |
3300032008|Ga0318562_10706712 | Not Available | 579 | Open in IMG/M |
3300032160|Ga0311301_11582534 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 799 | Open in IMG/M |
3300032893|Ga0335069_11071039 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 890 | Open in IMG/M |
3300032897|Ga0335071_11296988 | Not Available | 673 | Open in IMG/M |
3300032898|Ga0335072_11662643 | Not Available | 535 | Open in IMG/M |
3300033158|Ga0335077_12046814 | Not Available | 530 | Open in IMG/M |
3300033158|Ga0335077_12233838 | Not Available | 502 | Open in IMG/M |
3300034163|Ga0370515_0362775 | Not Available | 612 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 17.31% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 9.62% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 6.73% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 5.77% |
Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 5.77% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 4.81% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 3.85% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 2.88% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 2.88% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.88% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.88% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 2.88% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 2.88% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.92% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.92% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.92% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.92% |
Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 1.92% |
Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.96% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.96% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.96% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.96% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.96% |
Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 0.96% |
Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.96% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.96% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.96% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.96% |
Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.96% |
Exposed Rock | Environmental → Terrestrial → Rock-Dwelling (Subaerial Biofilms) → Unclassified → Unclassified → Exposed Rock | 0.96% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.96% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.96% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 0.96% |
Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.96% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.96% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.96% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.96% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.96% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300005167 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 | Environmental | Open in IMG/M |
3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Host-Associated | Open in IMG/M |
3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
3300005450 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 | Environmental | Open in IMG/M |
3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Host-Associated | Open in IMG/M |
3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Host-Associated | Open in IMG/M |
3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
3300006174 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014 | Environmental | Open in IMG/M |
3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
3300006953 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
