NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F098095

Metagenome Family F098095

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F098095
Family Type Metagenome
Number of Sequences 104
Average Sequence Length 81 residues
Representative Sequence MIDAFVVEVGALCEEPGEQLGTLVEVQRTERFRISALSPAAAETAGMQLFSAEATRRGRLVRDAWARAGLQAPDAPALH
Number of Associated Samples 93
Number of Associated Scaffolds 104

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 27.88 %
% of genes near scaffold ends (potentially truncated) 34.62 %
% of genes from short scaffolds (< 2000 bps) 93.27 %
Associated GOLD sequencing projects 87
AlphaFold2 3D model prediction No

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (68.269 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil
(49.038 % of family members)
Environment Ontology (ENVO) Unclassified
(47.115 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(55.769 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 27.85%    β-sheet: 25.32%    Coil/Unstructured: 46.84%
Feature Viewer
Powered by Feature Viewer

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 104 Family Scaffolds
PF00248Aldo_ket_red 38.46
PF14833NAD_binding_11 17.31
PF06737Transglycosylas 2.88
PF09335SNARE_assoc 0.96

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 104 Family Scaffolds
COG0398Uncharacterized membrane protein YdjX, related to fungal oxalate transporter, TVP38/TMEM64 familyFunction unknown [S] 0.96
COG0586Membrane integrity protein DedA, putative transporter, DedA/Tvp38 familyCell wall/membrane/envelope biogenesis [M] 0.96
COG1238Uncharacterized membrane protein YqaA, VTT domainFunction unknown [S] 0.96

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms68.27 %
UnclassifiedrootN/A31.73 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300001305|C688J14111_10039990All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces1409Open in IMG/M
3300001686|C688J18823_10045106All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter3045Open in IMG/M
3300004153|Ga0063455_100126623Not Available1119Open in IMG/M
3300004479|Ga0062595_100908115Not Available743Open in IMG/M
3300004643|Ga0062591_100995789All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces797Open in IMG/M
3300005347|Ga0070668_100563343All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura993Open in IMG/M
3300005355|Ga0070671_101809380All Organisms → cellular organisms → Bacteria543Open in IMG/M
3300005434|Ga0070709_10820745All Organisms → cellular organisms → Bacteria731Open in IMG/M
3300005456|Ga0070678_101194736All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura705Open in IMG/M
3300005614|Ga0068856_101033689Not Available840Open in IMG/M
3300005615|Ga0070702_101289251All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycolicibacterium → Mycolicibacterium litorale593Open in IMG/M
3300005874|Ga0075288_1039499Not Available713Open in IMG/M
3300006163|Ga0070715_10845837Not Available559Open in IMG/M
3300006954|Ga0079219_12310492All Organisms → cellular organisms → Bacteria520Open in IMG/M
3300009093|Ga0105240_12611993All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura522Open in IMG/M
3300009098|Ga0105245_10985214Not Available887Open in IMG/M
3300010401|Ga0134121_11198743Not Available759Open in IMG/M
3300010403|Ga0134123_12490850All Organisms → cellular organisms → Bacteria583Open in IMG/M
3300011000|Ga0138513_100073836Not Available527Open in IMG/M
3300012360|Ga0137375_10584154Not Available933Open in IMG/M
3300012903|Ga0157289_10209156All Organisms → cellular organisms → Bacteria641Open in IMG/M
3300012961|Ga0164302_11585538Not Available544Open in IMG/M
3300012985|Ga0164308_10960066All Organisms → cellular organisms → Bacteria757Open in IMG/M
3300012988|Ga0164306_11430499All Organisms → cellular organisms → Bacteria589Open in IMG/M
3300012989|Ga0164305_11797618All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura553Open in IMG/M
3300013105|Ga0157369_10895124All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria910Open in IMG/M
3300015077|Ga0173483_10134245All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1074Open in IMG/M
3300015372|Ga0132256_100456635All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1385Open in IMG/M
