Basic Information | |
---|---|
Family ID | F097991 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 104 |
Average Sequence Length | 39 residues |
Representative Sequence | EADPQVQKAVEAIPQARALYQNARKIVAQRMGGSFDQP |
Number of Associated Samples | 97 |
Number of Associated Scaffolds | 104 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 0.00 % |
% of genes near scaffold ends (potentially truncated) | 100.00 % |
% of genes from short scaffolds (< 2000 bps) | 86.54 % |
Associated GOLD sequencing projects | 96 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.52 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (82.692 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (13.462 % of family members) |
Environment Ontology (ENVO) | Unclassified (26.923 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (53.846 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 40.91% β-sheet: 0.00% Coil/Unstructured: 59.09% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.52 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 104 Family Scaffolds |
---|---|---|
PF13444 | Acetyltransf_5 | 3.85 |
PF12867 | DinB_2 | 3.85 |
PF02321 | OEP | 2.88 |
PF13180 | PDZ_2 | 1.92 |
PF00589 | Phage_integrase | 1.92 |
PF13683 | rve_3 | 1.92 |
PF00069 | Pkinase | 1.92 |
PF02687 | FtsX | 1.92 |
PF00291 | PALP | 1.92 |
PF07690 | MFS_1 | 1.92 |
PF00106 | adh_short | 0.96 |
PF00873 | ACR_tran | 0.96 |
PF01292 | Ni_hydr_CYTB | 0.96 |
PF03551 | PadR | 0.96 |
PF08281 | Sigma70_r4_2 | 0.96 |
PF13578 | Methyltransf_24 | 0.96 |
PF00903 | Glyoxalase | 0.96 |
PF03702 | AnmK | 0.96 |
PF04542 | Sigma70_r2 | 0.96 |
PF15631 | Imm-NTF2-2 | 0.96 |
PF13570 | PQQ_3 | 0.96 |
PF13624 | SurA_N_3 | 0.96 |
PF13620 | CarboxypepD_reg | 0.96 |
PF03544 | TonB_C | 0.96 |
PF13565 | HTH_32 | 0.96 |
PF00271 | Helicase_C | 0.96 |
PF01565 | FAD_binding_4 | 0.96 |
PF01850 | PIN | 0.96 |
PF02272 | DHHA1 | 0.96 |
PF01904 | DUF72 | 0.96 |
PF00082 | Peptidase_S8 | 0.96 |
PF13424 | TPR_12 | 0.96 |
PF12161 | HsdM_N | 0.96 |
PF08241 | Methyltransf_11 | 0.96 |
PF01425 | Amidase | 0.96 |
COG ID | Name | Functional Category | % Frequency in 104 Family Scaffolds |
---|---|---|---|
COG0515 | Serine/threonine protein kinase | Signal transduction mechanisms [T] | 7.69 |
COG1538 | Outer membrane protein TolC | Cell wall/membrane/envelope biogenesis [M] | 5.77 |
COG0154 | Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunit or related amidase | Translation, ribosomal structure and biogenesis [J] | 0.96 |
COG0568 | DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32) | Transcription [K] | 0.96 |
COG0810 | Periplasmic protein TonB, links inner and outer membranes | Cell wall/membrane/envelope biogenesis [M] | 0.96 |
COG1191 | DNA-directed RNA polymerase specialized sigma subunit | Transcription [K] | 0.96 |
COG1595 | DNA-directed RNA polymerase specialized sigma subunit, sigma24 family | Transcription [K] | 0.96 |
COG1695 | DNA-binding transcriptional regulator, PadR family | Transcription [K] | 0.96 |
COG1733 | DNA-binding transcriptional regulator, HxlR family | Transcription [K] | 0.96 |
COG1801 | Sugar isomerase-related protein YecE, UPF0759/DUF72 family | General function prediction only [R] | 0.96 |
COG1846 | DNA-binding transcriptional regulator, MarR family | Transcription [K] | 0.96 |
COG1969 | Ni,Fe-hydrogenase I cytochrome b subunit | Energy production and conversion [C] | 0.96 |
COG2377 | 1,6-Anhydro-N-acetylmuramate kinase | Cell wall/membrane/envelope biogenesis [M] | 0.96 |
COG2864 | Cytochrome b subunit of formate dehydrogenase | Energy production and conversion [C] | 0.96 |
COG3038 | Cytochrome b561 | Energy production and conversion [C] | 0.96 |
COG3658 | Cytochrome b subunit of Ni2+-dependent hydrogenase | Energy production and conversion [C] | 0.96 |
COG4117 | Thiosulfate reductase cytochrome b subunit | Inorganic ion transport and metabolism [P] | 0.96 |