3300009520 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaG | Environmental | Open in IMG/M |
3300009683 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_b_LC metaG | Environmental | Open in IMG/M |
3300009698 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG | Environmental | Open in IMG/M |
3300009700 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG | Environmental | Open in IMG/M |
3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
3300010341 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM2 | Environmental | Open in IMG/M |
3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
3300017924 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_5 | Environmental | Open in IMG/M |
3300017933 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_1 | Environmental | Open in IMG/M |
3300017937 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_4 | Environmental | Open in IMG/M |
3300017959 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG | Environmental | Open in IMG/M |
3300017974 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MG | Environmental | Open in IMG/M |
3300017994 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_2 | Environmental | Open in IMG/M |
3300018037 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_10 | Environmental | Open in IMG/M |
3300018038 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_10 | Environmental | Open in IMG/M |
3300018044 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_21_10 | Environmental | Open in IMG/M |
3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
3300020170 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
3300021374 | Barbacenia macrantha exposed rock microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - ER_R08 | Environmental | Open in IMG/M |
3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) | Host-Associated | Open in IMG/M |
3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) | Environmental | Open in IMG/M |
3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027504 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_RefH0_O3 (SPAdes) | Environmental | Open in IMG/M |
3300027696 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_b_LC metaG (SPAdes) | Environmental | Open in IMG/M |
3300027824 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM3 (SPAdes) | Environmental | Open in IMG/M |
3300027895 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 (SPAdes) | Environmental | Open in IMG/M |
3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300028781 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E2_3 | Environmental | Open in IMG/M |
3300028808 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N1_2 | Environmental | Open in IMG/M |
3300028828 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202 | Environmental | Open in IMG/M |
3300028877 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N3_3 | Environmental | Open in IMG/M |
3300028879 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N1_3 | Environmental | Open in IMG/M |
3300029999 | I_Palsa_E3 coassembly | Environmental | Open in IMG/M |
3300030007 | I_Palsa_E1 coassembly | Environmental | Open in IMG/M |
3300030056 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_3 | Environmental | Open in IMG/M |
3300030503 | III_Palsa_E3 coassembly | Environmental | Open in IMG/M |
3300030509 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_N3_2 | Environmental | Open in IMG/M |
3300030524 | II_Palsa_N3 coassembly | Environmental | Open in IMG/M |
3300031233 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E3_2 | Environmental | Open in IMG/M |
3300031525 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3 | Environmental | Open in IMG/M |