3300015372|Ga0132256_103880225All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycolicibacterium → Mycolicibacterium litorale503Open in IMG/M
3300015373|Ga0132257_101866444All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → environmental samples → uncultured Solirubrobacteraceae bacterium773Open in IMG/M
3300017965|Ga0190266_10275971Not Available860Open in IMG/M
3300017965|Ga0190266_10917967Not Available577Open in IMG/M
3300018028|Ga0184608_10084127All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1308Open in IMG/M
3300018061|Ga0184619_10364725Not Available658Open in IMG/M
3300018066|Ga0184617_1045027All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → environmental samples → uncultured Solirubrobacteraceae bacterium1102Open in IMG/M
3300018066|Ga0184617_1137005Not Available709Open in IMG/M
3300018081|Ga0184625_10482857All Organisms → cellular organisms → Bacteria629Open in IMG/M
3300019361|Ga0173482_10140180All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces929Open in IMG/M
3300019362|Ga0173479_10171750Not Available888Open in IMG/M
3300019767|Ga0190267_11548487All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces514Open in IMG/M
3300019867|Ga0193704_1018674All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales1408Open in IMG/M
3300019873|Ga0193700_1018794All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → environmental samples → uncultured Solirubrobacteraceae bacterium1140Open in IMG/M
3300019875|Ga0193701_1009931All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae1878Open in IMG/M
3300022886|Ga0247746_1069727All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → environmental samples → uncultured Solirubrobacteraceae bacterium830Open in IMG/M
3300024055|Ga0247794_10222421All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → environmental samples → uncultured Solirubrobacteraceae bacterium616Open in IMG/M
3300025927|Ga0207687_11935052Not Available504Open in IMG/M
3300025931|Ga0207644_11053808All Organisms → cellular organisms → Bacteria683Open in IMG/M
3300025972|Ga0207668_10529647All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura1018Open in IMG/M
3300026023|Ga0207677_11446600All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura634Open in IMG/M
3300026088|Ga0207641_10783574Not Available943Open in IMG/M
3300026118|Ga0207675_102394370Not Available540Open in IMG/M
3300026121|Ga0207683_11277744Not Available680Open in IMG/M
3300028587|Ga0247828_11101137All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura526Open in IMG/M
3300028590|Ga0247823_10827707All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura695Open in IMG/M
3300028596|Ga0247821_11223090Not Available511Open in IMG/M
3300028705|Ga0307276_10030637All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces1114Open in IMG/M
3300028707|Ga0307291_1011702All Organisms → cellular organisms → Bacteria1919Open in IMG/M
3300028710|Ga0307322_10024967All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1394Open in IMG/M
3300028711|Ga0307293_10009033All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales2743Open in IMG/M
3300028711|Ga0307293_10170106All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura694Open in IMG/M
3300028712|Ga0307285_10212570Not Available544Open in IMG/M
3300028714|Ga0307309_10058556All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycolicibacterium → Mycolicibacterium litorale854Open in IMG/M
3300028716|Ga0307311_10111003Not Available771Open in IMG/M
3300028718|Ga0307307_10122304Not Available803Open in IMG/M
3300028719|Ga0307301_10049985All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1285Open in IMG/M
3300028720|Ga0307317_10004193All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales4319Open in IMG/M
3300028720|Ga0307317_10154347Not Available771Open in IMG/M
3300028722|Ga0307319_10095672Not Available950Open in IMG/M
3300028755|Ga0307316_10168707All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces783Open in IMG/M
3300028768|Ga0307280_10195735Not Available713Open in IMG/M
3300028771|Ga0307320_10300570All Organisms → cellular organisms → Bacteria637Open in IMG/M
3300028778|Ga0307288_10233247All Organisms → cellular organisms → Bacteria717Open in IMG/M
3300028782|Ga0307306_10143199Not Available661Open in IMG/M
3300028787|Ga0307323_10052743Not Available1433Open in IMG/M