COG4941 | Predicted RNA polymerase sigma factor, contains C-terminal TPR domain | Transcription [K] | 0.96 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 82.69 % |
Unclassified | root | N/A | 17.31 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300000364|INPhiseqgaiiFebDRAFT_100760953 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Occallatibacter → Occallatibacter savannae | 799 | Open in IMG/M |
3300000364|INPhiseqgaiiFebDRAFT_100762801 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Occallatibacter → Occallatibacter savannae | 898 | Open in IMG/M |
3300002245|JGIcombinedJ26739_100671785 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 914 | Open in IMG/M |
3300005176|Ga0066679_10080535 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1944 | Open in IMG/M |
3300005332|Ga0066388_101051912 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1371 | Open in IMG/M |
3300005446|Ga0066686_10169332 | All Organisms → cellular organisms → Bacteria | 1452 | Open in IMG/M |
3300005467|Ga0070706_101192288 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 700 | Open in IMG/M |
3300005468|Ga0070707_101616943 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus | 615 | Open in IMG/M |
3300005526|Ga0073909_10154979 | All Organisms → cellular organisms → Bacteria | 958 | Open in IMG/M |
3300005536|Ga0070697_101986283 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 521 | Open in IMG/M |
3300005537|Ga0070730_10805954 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 591 | Open in IMG/M |
3300005538|Ga0070731_10028947 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3764 | Open in IMG/M |
3300005547|Ga0070693_100667864 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 757 | Open in IMG/M |
3300005560|Ga0066670_10737632 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 597 | Open in IMG/M |
3300005598|Ga0066706_11438278 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 519 | Open in IMG/M |
3300005764|Ga0066903_105675097 | Not Available | 656 | Open in IMG/M |
3300006172|Ga0075018_10041957 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1872 | Open in IMG/M |
3300006176|Ga0070765_100263280 | All Organisms → cellular organisms → Bacteria | 1585 | Open in IMG/M |
3300006603|Ga0074064_11730680 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 613 | Open in IMG/M |
3300006893|Ga0073928_10086952 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 2661 | Open in IMG/M |
3300009038|Ga0099829_10676563 | Not Available | 858 | Open in IMG/M |
3300009088|Ga0099830_11730849 | All Organisms → cellular organisms → Bacteria | 522 | Open in IMG/M |
3300009090|Ga0099827_10051548 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 3097 | Open in IMG/M |
3300009137|Ga0066709_101819497 | All Organisms → cellular organisms → Bacteria | 853 | Open in IMG/M |
3300009177|Ga0105248_10890671 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Occallatibacter → Occallatibacter savannae | 1005 | Open in IMG/M |
3300009549|Ga0116137_1055075 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1276 | Open in IMG/M |
3300009553|Ga0105249_12067920 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Occallatibacter → Occallatibacter savannae | 642 | Open in IMG/M |
3300010325|Ga0134064_10011736 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2367 | Open in IMG/M |
3300010339|Ga0074046_10522452 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 707 | Open in IMG/M |
3300010341|Ga0074045_10020629 | All Organisms → cellular organisms → Bacteria | 5177 | Open in IMG/M |
3300010361|Ga0126378_12460153 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 595 | Open in IMG/M |
3300010362|Ga0126377_11177855 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 836 | Open in IMG/M |
3300012209|Ga0137379_10967084 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 756 | Open in IMG/M |
3300012359|Ga0137385_10311449 | Not Available | 1353 | Open in IMG/M |