3300031778 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f24 | Environmental | Open in IMG/M |
3300031781 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20 | Environmental | Open in IMG/M |
3300031996 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2 | Environmental | Open in IMG/M |
3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
3300032008 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f18 | Environmental | Open in IMG/M |
3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
3300032893 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1 | Environmental | Open in IMG/M |
3300032897 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.5 | Environmental | Open in IMG/M |
3300032898 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1 | Environmental | Open in IMG/M |
3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
3300034163 | Peat soil microbial communities from wetlands in Alaska, United States - Goldstream_04D_14 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
Ga0066672_105109812 | 3300005167 | Soil | RIAEAERMGFRRVIVPAASGAPLERADGLAGLMQVQEVEDIRQALSAVLGAES* |
Ga0066388_1019962392 | 3300005332 | Tropical Forest Soil | FRRVIVPAASGAPLERTDGVSGLTQVQEVEDIRQALSAVLGAEP* |
Ga0070675_1005641932 | 3300005354 | Miscanthus Rhizosphere | AEAERMGFRRVIVPAASGAPLERADGLSHLMQVQEVEDIRQALSAVLGAEP* |
Ga0070709_111336453 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | AERMGFRRVIVPAASGAPLERADGLSHLMQVQEVEDIRQALSAVLGAEP* |
Ga0070714_1015443742 | 3300005435 | Agricultural Soil | IAEAERMGFRRVIVPAASGAPLERADGLSHLMQVQEVEDIRQALSAVLGAEP* |
Ga0066682_104358512 | 3300005450 | Soil | ERMGFRRVIVPAASGAPLERADGLTGPMQVQEVEDIRQALSAVLGAES* |
Ga0070678_1016668803 | 3300005456 | Miscanthus Rhizosphere | RVIVPAASGAPLERADGLSHLMQVQEVEDIRQALSAVLGAEP* |
Ga0066706_106867931 | 3300005598 | Soil | RVIVPAASGAPLERADGLSHLMQVQEVEDIRQPLSAVLGADP* |
Ga0068856_1011622373 | 3300005614 | Corn Rhizosphere | PAASGAPLERADGLSHLMQVQEVEDIRQALSAVLGAEP* |
Ga0068852_1007120993 | 3300005616 | Corn Rhizosphere | RMGFRRVIVPAASGAPLERADGLSHLMQVQEVEDIRQALSAVLGAEP* |
Ga0068860_1021910672 | 3300005843 | Switchgrass Rhizosphere | VIVPAASGAPLERADGLSHLMQVQEVEDIRQALSAVLGAESL* |
Ga0070717_106094131 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | AEAERMGFRRVIVPAASGAPLERADGLSHLMQVQEVEDIRQALSAVLGSHP* |
Ga0070715_102424801 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | GFRRVIVPAASGAPLERADGLAGLMQVQEVEDIRQALSAVLGAES* |
Ga0075014_1005028542 | 3300006174 | Watersheds | GAPLERADGLTHLMQVQEVEDIRQALSAVLGTDL* |
Ga0070765_1004400401 | 3300006176 | Soil | GAPLERVDGLPGLMQVQEVEDIRQALSAVLGADP* |
Ga0097621_1015773692 | 3300006237 | Miscanthus Rhizosphere | RVIVPAASGAPLERADGLTHLMQVQEVNDIRQALSAVLGGD* |
Ga0079221_104110173 | 3300006804 | Agricultural Soil | AERLGFRRVIVPAASGAPLERADGLAHLMKVEEVNDIRQALSAVLGGD* |
Ga0074063_142844142 | 3300006953 | Soil | ASGAPLERADGLSHLMQVQEVDDIRQALSAVLGAEP* |
Ga0079219_100103514 | 3300006954 | Agricultural Soil | IVPAASGAPLERADGLSHLMQVQEVEDIRQALSAVLGAEPLP* |
Ga0105245_128766211 | 3300009098 | Miscanthus Rhizosphere | LGFRRVIVPAASGAPLERADGLTHLMQVQEVNDIRQALSAVLGGD* |
Ga0116214_13110103 | 3300009520 | Peatlands Soil | AASGAPLERADGLTHLMQVQEVEDIRQALSAVLGTDL* |
Ga0116224_101007653 | 3300009683 | Peatlands Soil | LPRRLAEAERMGFRRVIVPAASGAPLERADGLTHLMQVQEVEDIRQALSAVLGTDL* |
Ga0116216_103473932 | 3300009698 | Peatlands Soil | SGAPLERADGLTHLMQVQEVEDIRQALSAVLGTDL* |
Ga0116217_101517043 | 3300009700 | Peatlands Soil | EAERMGFRRVIVPVASGAPLERADGLTHLMQVQEVEDIRQALSAVLGTEV* |
Ga0126382_109108691 | 3300010047 | Tropical Forest Soil | GAPLERADGLSHLMQVHEVEDIRRALSAVLGAEP* |
Ga0074045_103303332 | 3300010341 | Bog Forest Soil | LAEAERMGFRRVIVPAASGAPLERADGLTHLMQVQEVEDIRQALSAVLGTDL* |
Ga0126376_114919381 | 3300010359 | Tropical Forest Soil | ERLGFRRVIVPAASGAPLERADGLTHLMKVEEVNDIRQALSAVLGGD* |