3300028791|Ga0307290_10025530All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales2078Open in IMG/M
3300028793|Ga0307299_10230271All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces696Open in IMG/M
3300028796|Ga0307287_10043145All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1641Open in IMG/M
3300028796|Ga0307287_10071855All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1291Open in IMG/M
3300028809|Ga0247824_10551007All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura687Open in IMG/M
3300028812|Ga0247825_10443250All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura920Open in IMG/M
3300028814|Ga0307302_10049618All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1953Open in IMG/M
3300028814|Ga0307302_10678422All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia512Open in IMG/M
3300028819|Ga0307296_10140187All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → environmental samples → uncultured Solirubrobacteraceae bacterium1303Open in IMG/M
3300028819|Ga0307296_10209664All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura1058Open in IMG/M
3300028828|Ga0307312_10105710Not Available1750Open in IMG/M
3300028828|Ga0307312_10803659All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura623Open in IMG/M
3300028875|Ga0307289_10155725Not Available939Open in IMG/M
3300028875|Ga0307289_10223453All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces774Open in IMG/M
3300028878|Ga0307278_10037979All Organisms → cellular organisms → Bacteria2194Open in IMG/M
3300028880|Ga0307300_10061899Not Available1077Open in IMG/M
3300028881|Ga0307277_10551301All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces517Open in IMG/M
3300028885|Ga0307304_10088160All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura1220Open in IMG/M
3300030336|Ga0247826_10059380All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2185Open in IMG/M
3300030336|Ga0247826_10102199All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1786Open in IMG/M
3300031152|Ga0307501_10071184All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria824Open in IMG/M
3300031164|Ga0307502_10000391All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales11677Open in IMG/M
3300031547|Ga0310887_10344282All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces863Open in IMG/M
3300031854|Ga0310904_10387191All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces912Open in IMG/M
3300031938|Ga0308175_102117671All Organisms → cellular organisms → Bacteria631Open in IMG/M
3300031996|Ga0308176_12113145All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces601Open in IMG/M
3300032002|Ga0307416_103299076Not Available540Open in IMG/M
3300032074|Ga0308173_10150684All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales1881Open in IMG/M
3300032075|Ga0310890_11557903Not Available546Open in IMG/M
3300034384|Ga0372946_0054642All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces1814Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil49.04%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil12.50%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment4.81%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere3.85%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil2.88%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere2.88%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil1.92%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil1.92%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil1.92%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere1.92%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere1.92%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.92%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere1.92%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil0.96%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil0.96%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil0.96%
Rice Paddy SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil0.96%
SoilEnvironmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil0.96%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.96%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere0.96%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere0.96%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere0.96%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.96%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.96%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300001305Grasslands soil microbial communities from Hopland, California, USAEnvironmentalOpen in IMG/M