3300012362|Ga0137361_10127823 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium | 2247 | Open in IMG/M |
3300012362|Ga0137361_10463244 | All Organisms → cellular organisms → Bacteria | 1164 | Open in IMG/M |
3300012685|Ga0137397_10581543 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 833 | Open in IMG/M |
3300012903|Ga0157289_10437787 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Occallatibacter → Occallatibacter savannae | 501 | Open in IMG/M |
3300012924|Ga0137413_10662798 | All Organisms → cellular organisms → Bacteria | 788 | Open in IMG/M |
3300012929|Ga0137404_10261615 | All Organisms → cellular organisms → Bacteria | 1488 | Open in IMG/M |
3300012930|Ga0137407_10415036 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1248 | Open in IMG/M |
3300012944|Ga0137410_10186408 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Paraburkholderia → Paraburkholderia caribensis | 1599 | Open in IMG/M |
3300012971|Ga0126369_11233239 | Not Available | 838 | Open in IMG/M |
3300014151|Ga0181539_1100971 | Not Available | 1215 | Open in IMG/M |
3300016357|Ga0182032_10189573 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1556 | Open in IMG/M |
3300016387|Ga0182040_11006447 | All Organisms → cellular organisms → Bacteria | 695 | Open in IMG/M |
3300016387|Ga0182040_11125022 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 658 | Open in IMG/M |
3300017823|Ga0187818_10444798 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 578 | Open in IMG/M |
3300017927|Ga0187824_10295810 | Not Available | 572 | Open in IMG/M |
3300017930|Ga0187825_10405571 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 524 | Open in IMG/M |
3300017934|Ga0187803_10261886 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 686 | Open in IMG/M |
3300017955|Ga0187817_11019511 | Not Available | 530 | Open in IMG/M |
3300017974|Ga0187777_10182687 | Not Available | 1409 | Open in IMG/M |
3300018018|Ga0187886_1177572 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 832 | Open in IMG/M |
3300018030|Ga0187869_10490416 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 584 | Open in IMG/M |
3300018062|Ga0187784_10975860 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 674 | Open in IMG/M |
3300018088|Ga0187771_10903760 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 749 | Open in IMG/M |
3300018482|Ga0066669_10157871 | All Organisms → cellular organisms → Bacteria | 1679 | Open in IMG/M |
3300020021|Ga0193726_1245602 | Not Available | 728 | Open in IMG/M |
3300020579|Ga0210407_10832189 | Not Available | 710 | Open in IMG/M |
3300020580|Ga0210403_10718502 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 799 | Open in IMG/M |
3300020580|Ga0210403_11010037 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 650 | Open in IMG/M |
3300021088|Ga0210404_10035800 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2256 | Open in IMG/M |
3300021170|Ga0210400_10179921 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1713 | Open in IMG/M |
3300021402|Ga0210385_10260180 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1278 | Open in IMG/M |
3300021403|Ga0210397_11466356 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 530 | Open in IMG/M |
3300021432|Ga0210384_10587946 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1000 | Open in IMG/M |
3300021433|Ga0210391_11414631 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 534 | Open in IMG/M |
3300021474|Ga0210390_11233915 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 602 | Open in IMG/M |
3300022726|Ga0242654_10315897 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 579 | Open in IMG/M |
3300026298|Ga0209236_1004673 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 8348 | Open in IMG/M |
3300026298|Ga0209236_1117683 | Not Available | 1175 | Open in IMG/M |
3300026310|Ga0209239_1192455 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 748 | Open in IMG/M |