Ga0134128_120578632 | 3300010373 | Terrestrial Soil | AASGAPLERADGLSHLMQVQEVEDIRQALSAVLGAEP* |
Ga0134121_132742861 | 3300010401 | Terrestrial Soil | ASGAPLERADGLSHLMQVQEVEDIRQALSAVLGAEP* |
Ga0137381_102735013 | 3300012207 | Vadose Zone Soil | VPAASGAPLERADGLAGPMQVQEVEDIRQALSAVLGAESL* |
Ga0137394_105415322 | 3300012922 | Vadose Zone Soil | AASGAPLERADGLSHLMHVQEVEDIRQALSAVLGAES* |
Ga0137404_104669482 | 3300012929 | Vadose Zone Soil | RIAEAERMGFRRVIVPAASGAPLERADGLSHLMQVQEVEDIRQALSAVLGAEP* |
Ga0137404_105830161 | 3300012929 | Vadose Zone Soil | IVPAASGAPLERADGLTHLMQVQEVNDIRQALSAVLGSD* |
Ga0164305_118075711 | 3300012989 | Soil | PAASGAPLERADGLSHLMQVLEVEDIRQALSAVLGSDL* |
Ga0157374_109989811 | 3300013296 | Miscanthus Rhizosphere | SGAPLERADGLSHLMEVQEVEDIRQALSAVLGAEP* |
Ga0132258_114108213 | 3300015371 | Arabidopsis Rhizosphere | EAERMGFRRVIVPAASGAPLERADGLSHLMRVEEVEDIRQALSAVLGAEPL* |
Ga0182033_112914912 | 3300016319 | Soil | PAASGAPLERADGLTHLMQVQEVEDIRQALSAVLGTAP |
Ga0182038_107732701 | 3300016445 | Soil | ASGAPMERTDGLSHPMQVQEVEDIRQALSAVLGTDP |
Ga0187820_12201061 | 3300017924 | Freshwater Sediment | ASGAPLERADGLTHLMQVQEVEDIRQALSAVLGTDL |
Ga0187801_104535411 | 3300017933 | Freshwater Sediment | RLAEAERMGFRRVIVPAASGAPLERADGLTHLMQVQEVEDIRQALSAVLGTAL |
Ga0187809_101876361 | 3300017937 | Freshwater Sediment | RRVIVPAASGAPLERADGLAHLMKVEEVNDIRQALSAVLGGD |
Ga0187779_105047802 | 3300017959 | Tropical Peatland | GFRRVIVPAASGAPLERADGLSHLMHVQEVEDIRQALSAVLGAEP |
Ga0187777_111771621 | 3300017974 | Tropical Peatland | PLERADGLSHLMQVQEVEDIRQALSAVLGGDGSDPR |
Ga0187822_101825002 | 3300017994 | Freshwater Sediment | EAERLGFRRVIVPAASGAPLERADGLSHLMQVQEVDDIRQALSAVLGAEP |
Ga0187883_106851631 | 3300018037 | Peatland | RMGFRRAIVPAASGGPLEPADGPSPLMQVVEVQDIRQALSAVLGTDL |
Ga0187855_105850731 | 3300018038 | Peatland | LAEAERMGFRRAIVPAASGGPLVPADGPSPLMQVVEVQDIRQALSAVLGTDL |
Ga0187890_101820423 | 3300018044 | Peatland | VVPAASGGPLEPADGPSPLMQVVEVQDIRQALSAVLGTDL |
Ga0187772_113501692 | 3300018085 | Tropical Peatland | FRRVIVPAASGAPLERADGLSHLMQVQEVEDIRQALSAVLGGDGSDPR |
Ga0066667_105576661 | 3300018433 | Grasslands Soil | MGFRRVIVPAASGAPLERADGLSHLMQVQEVEDIRQALSAVLGAEA |
Ga0179594_103519912 | 3300020170 | Vadose Zone Soil | AASGAPLERADGLSHLMQVQEVEDIRQALSAVLGAEP |
Ga0210399_104078542 | 3300020581 | Soil | IVPAASGAPLERADGLSHLMQVQEVEDIRQALSAVLGAEP |
Ga0210405_101297033 | 3300021171 | Soil | RRVIVPVASGAPLERADGLAGPMQVQEVEDIRQALSAVLGAEPL |
Ga0210396_113447462 | 3300021180 | Soil | AASGAPLERTDGLAGLMQVQEVEDIRQALSAVLGAESL |
Ga0213881_105642882 | 3300021374 | Exposed Rock | WRLAEAERLGFRRVIVPAASGAPLERADGLTHLMQVQEVNDIRQALSAVLGGD |
Ga0210393_111065402 | 3300021401 | Soil | ASGAPLERADGLSHLMQVHEVEDIRQALSAVLGTDL |
Ga0210384_112590641 | 3300021432 | Soil | RIAEAERMGFRRVIVPAASGAPLERADGLAGLMQVQEVEDIRQALSAVLGAEA |
Ga0210384_116029681 | 3300021432 | Soil | RLAEAERMGFRRVIVPAASGAPLERADGLTHLMQVQEVEDIRQALSAVLGTDP |
Ga0210402_118575091 | 3300021478 | Soil | SGAPLERADGLAGLMQVQEVEDIRQALSAVLGAEA |
Ga0126371_136896251 | 3300021560 | Tropical Forest Soil | EAERMGFRRVIVPAASGAPLERADGLSHLMKVQEVEDIRQALSAVLGAEPL |
Ga0207692_104663291 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | AEAERMGFRRVIVPAASGAPLERADGLSHLMQVQEVEDIRQALSAVLGAEP |
Ga0207688_101858171 | 3300025901 | Corn, Switchgrass And Miscanthus Rhizosphere | ASGAPLERADGLSHLTQVQEVEDIRQALSAVLGAEP |
Ga0207688_103358831 | 3300025901 | Corn, Switchgrass And Miscanthus Rhizosphere | ASGAPLERADGLSHLMQVQEVEDIRQALSAVLGAEP |
Ga0207707_103175982 | 3300025912 | Corn Rhizosphere | VPAASGAPLERADGLSHLMQVQEVEDIRQALSAVLGAEP |
Ga0207693_107043741 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | RMGFRRVIVPAASGAPLERADGLSHLMQVQEVEDIRQALSAVLGAEP |