3300001686Grasslands soil microbial communities from Hopland, California, USAEnvironmentalOpen in IMG/M
3300004153Grasslands soil microbial communities from Hopland, California, USA (version 2)EnvironmentalOpen in IMG/M
3300004479Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAsEnvironmentalOpen in IMG/M
3300004643Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3EnvironmentalOpen in IMG/M
3300005347Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaGHost-AssociatedOpen in IMG/M
3300005355Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaGHost-AssociatedOpen in IMG/M
3300005434Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaGEnvironmentalOpen in IMG/M
3300005456Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaGHost-AssociatedOpen in IMG/M
3300005614Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2Host-AssociatedOpen in IMG/M
3300005615Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaGEnvironmentalOpen in IMG/M
3300005874Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_0N_404EnvironmentalOpen in IMG/M
3300006163Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaGEnvironmentalOpen in IMG/M
3300006954Agricultural soil microbial communities from Georgia to study Nitrogen management - GA ControlEnvironmentalOpen in IMG/M
3300009093Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaGHost-AssociatedOpen in IMG/M
3300009098Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaGHost-AssociatedOpen in IMG/M
3300010401Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1EnvironmentalOpen in IMG/M
3300010403Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3EnvironmentalOpen in IMG/M
3300011000Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t6i015EnvironmentalOpen in IMG/M
3300012360Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaGEnvironmentalOpen in IMG/M
3300012903Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S134-311R-1EnvironmentalOpen in IMG/M
3300012961Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MGEnvironmentalOpen in IMG/M
3300012985Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MGEnvironmentalOpen in IMG/M
3300012988Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MGEnvironmentalOpen in IMG/M
3300012989Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MGEnvironmentalOpen in IMG/M
3300013105Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaGHost-AssociatedOpen in IMG/M
3300015077Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S178-409R-2 (version 2)EnvironmentalOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300017965Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 220 TEnvironmentalOpen in IMG/M
3300018028Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coexEnvironmentalOpen in IMG/M
3300018061Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_b1EnvironmentalOpen in IMG/M
3300018066Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5_b1EnvironmentalOpen in IMG/M
3300018081Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b1EnvironmentalOpen in IMG/M
3300019361Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2)EnvironmentalOpen in IMG/M
3300019362Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S104-311B-1 (version 2)EnvironmentalOpen in IMG/M
3300019767Populus adjacent soil microbial communities from riparian zone of Oak Creek, Arizona, USA - 239 TEnvironmentalOpen in IMG/M
3300019867Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3m1EnvironmentalOpen in IMG/M
3300019873Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3s1EnvironmentalOpen in IMG/M
3300019875Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3s2EnvironmentalOpen in IMG/M
3300022886Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S079-202R-5EnvironmentalOpen in IMG/M
3300024055Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S046-202B-6EnvironmentalOpen in IMG/M