3300026317|Ga0209154_1046991 | All Organisms → cellular organisms → Bacteria | 1934 | Open in IMG/M |
3300026532|Ga0209160_1127839 | All Organisms → cellular organisms → Bacteria | 1232 | Open in IMG/M |
3300027655|Ga0209388_1005686 | All Organisms → cellular organisms → Bacteria | 3209 | Open in IMG/M |
3300027684|Ga0209626_1046019 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1088 | Open in IMG/M |
3300027701|Ga0209447_10003701 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 4603 | Open in IMG/M |
3300027737|Ga0209038_10128286 | All Organisms → cellular organisms → Bacteria | 768 | Open in IMG/M |
3300027768|Ga0209772_10153307 | Not Available | 723 | Open in IMG/M |
3300027787|Ga0209074_10397663 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 577 | Open in IMG/M |
3300027812|Ga0209656_10488943 | Not Available | 539 | Open in IMG/M |
3300027825|Ga0209039_10044176 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | 2058 | Open in IMG/M |
3300027825|Ga0209039_10179350 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 869 | Open in IMG/M |
3300027875|Ga0209283_10066217 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2322 | Open in IMG/M |
3300027894|Ga0209068_10338799 | Not Available | 850 | Open in IMG/M |
3300028047|Ga0209526_10291377 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1107 | Open in IMG/M |
3300031022|Ga0138301_1890069 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 518 | Open in IMG/M |
3300031122|Ga0170822_14057870 | All Organisms → cellular organisms → Bacteria | 792 | Open in IMG/M |
3300031231|Ga0170824_119013290 | Not Available | 1344 | Open in IMG/M |
3300031719|Ga0306917_11121572 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 612 | Open in IMG/M |
3300031720|Ga0307469_12375515 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 517 | Open in IMG/M |
3300031744|Ga0306918_11341625 | All Organisms → cellular organisms → Bacteria | 549 | Open in IMG/M |
3300031753|Ga0307477_10059129 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2639 | Open in IMG/M |
3300031754|Ga0307475_10243437 | All Organisms → cellular organisms → Bacteria | 1440 | Open in IMG/M |
3300031754|Ga0307475_11291663 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 565 | Open in IMG/M |
3300031823|Ga0307478_10097393 | All Organisms → cellular organisms → Bacteria | 2273 | Open in IMG/M |
3300031962|Ga0307479_10915664 | All Organisms → cellular organisms → Bacteria | 848 | Open in IMG/M |
3300032067|Ga0318524_10662305 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 550 | Open in IMG/M |
3300032892|Ga0335081_10637500 | All Organisms → cellular organisms → Bacteria | 1306 | Open in IMG/M |
3300032893|Ga0335069_12670543 | Not Available | 514 | Open in IMG/M |
3300032897|Ga0335071_12023003 | Not Available | 519 | Open in IMG/M |
3300033158|Ga0335077_11364047 | Not Available | 685 | Open in IMG/M |
3300033289|Ga0310914_11668724 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 541 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 13.46% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 13.46% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 7.69% |
Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 5.77% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 5.77% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 4.81% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 4.81% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 4.81% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 3.85% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.85% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 2.88% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 2.88% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 2.88% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 2.88% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 1.92% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.92% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.92% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.92% |
Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 1.92% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.92% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.92% |
Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.96% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 0.96% |
Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.96% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.96% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.96% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.96% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.96% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
3300005176 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 | Environmental | Open in IMG/M |
3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
3300005446 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 | Environmental | Open in IMG/M |
3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
3300005526 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 | Environmental | Open in IMG/M |
3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
3300005537 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 | Environmental | Open in IMG/M |
3300005538 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 | Environmental | Open in IMG/M |
3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Environmental | Open in IMG/M |
3300005560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119 | Environmental | Open in IMG/M |
3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300006172 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014 | Environmental | Open in IMG/M |
3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
3300006603 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMC (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
3300009549 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_100 | Environmental | Open in IMG/M |
3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
3300010325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_0_1 metaG | Environmental | Open in IMG/M |
3300010339 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM3 | Environmental | Open in IMG/M |
3300010341 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM2 | Environmental | Open in IMG/M |
3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
3300012903 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S134-311R-1 | Environmental | Open in IMG/M |
3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
3300014151 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_60_metaG | Environmental | Open in IMG/M |
3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
3300017823 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3 | Environmental | Open in IMG/M |
3300017927 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_4 | Environmental | Open in IMG/M |
3300017930 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_5 | Environmental | Open in IMG/M |
3300017934 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_3 | Environmental | Open in IMG/M |
3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
3300017974 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MG | Environmental | Open in IMG/M |
3300018018 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_150 | Environmental | Open in IMG/M |
3300018030 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_100 | Environmental | Open in IMG/M |
3300018062 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
3300018088 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MG | Environmental | Open in IMG/M |
3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
3300020021 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2c1 | Environmental | Open in IMG/M |
3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