Ga0207663_112283491 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | RLGFRRVIVPAASGAPLERADGLTHLMQVQEVNDIRQALSAVLGGD |
Ga0207694_109611311 | 3300025924 | Corn Rhizosphere | SGAPLERADGLSHLMQVQEVEDIRQALSAVLGAEP |
Ga0207700_102411591 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | FRRVIVPAASGAPLERADGLAGPMQVQEVEDIRQALSAVLGAESL |
Ga0209114_11102852 | 3300027504 | Forest Soil | AIVPMASGGPLERAEGLPHQMEVVEVEDVRQALSAVLGSVP |
Ga0208696_12328562 | 3300027696 | Peatlands Soil | LPRRLAEAERMGFRRVIVPAASGAPLERADGLTHLMQVQEVEDIRQALSAVLGTDL |
Ga0209040_103524932 | 3300027824 | Bog Forest Soil | PAASGAPLERADGLSHLMQVREVEDIRQALSAVLGTDL |
Ga0209624_106324802 | 3300027895 | Forest Soil | RLAEAERMGFRRAIVPAGPADPAGPADPGGPAGPTGSLQVVGVQDVRQALSAVLGTDLLPVELDR |
Ga0209526_103743242 | 3300028047 | Forest Soil | RLAEAERMGFRRVIVPMASGAPLERADGLSHLMKVEEVEDIRQALSAVLGTDLR |
Ga0137415_110259201 | 3300028536 | Vadose Zone Soil | AERMGFRRVIVPAASGAPLERADGVSGPTQVQEVEDIRQALSAVLGADP |
Ga0302223_102247571 | 3300028781 | Palsa | AERMGFRRAIVPAASGGPLEPADGPSPLMQVVEVQDIRQALSAVLGTDL |
Ga0302228_100971631 | 3300028808 | Palsa | RAIVPAASGGPLEPADGPSPLMQVIEVQDIRQALSAVLGTDL |
Ga0307312_111229361 | 3300028828 | Soil | VIVPAASGAPLERVDGPSSLMQVQEVEDIRQALSAVLGADP |
Ga0302235_101461111 | 3300028877 | Palsa | ASGGPLEPADGPSPLMQVVEVQDIRQALSAVLGTDL |
Ga0302229_100449341 | 3300028879 | Palsa | AASGGPLEPADGPSPLMQVVEVQDIRQALSAVLGTDL |
Ga0302229_101545781 | 3300028879 | Palsa | IVPAASGGPLEPADGPSPLMQVVEVQDIRQALSAVLGTDL |
Ga0302229_104211751 | 3300028879 | Palsa | LPQRLAEAERMGFRRAIVPAASGGPLEPADGPSPLMQVVEVQDIRQALSAVLGTDL |
Ga0311339_101609601 | 3300029999 | Palsa | RAIVPAASGGPLEPADGPSPLMQVVEVQDIRQALSAVLGTDL |
Ga0311338_119451992 | 3300030007 | Palsa | EAERMGFRRAIVPAASGGPLEPADGPSPLMQVVEVQDIRQALSAVLGTDL |
Ga0302181_103640482 | 3300030056 | Palsa | LTQRLAEAERLGFRRAIVPAASGEPLDRADGSASAMEVVEVADVRQALSAVLGTTP |
Ga0311370_110480292 | 3300030503 | Palsa | AEAERMGFRRAIVPAASGGPLEPADGPSPLMQVVEVQDIRQALSAVLGTDL |
Ga0302183_101948292 | 3300030509 | Palsa | VPAASGGPLEPADGPSPLMQVVEVQDIRQALSAVLGTDL |
Ga0311357_101071854 | 3300030524 | Palsa | MGFRRAIVPAASGGPLEPADGPSPLMQVVEVQDIRQALSAVLGTDL |
Ga0311357_105236321 | 3300030524 | Palsa | LAEAERMGFRRAIVPAASGGPLEPADGPSPLMQVVEVQDIRQALSAVLGTDL |
Ga0311357_110319461 | 3300030524 | Palsa | LGFRRAIVPAASGAPLDRADGSASAMEVVEVADVRQALSAVLGTTP |
Ga0302307_101156401 | 3300031233 | Palsa | RRAIVPAASGGPLEPADGPSPLMQVVEVQDIRQALSAVLGTDL |
Ga0302326_108969271 | 3300031525 | Palsa | IVPAASGAPLDRADGSASAMEVVEVADVRQALSAVLGTTP |
Ga0302326_125513331 | 3300031525 | Palsa | ALSQRLAEAERMGFRHAIVPAASGGILEHAEGPSRVMEVHEVQDIRQALSAVLGTTSGD |
Ga0302326_128470571 | 3300031525 | Palsa | GFRRAIVPAASGGPLEPADGPSPLMQVVEVQDIRQALSAVLGTDL |
Ga0318498_100715673 | 3300031778 | Soil | PAASGAPLERADGLSHLMRVEEVEDIRQALSAVLGAEPL |
Ga0318547_110279262 | 3300031781 | Soil | LPRRLAEAERMGFRRVIVPAASGAPMERTDGLSHPMQVQEVEDIRQALSAVLGTDP |
Ga0308176_121744491 | 3300031996 | Soil | IVPAASGAPLERVDGVSGLTQVQEVEDIRQALSAVLGAEP |
Ga0306922_120904502 | 3300032001 | Soil | ASGAPLERADGLTHLMQVQEVEDIRQALSAVLGSDV |
Ga0318562_107067122 | 3300032008 | Soil | VIVPAASGAPLERADGLSHLMQVEEVEDIRQALSAVLGAEPQ |
Ga0311301_115825341 | 3300032160 | Peatlands Soil | VPAASGAPLERADGLTHLMQVQEVEDIRQALSAVLGTDL |
Ga0335069_110710392 | 3300032893 | Soil | SGAPLERADGLSHLMQVQEVEDIRQALSAVLGADP |
Ga0335071_112969882 | 3300032897 | Soil | AEAERMGFRRVIVPAASGAPLERADGLSHLMRVEEVEDIRQALSAVLGAEPL |
Ga0335072_116626431 | 3300032898 | Soil | SGAPLERVDGVSGLTQVQEVEDIRQALSAVLGAEP |
Ga0335077_120468142 | 3300033158 | Soil | FRRVIVPAASGAPLERADGLSHLMQVEEVEDIRQALSAVLGAEPL |
Ga0335077_122338382 | 3300033158 | Soil | VIVPAASGAPLERTDGLAGLMQVQEVDDIRQALSAVLGAESL |
Ga0370515_0362775_490_612 | 3300034163 | Untreated Peat Soil | IVPAASGGSLEPADGSSQLMEVQEVQDIRQALSAVLGTDL |
⦗Top⦘ |