3300025927Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025931Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025972Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026023Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026088Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026118Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026121Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300028587Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day3EnvironmentalOpen in IMG/M
3300028590Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_PalmiticAcid_Day30EnvironmentalOpen in IMG/M
3300028596Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Glycerol_Day14EnvironmentalOpen in IMG/M
3300028705Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_115EnvironmentalOpen in IMG/M
3300028707Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_148EnvironmentalOpen in IMG/M
3300028710Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_380EnvironmentalOpen in IMG/M
3300028711Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_150EnvironmentalOpen in IMG/M
3300028712Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_139EnvironmentalOpen in IMG/M
3300028714Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_196EnvironmentalOpen in IMG/M
3300028716Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_198EnvironmentalOpen in IMG/M
3300028718Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_194EnvironmentalOpen in IMG/M
3300028719Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_182EnvironmentalOpen in IMG/M
3300028720Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_357EnvironmentalOpen in IMG/M
3300028722Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_368EnvironmentalOpen in IMG/M
3300028755Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_356EnvironmentalOpen in IMG/M
3300028768Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_119EnvironmentalOpen in IMG/M
3300028771Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_369EnvironmentalOpen in IMG/M
3300028778Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_142EnvironmentalOpen in IMG/M
3300028782Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_193EnvironmentalOpen in IMG/M
3300028787Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_381EnvironmentalOpen in IMG/M
3300028791Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_144EnvironmentalOpen in IMG/M
3300028793Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_159EnvironmentalOpen in IMG/M
3300028796Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_141EnvironmentalOpen in IMG/M
3300028809Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_PalmiticAcid_Day48EnvironmentalOpen in IMG/M
3300028812Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Vanillin_Day48EnvironmentalOpen in IMG/M
3300028814Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_183EnvironmentalOpen in IMG/M
3300028819Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_153EnvironmentalOpen in IMG/M
3300028828Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202EnvironmentalOpen in IMG/M
3300028875Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_143EnvironmentalOpen in IMG/M
3300028878Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_117EnvironmentalOpen in IMG/M
3300028880Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_181EnvironmentalOpen in IMG/M
3300028881Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_116EnvironmentalOpen in IMG/M
3300028885Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_185EnvironmentalOpen in IMG/M
3300030336Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day1EnvironmentalOpen in IMG/M
3300031152Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 15_SEnvironmentalOpen in IMG/M
3300031164Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 16_SEnvironmentalOpen in IMG/M
3300031547Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D4EnvironmentalOpen in IMG/M
3300031854Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D1EnvironmentalOpen in IMG/M
3300031938Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1EnvironmentalOpen in IMG/M
3300031996Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2EnvironmentalOpen in IMG/M
3300032002Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3Host-AssociatedOpen in IMG/M
3300032074Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R1EnvironmentalOpen in IMG/M