3300022726 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-30-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300026298 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
3300026310 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm (SPAdes) | Environmental | Open in IMG/M |
3300026317 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 (SPAdes) | Environmental | Open in IMG/M |
3300026532 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 (SPAdes) | Environmental | Open in IMG/M |
3300027655 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 (SPAdes) | Environmental | Open in IMG/M |
3300027684 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_M2 (SPAdes) | Environmental | Open in IMG/M |
3300027701 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM3 (SPAdes) | Environmental | Open in IMG/M |
3300027737 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM3 (SPAdes) | Environmental | Open in IMG/M |
3300027768 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM1 (SPAdes) | Environmental | Open in IMG/M |
3300027787 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter (SPAdes) | Environmental | Open in IMG/M |
3300027812 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2 (SPAdes) | Environmental | Open in IMG/M |
3300027825 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM1 (SPAdes) | Environmental | Open in IMG/M |
3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027894 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 (SPAdes) | Environmental | Open in IMG/M |
3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
3300031022 | Forest soil microbial communities from Spain - ITS-tags Site 9-Mixed-thinned forest site A3_MS_spring Metatranscriptome (Eukaryote Community Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
3300031122 | Oak Spring Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
3300032067 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f22 | Environmental | Open in IMG/M |
3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
3300032893 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1 | Environmental | Open in IMG/M |
3300032897 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.5 | Environmental | Open in IMG/M |
3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
INPhiseqgaiiFebDRAFT_1007609531 | 3300000364 | Soil | PQVXKGVEAVPQARALYQNARKIVAQRTGASIDQP* |
INPhiseqgaiiFebDRAFT_1007628011 | 3300000364 | Soil | LLEADPQVQKGVEAIPQARALYQNARKVVAQRTGAGIDQP* |
JGIcombinedJ26739_1006717853 | 3300002245 | Forest Soil | EADPQVQKAVDAIPQARALYQNARKIVAQRTGTPIDQP* |
Ga0066679_100805351 | 3300005176 | Soil | KVLLEADPQVQKAVEAIPQARALYQNVKKIVAQRSGGAIEQP* |
Ga0066388_1010519121 | 3300005332 | Tropical Forest Soil | SEGSKVLIEADPQVQAAMDALPQARTLYQSARKIVAQRTGTTTLDQP* |
Ga0066686_101693323 | 3300005446 | Soil | LEADPQVQKAVEAVPQAGALYQKVRRIVAQRTGGAAEQP* |
Ga0070706_1011922881 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | SDPQVQKAVEAIPQARALYENARKIVAQRAGLAPGQTQP* |
Ga0070707_1016169431 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | ELEDDLQVQKAVESIPQARALYENARKVIAQRTGAQNTFR* |
Ga0073909_101549793 | 3300005526 | Surface Soil | PQVQKAVDAIPQARALYLNAKRITAQRTGGAIDQP* |
Ga0070697_1019862833 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | LEADPQLQKGVEAMPQARALYQNARKIVAQRTGGTIDQP* |
Ga0070730_108059542 | 3300005537 | Surface Soil | MLEADPQVQKAVEAIPQARALYQNARKIVAQRTGATFDQP* |
Ga0070731_100289471 | 3300005538 | Surface Soil | VQKAVEAVPQARALYQNARKIVAQRAGTSSIDQP* |
Ga0070693_1006678642 | 3300005547 | Corn, Switchgrass And Miscanthus Rhizosphere | ELEADPQVQKAVDAIPQARALYENARKVVAQRMGGASVDQP* |
Ga0066670_107376323 | 3300005560 | Soil | KVLLEADPQVQKAVEAIPQARALYQNAKKIVAQRAGNSIERP* |
Ga0066706_114382781 | 3300005598 | Soil | LLEADPQVQKAVEAIPQARALYQNAKKIVAQRAGGPVEQP* |
Ga0066903_1056750971 | 3300005764 | Tropical Forest Soil | QVQKAVEAVPQARALYQNAHKIMAQRMGGSNDQP* |