3300032075Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3EnvironmentalOpen in IMG/M
3300034384Forest soil microbial communities from Eldorado National Forest, California, USA - SNFC_MG_KNG_2.2EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
C688J14111_1003999013300001305SoilMLGPMIDAFVVEVGALCEEPGEQLGTLVEVQRTERFRISALSPAAAETAGMQLFSAEATRRRRLVRDAWVRAGLQPPDAPALH*
C688J18823_1004510643300001686SoilMLGPMIDAFVVEVGALCEEPGEQLGTLVEVQRTERFRISALSPAAAETAGMQLFSAEATRRGRLVRDAWVRAGLQAPDAPALH*
Ga0063455_10012662313300004153SoilMLGPMIDAFVVEVGALCEEPGEQLGTLVEVQRTERFRISALSPAAAETAGMQLFSAESTRRGRLVRDAWVRAGLQAPDTPALH*
Ga0062595_10090811523300004479SoilMIDAFVVEVGALCEEPGEQLGTLVAVQRTERFRISALSPAAAETAGMQLFSAEATRRGRLVRDPWARAGVQAADEPVLR*
Ga0062591_10099578923300004643SoilMLGPMIDAFVVEVGALCEEPGEQLGTLVAVQRTERFRISALSPAAAETAGMQLFSAEATRRGRLVRDPWVRAGLQAGEAPALP*
Ga0070668_10056334323300005347Switchgrass RhizosphereEEPGEQLGTLVAVQRTERFRISALSPAAAETAGMQLFSAEATRRGRLVRDPWARAGVQAADEPALR*
Ga0070671_10180938013300005355Switchgrass RhizosphereMIDAFVVEVGALCEEPGDQLGTLVAVQRTERFRISALSPAAAETAGMQLFSAEATRRRRLVRDPWVRAGLQTPDAPPLH*
Ga0070709_1082074513300005434Corn, Switchgrass And Miscanthus RhizosphereMIDAFVVEVGALCEEPGDQLGTRVAVQRTERFRISALSPAAAETAGMQLFSAEATRRRRLVRDPWVRAGLQTPDAPALH*
Ga0070678_10119473623300005456Miscanthus RhizosphereMIDAFLVEVGALCAEPGEQLGTLVEVQRTERFRIAALSPAAAETAGMQLFSAAAARERRLVRDPWARAGVQGPDEPALH*
Ga0068856_10103368923300005614Corn RhizosphereMIDAFVVEVGALCEEPGDQLGTLVAVQRTERFRISALSSAAAETAGMQLFSAQATRRRRLVRDPWVRAGLQTPDAPPL
Ga0070702_10128925113300005615Corn, Switchgrass And Miscanthus RhizosphereMLGPMIDAFVVEVGALCEEPGEQLGTLVAVQRTECFRISALSPAAAETAGMQLFSAEATRRRRLVRDPWVRAGLQTPDAPALH*
Ga0075288_103949913300005874Rice Paddy SoilMIDAFVVEVGALCEEPGEHLGTLVSVQRTERFRISALGSAAAETAGMQLFSAEATRRRRLVRDAWVHAGLQPPDAPSVP*
Ga0070715_1084583713300006163Corn, Switchgrass And Miscanthus RhizosphereMLGPVIDAFVVEVGALCEEPGDQLGTRVAVQRTERFRISALSPAAAETAGMQLFSAEATRRRRLVRDPWVRAGLQTPDAPALH*
Ga0079219_1231049223300006954Agricultural SoilMLGPMIDAFVVEVGALCEEPGDQLGTRVAVQRTERFRISALSPAAAETAGMQLFSAEATRRRRLVRDPWVRAGLQTPDAPALH*
Ga0105240_1261199313300009093Corn RhizosphereMIDAFVVEVGALCEEPGEQLGTLVAVQRTERFRISALSPAAAETAGMQLFSAEATRRGRLVRDPWARAGVQAADEPALR*
Ga0105245_1098521413300009098Miscanthus RhizosphereMLGPMIDAFVVEVGALCEEPGDQLGTLVAVQRTERFRISALSPAAAETAGMQLFSAEATRRGRLVRDPWARAG
Ga0134121_1119874323300010401Terrestrial SoilMIDAFVVEVGALCEEPGEQLGTLVAVQRTERFRISALSPAAAETAGMQLFSAEATRRGRLVRDPWARAGV
Ga0134123_1249085013300010403Terrestrial SoilPMIDAFVVEVGALCEEPGDQLGTRVAVQRTERFRISALSPAAAETAGMQLFSAEATRRRRLVRDPWVRAGLQTPEGPALH*
Ga0138513_10007383613300011000SoilMVDAFVVEVGALCEEPGEQLGTLVEVQRTERFRISAVSPAAAETAGMQLFSAEATRQRRLVRDAWARAGLHLPDAPA
Ga0137375_1058415413300012360Vadose Zone SoilMLAGMVDAFVVEVGAMCSEPGEELGTRVEVQRTERFRIAALGPAAAETAGMQLFSAAATRRRRLVRDPWARAGVQAPDAPALR*
Ga0157289_1020915623300012903SoilMLGPMIDAFVVEVGALCEEPGEQLGTLVEVQRTERFRISALSPAAAETAGMQLFSAEATRRRRLVRDAWVRAGLPAPEAPALH*
Ga0164302_1158553813300012961SoilMIDAFVVEVGALCEEPGEQLGTLVEVQRTERFRISALSPAAAETAGMQLFSAEATRRGRLVRDPWARAGVQAADEPALR*
Ga0164308_1096006623300012985SoilMLGPMIDAFVVEVGALCAEPGEQMGMLVEVQRTERFRISALSPAAAETAGMQLFSAEASRRRRLVRDPWVRAGLQAPEAPALP*
Ga0164306_1143049913300012988SoilMLGPMIDAFVVEVGALCAEPGEQMGMLVEVQRTERFRISALSPAAAETAGMQLFSAEASRRRRLVRDPWVRAGLQAPGVP*
Ga0164305_1179761813300012989SoilMIDAFVVEVGALCEEPGEQLGTLVAVQRTERFRISALSPAAAETAGMQLFSAEATRRGRLVRDPWARAGVQAADEPALH*
Ga0157369_1089512423300013105Corn RhizosphereMIDAFVVEVGALCEEPGDQLGTLVAVQRTERFRISALSSAAAETAGMQLFSAQATRRRRLVRDPWVRAGLQTPDAPPLH*
Ga0173483_1013424523300015077SoilMLGPMIDAFVVEVGALCEEPGEQLGTLVEVQRTERFRISALSPAAAETAGMQLFSAEATRRGRLVRDPWVRAGLQAGEAPALP*
Ga0132256_10045663523300015372Arabidopsis RhizosphereMLAAMIDAFLVDVGGVCVEPGEQHGTLVEVQRTERFRLAALGAAAAETAGLQLFSAAASRNRGVVRDRWAEARDGALL*
Ga0132256_10388022523300015372Arabidopsis RhizosphereIDAFLVEVGALCEEPGEQLGTLVEVQRTECFRISALSPAAAETAGMQLFSAEATRRRRLVRDAWVRAGLQAPDAPALD*
Ga0132257_10186644413300015373Arabidopsis RhizosphereMLGPMIDAFVVEVGALCEEPGEQLGTLVAVRRTERFRISALSPAAAETAGMQLFSAEATRRGRLVRDAWVRAGLQTPDAPALH*
Ga0190266_1027597123300017965SoilMLGPMIEAFVVEVGALCEEPGEQLGTLVEVQRTERFRISALSPAAAETAGMQLFSAEATRRRRLVRDAWVRAGLQAPDAPAVR
Ga0190266_1091796713300017965SoilMLADMIDAFVVEVGALCEEPGDQLGTLVEVQRTESFRISALSPAAAETAGMQLFSAEATRRRRLVRDPWARAGL
Ga0184608_1008412723300018028Groundwater SedimentMVDAFVVEVGALCEEPGDQLGTLVEVQRTERFRISALSPAAAETAGMQLFSAEATRQRRLVRDAWARAGLHLPDAPVLH
Ga0184619_1036472513300018061Groundwater SedimentTYPLYLRSKRVPTDGPRREAGVTGDARPMVDAFVVEVGALCEEPGEQLGTLVEVQRTERFRISALSPAAAETAGMQLFSAEATRRRRIVRDPWVRAGLQTPDAPARH
Ga0184617_104502723300018066Groundwater SedimentMVDAFVVEVGALCEEPGEQLGTLVEVQRTERFRISALSPAAAETAGMQLFSAEATRQRRLVRDAWARAGLHMPDAPALR
Ga0184617_113700523300018066Groundwater SedimentMIDAFLVEVGAVCAEPGEQLGTLVEVQRTERFRIAALSPAAAETAGMQLFSAAAARQRRVVRDPWARAGLQGPDEPALH
Ga0184625_1048285713300018081Groundwater SedimentEAGSTDGPRREGGVTGDARPMVDAFVVEVGALCEEPGEQLGTLVEVQRTERFRISALSSAAAETAGMQLFSAEATRQRRLMRDAWVRARLPDAPALQ
Ga0173482_1014018013300019361SoilMIDAFVVEVGALCEEPGEQLCTLVAVQRTERFRISALSPAAAETAGMQLFSAEATRRRRLVRDAWVRAGLPAPEAPALH
Ga0173479_1017175013300019362SoilMLGPMIDAFVVEVGAMCEEPGEQLGTLVEVQRTERFRISALSPAAAETAGMQLFSAEATRRRRLVRDAWVRAGLPAPEAPALH
Ga0190267_1154848713300019767SoilVGALCEEPGEQLGTLVEVQRTERFRISALSPAAAETAGMQLFSAEAARQRRLVRDAWARAGLHVADAPALH
Ga0193704_101867423300019867SoilMVDAFVVEVGALCEEPGEQLGTLVEVQRTERFRISALSPAAAETAGMQLFSAEATRQRRLVRDAWVHAGLPDAPALH
Ga0193700_101879423300019873SoilVTGDARPMVDAFVVEVGALCEEPGEQLGTLVEVQRTERFRISALSPAAAETAGMQLFSAEATRQRRLVRDAWARAGLHMPDAPVLH
Ga0193701_100993133300019875SoilVTGDARPMVDAFVVEVGALCEEPGEQLGTLVEVQRTERFRISALSSAAAETAGMQLFSAEATRQRRLVRDAWVRAGLPDAPALH
Ga0247746_106972723300022886SoilMIDAFVVEVGALCEEPGEQLGTLVAVQRTERFRISALSPAAAETAGMQLFSAEATRRGRLVRDPWVRAGLQAGEAPALP
Ga0247794_1022242113300024055SoilEEPGEQLGTLVEVQRTERFRISALSPAAAETAGMQLFSAEATRRGRLVRDPWVRAGLQAGEAPALP
Ga0207687_1193505213300025927Miscanthus RhizosphereVPAAMLGPMIDAFVVEVGALCEEPGEQLGTLVAVQRTERFRISALSPAAAETAGMQLFSAEATRRGRLVRDPWARAG
Ga0207644_1105380823300025931Switchgrass RhizosphereMIDAFVVEVGALCEEPGDQLGTLVAVQRTERFRISALSPAAAETAGMQLFSAEATRRRRLVRDPWVRAGLQTPDAPALH
Ga0207668_1052964723300025972Switchgrass RhizosphereVVEVGALCEEPGEQLGTLVAVQRTERFRISALSPAAAETAGMQLFSAEATRRGRLVRDPWARAGVQAADEPALR
Ga0207677_1144660023300026023Miscanthus RhizospherePAGRGATRVPAAMLGPMIDAFVVEVGALCEEPGEQLGTLVAVQRTERFRISALSPAAAETAGMQLFSAEATRRGRLVRDPWARAGVQAADEPALR
Ga0207641_1078357413300026088Switchgrass RhizosphereMIDAFVVEVGALCEEPGEQLGTLVAVQRTERFRISALSPAAAETAGMQLFSAEATRRGRLVRDPWA
Ga0207675_10239437023300026118Switchgrass RhizosphereVPAAMLGPMIDAFVVEVGALCEEPGEQLGTLVAVQRTERFRISALSPAAAETAGMQLFSAEATRRGRLMRDPWARAGVQAPDEPALH
Ga0207683_1127774413300026121Miscanthus RhizosphereMIDAFLVEVGALCAEPGEQLGTLVEVQRTERFRIAALSPAAAETAGMQLFSAAAARERRLVRDPWARAGVQGPDEPALH
Ga0247828_1110113713300028587SoilAAMIDAFEVEVGAMCSEPGEQLGTLVEVERTERFRIAALSPAAAETAGMQLFSAAATRRRGLVRDPWARAGLQAADGPALH
Ga0247823_1082770713300028590SoilALCEEPGEQLGTLVAVQRTERFRISALSPAAAETAGMQLFSAEATRRGRLVRDPWARAGVQAADEPALH
Ga0247821_1122309013300028596SoilVPAAMLGPMIDAFVVEVGALCEEPGEQLGTLVAVQRTERFRISALSPAAAETAGMQLFSAEATRRGRLVRDPWARAGVQAADEPALL
Ga0307276_1003063723300028705SoilMVDAFVVEVGALCEEPGDQLGTLVEVQRTERFRISAVSPAAAETAGMQLFSAEATRQRRLVRDAWARAGLHLPDAPALH
Ga0307291_101170223300028707SoilMVDAFVVEVGALCEEPGDQLGTLVEVQRTERFRISAVSPAAAETAGMQLFSAEATRQRRLVRDAWARAGLHMPDAPVLH
Ga0307322_1002496733300028710SoilRAGRTYPLYLRSKRVPTDGPRREAGVTGDARPMVDAFVVEVGALCEEPGEQLGTLVEVQRTERFRISALSPAAAETAGMQLFSAEATRQRRLVRDAWVHAGLPDAPALH
Ga0307293_1000903343300028711SoilMVDAFVVEVGALCEEPGDQLGTLVEVQRTERFRISAVSPAAAETAGMQLFSAEATRQRRLVRDAWARAGLHLPDAPVLH
Ga0307293_1017010613300028711SoilMLAPMIDAFLVDVGAVCAEPGEQLGPLVEVQRTERFRIAALGPAAAETAGMQLFSAAAARQRRLVRDPWARAGLQAPDEPALH
Ga0307285_1021257013300028712SoilPAAMLAGMIDAFLVDVGGVCVEPGEQLGTLVEVQRTERFRIAALSPAAAETAGLQLFSAAAARKRGVVRDRWAEARDSALV
Ga0307309_1005855623300028714SoilMIDAFVVEVGALCEEPGEQLGTLVEVQRTERFRISALSPAAAETAGMQLFSAEATRRGRLVRDAWARAGLQAPDAPALH
Ga0307311_1011100313300028716SoilVTGDARPMVDAFVVEVGALCEEPGEQLGTLVEVQRTERFRISALSSAAAETAGMQLFSAEATRQRRLVRDAWVHAGLPDAPALH
Ga0307307_1012230413300028718SoilMLAPMIDAFLVDVGAVCAEPGEQLGTLVEVQRTERFRIAALGPAAAETAGMQLFSAAAARQRRLVRDPWARAGLQAPDEPALH
Ga0307301_1004998523300028719SoilMVDAFVVEVGALCEEPGEQLGTLVEVQRTERFRISALSSAAAETAGMQLFSAEATRQRRLVRDAWVRAGLPDAPALH
Ga0307317_1000419353300028720SoilMVDAFVVEVGALCEEPGEQLGTLVEVQRTERFRISALSPAAAETAGMQLFSAEATRQRRLVRDAWVRAGLPDAPALH
Ga0307317_1015434723300028720SoilMLAPMIDAFLVEVGALCAEPGEQLGTLVEVQRTERFRISALSPAAAETAGMQLFSAAAARQRRVVRDPWARAGAPDEPALH
Ga0307319_1009567213300028722SoilMIDAFLVEVGAVCSEPGEQLGTLVEVQRTERFRIAALSPAAAETAGMQLFSAAATRQRRLVRDPWARAGLQVPDEPALH
Ga0307316_1016870723300028755SoilLCEEPGEQLGTLVEVQRTERFRISALSPAAAETAGMQLFSAEATRQRRLVRDAWVRAGLPDAPALH
Ga0307280_1019573513300028768SoilMLDGMIDAFLVEVGAVCAEPGEQLGTLVEVQRTERFRIAALCPAAAETAGMQLFNAAAARQRRVVRDPWARAGLQGPDEPALH
Ga0307320_1030057013300028771SoilMIDAFLVEVGAVCSEPGEQLGTLVEVQRTERFRIAALSPAAAETAGMQLFSAAATRQRRLVRDPWARAGLQVPDEPALR
Ga0307288_1023324723300028778SoilMLGPMSDAFLVEVGALCEEPGEQLGTLVEVQRTERFRISALSPAAAETAGMQLFSAEATRRGRLVRDAWARAGLQAPDAPALH
Ga0307306_1014319913300028782SoilMLGSMSDAFLVEVGALCEEPGEQLGTLVEVQRTERFRISALSPAAAETAGMQLFSAEATRRGRLVRDAWARAGLQAPDAPALH
Ga0307323_1005274313300028787SoilMVDAFVVEVGALCEEPGEQLGTLVEVQRTERFRISALSPAAAETAGMQLFSAEATRQRRLVRDAWVHAGLPDGP
Ga0307290_1002553023300028791SoilMVDAFVVEVGALCEEPGEQLGTLVEVQRTERFRISALSSAAAETAGMQLFSAEATRQRRLVRDAWVRAGLPDGPPCTEPGPRAA
Ga0307299_1023027123300028793SoilPLYLRSKRVPTDGPRREAGVTGDARPMVDAFVVEVGALCEEPGDQLGTLVEVQRTERFRISAVSPAAAETAGMQLFSAEATRQRRLVRDAWARAGLHMPDAPVLH
Ga0307287_1004314533300028796SoilSAAMLGSMIDAFLVEVGAVCAEPGEQLGTLVEVQRTERFRIAALSSAAAETAGMQLFTAAAARQRRVVRDPWVRAGLQGPDEPALH
Ga0307287_1007185523300028796SoilMIDAFLVEVGAVCSEPGEQLGTLVEVQRTERFRIAALSPAAAETAGMQLFSAAATRQRRLVRDPWARAGLQAPDEPALH
Ga0247824_1055100713300028809SoilAMLAAMIDAFEVEVGAMCSEPGEQLGTLVEVERTERFRIAALSPAAAETAGMQLFSAAATRRRGLVRDPWARAGLQAADGPALH
Ga0247825_1044325013300028812SoilEPGEQLGTLVEVERTERFRIAALSPAAAETAGMQLFSAAATRRRGLVRDPWARAGLQAADGPALH
Ga0307302_1004961823300028814SoilMLDGMIDAFLVEVGAVCAEPGEQLGTLVEVQRTERFRIAALSPAAAETAGMQLFSAAAARQRRLVRDPWARAGLQGPDEPALH
Ga0307302_1067842213300028814SoilGRGAAGTSAAMLGSMIDAFLVEVGAVCAEPGEQLGTLVEVQRTERFRIAALSPAAAETAGMQLFTAAAARQRRVVRDPWVRAGLQGPDEPALH
Ga0307296_1014018713300028819SoilEEPGDQLGTLVEVQRTERFRISAVSPAAAETAGMQLFSAEATRQRRLVRDAWARAGLHMPDAPVLH
Ga0307296_1020966423300028819SoilMLAPMIDAFLVDVGAVCAEPGEQLGTLVEVERTERFRIAALGPAAAETAGMQLFSAAAARQRRLVRDPWARARLQAPDEPALH
Ga0307312_1010571033300028828SoilMLAGMIDAFLVEVGAVCAEPGEQLGTLVEVPRTESFRIAALSPAAAETAGMQLFSAAATRQRRLVRDPWARAGLQGPDEPALH
Ga0307312_1080365923300028828SoilGALCAEPGEQLGTLVEVQRTERFRISALSPAAAETAGMQLFSAAAARQRRVVRDPWARAGAPDEPALH
Ga0307289_1015572523300028875SoilMVDAFVVEVGALCEEPGEQLGTLVEVQRTERFRISALSPAAAETAGMQLFSAEATRQRRLVRDAWVHAGLPD
Ga0307289_1022345323300028875SoilLAVEAGSYRRAEARAGVTGDARPMVDAFVVEVGALCEEPGDQLGTLVEVQRTERFRISAVSPAAAETAGMQLFSAEATRQRRLVRDAWARAGLHLPDAPALH
Ga0307278_1003797913300028878SoilLDGMIDAFLVEVGAVCAEPGEQLGTLVEVQRTERFRIAALSPAAAETAGMQLFSAAAARQRRLVRDPWARAGLQGPDEPALH
Ga0307300_1006189913300028880SoilMIDAFLVEVGAVCSEPGEQLGTLVEVQRTERFRIAALSPAAAETAGMQLFSAAATRQRRLVRDPWARAGLQVPDEPAPH
Ga0307277_1055130123300028881SoilEEPGDQLGTLVEVQRTERFRISAVSPAAAETAGMQLFSAEATRQRRLVRDAWARAGLHLPDAPALH
Ga0307304_1008816013300028885SoilMLAGMIDAFLVEVGAVCAEPGEQLGTLVEVQRTESFRIAALSPAAAETAGMQLFSAAATRQRRLVRDPWARAGLQGPDEPALH
Ga0247826_1005938023300030336SoilMLAAMIDAFEVEVGAMCSEPGEQLGTLVEVERTERFRIAALSPAAAETAGMQLFSAAATRRRGLVRDPWARAGLQAADGPALH
Ga0247826_1010219923300030336SoilVPAAMLGPMIDAFVVEVGALCEEPGEQLGTLVAVQRTERFRISALSPAAAETAGMQLFSAEATRRGRLVRDPWARAGVQAADEPALR
Ga0307501_1007118423300031152SoilMLADMIDAFVVEVGALCEEPGDQLGTLVEVQRTESFRISALSPAAAETAGMQLFSAEATRRRRLVRDPWARAGLQAPDEPALH
Ga0307502_1000039163300031164SoilMLAGMIDAFLVEVGAVCAEPGEQLGTLVEVQRTERFRIAALSPAAAETAGMQLFSAAATRQRRLVRDPWARAGLQGPDEPALH
Ga0310887_1034428223300031547SoilLHDFVRVRMYPLYFRSERVPTGGPRREAGASRDARAMIDAFLVEVGALCEEPGEQLGTLVEVQRTERFRISALSPAAAETAGMQLFSAEATRRGRLVRDPWVRAGLQTPDAPALH
Ga0310904_1038719123300031854SoilTCGRSGFLLAGRGAGRAPAAMLGPMIDAFVVEVGALCEEPGEQLGTLVEVQRTERFRISALSPAAAETAGMQLFSAEATRRGRLVRDPWVRAGLQTPDAPALH
Ga0308175_10211767123300031938SoilMSDAFLVEVGALCEEPGEQLGTLVEVQRTERFRISALSPAAAETAGMQLFSAEATRRGRLVRDAWVRAGLQAPDAPALH
Ga0308176_1211314513300031996SoilDAFLVEVGALCEEPGEQLGTLVEVQRTERFRISALSPAAAETAGMQLFSAEATRRGRLVRDAWVRAGLHAPDAPALHLA
Ga0307416_10329907613300032002RhizosphereMLAGMVDAFVVEVGAMCSESGEQLGTRVEVQRTERFRIAALSPAAAETAGMQLFSAAATRQRRLVRDPWARAGLQAPDEPALR
Ga0308173_1015068423300032074SoilMLGPMSDAFLVEVGALCEEPGEQLGTLVEVQRTERFRISALSPAAAETAGMQLFSAEATRRGRLVRDAWVRAGLQAPDAPALH
Ga0310890_1155790313300032075SoilMLAPMIDAFLVEVGALCEEPGEQLGTLVEVQRTERFRISALSPAAAETAGMQLFSAEATRRRRLVRDAWVRAGLQTPDAPALH
Ga0372946_0054642_1049_13003300034384SoilMLARMIEAFLVEVGAVCAEPGEQLGTLVEVQRTERFRIAALSAAAAETAGMQLFSAAATRQRRLVRDPWARAGLQGPDEPAVQ

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.