Ga0075018_100419571 | 3300006172 | Watersheds | VLLEADPQVQKAVEAIPQARALYQNARKIVAQRTGERGDQP* |
Ga0070765_1002632801 | 3300006176 | Soil | EADPQVQKAVEAVPQARALYQNVRKIVAQRAGGNLDQP* |
Ga0074064_117306803 | 3300006603 | Soil | KVLLEADPQVQKGIEAIPQARALYQNARKIVAQRNGGSLDQP* |
Ga0073928_100869525 | 3300006893 | Iron-Sulfur Acid Spring | VLLEADPQVQKAVDSIPQARALYQNARKIVAQRTGTPIDQP* |
Ga0099829_106765633 | 3300009038 | Vadose Zone Soil | LLEADPQVQKAVEAVPEARALYQKTRRIVAQRTGGAVEQP* |
Ga0099830_117308492 | 3300009088 | Vadose Zone Soil | DDVQLQKAIESIPQARALYENARRVIAQRSSNGQSPR* |
Ga0099827_100515481 | 3300009090 | Vadose Zone Soil | LSVFGLPDSVKVELEADPQVQKAVESIPQARALYESVRKVIAQRSGEPVSKP* |
Ga0066709_1018194971 | 3300009137 | Grasslands Soil | ADPQVQKAVEAIPQARALYQNAKKIVAQRAGGTIEQP* |
Ga0105248_108906711 | 3300009177 | Switchgrass Rhizosphere | QVQKGVEAVPQARALYQNARKIVAQRAGASIDQP* |
Ga0116137_10550752 | 3300009549 | Peatland | LLEADPQVQKAIEAIPQARALYENARKVVAQRTGASPDQP* |
Ga0105249_120679201 | 3300009553 | Switchgrass Rhizosphere | PQVQKAVEAVPQARALYQNARKIVAQRTGAGIDQP* |
Ga0134064_100117361 | 3300010325 | Grasslands Soil | QVQKAVEAIPQARALYQNAKKIVAQRAGEPVEQP* |
Ga0074046_105224522 | 3300010339 | Bog Forest Soil | ADPQVQKAIEAIPQARALYENARKVVAQRAGTTPDQP* |
Ga0074045_100206291 | 3300010341 | Bog Forest Soil | ADPQVQKAVEAIPQARALYDNARKVVAQRAGATPTDQP* |
Ga0126378_124601532 | 3300010361 | Tropical Forest Soil | QVQAAVDAIPKARALYQNAKKIIAQRSGGAVEQP* |
Ga0126377_111778553 | 3300010362 | Tropical Forest Soil | DPQVQKAIESVPQARALYQNARKIVAQRNGGSIDQP* |
Ga0137379_109670842 | 3300012209 | Vadose Zone Soil | FKVLLEADPQVQKAVEAIPQARALYQNAKKIVAQRAGGPVEQP* |
Ga0137385_103114494 | 3300012359 | Vadose Zone Soil | LEADPQVQKAVEAVPQARALYQNARRIVAQRTGGAVEQP* |
Ga0137361_101278235 | 3300012362 | Vadose Zone Soil | GDKVLLAADPQVQKAVESIPQARALYENARKVVAQRNGSGHDQP* |
Ga0137361_104632441 | 3300012362 | Vadose Zone Soil | GTKVQLEADPQVQKAVEAIPQARALYETARKIVAQRAGLTPDQP* |
Ga0137397_105815432 | 3300012685 | Vadose Zone Soil | FLSAYGQAEGTKVQLESDPQVQKAVEAIPAARALYESARKIVAQRAGLAPAQP* |
Ga0157289_104377871 | 3300012903 | Soil | PQVQKAVEAVPQARALYQNAKKIVAQRTGAGIDQP* |
Ga0137413_106627982 | 3300012924 | Vadose Zone Soil | QLESDPQVQKAVEAIPQARALYENARKIVAQRAGLAPAQP* |
Ga0137404_102616152 | 3300012929 | Vadose Zone Soil | QVQKAVEAIPQARALYENARKIVAQRAGLAPAQP* |
Ga0137407_104150363 | 3300012930 | Vadose Zone Soil | SAYGTQEGDKVLLAADPQVQKAVDSIPHARALYENARKVVAQRNGSNHDQP* |
Ga0137410_101864083 | 3300012944 | Vadose Zone Soil | VLLEADPQVQKAVESIPQARALYQNARKIVAQRNGGSLDQP* |
Ga0126369_112332391 | 3300012971 | Tropical Forest Soil | QVQKAVEAVPQARALYQNARKIVAQRTGESPDQP* |
Ga0181539_11009711 | 3300014151 | Bog | QMQKAIEAIPQARALYENARKVVAQRSGSSPNQP* |
Ga0182032_101895731 | 3300016357 | Soil | EADPQVQKGVEAVPQARALYQNARKIVAQRAGGGVDQP |
Ga0182040_110064471 | 3300016387 | Soil | EADPQVQKAVEAVPQARALYENARKVVAQRNGTSDQP |
Ga0182040_111250221 | 3300016387 | Soil | ADPQVQKGVEAVPQARALYQNARKIVAQRAGGGVDQP |
Ga0187818_104447981 | 3300017823 | Freshwater Sediment | DPQVQKAVEALPEARALYQNARKIVAQRMGGSFNQP |
Ga0187824_102958101 | 3300017927 | Freshwater Sediment | QVQKAVEAIPQARALYENARKIVAQRSGSNVHFNQP |
Ga0187825_104055712 | 3300017930 | Freshwater Sediment | PQVQKAVEAIPQARALYQNARKIVAQRTGATFDQP |
Ga0187803_102618861 | 3300017934 | Freshwater Sediment | PQVQKAVEAIPQARALYENARKVVAQRSGGSPDQP |
Ga0187817_110195112 | 3300017955 | Freshwater Sediment | FKVLLEADPQVQRAVDAVPQARALYENARKIIALRNGSTAHFNQP |
Ga0187777_101826871 | 3300017974 | Tropical Peatland | EGLKVLLEADPQVQAAVDAIPKARALYQNAKKIIAQRSGSAVEQP |
Ga0187886_11775721 | 3300018018 | Peatland | DPQVQKAIEAIPQARALYENARKIVAQRAGASPDQP |
Ga0187869_104904162 | 3300018030 | Peatland | LEADPQVQKAIEAIPQARALYENARKVVAQRTGASPDQP |
Ga0187784_109758602 | 3300018062 | Tropical Peatland | FKVLLDADPQVQKAIDAVPQARALYENARKVVAQKSGSNIRFNQP |
Ga0187771_109037601 | 3300018088 | Tropical Peatland | PQVQKAIEAVPQARALYQNARRIVAQRSGASPDQP |
Ga0066669_101578711 | 3300018482 | Grasslands Soil | LEGDPQVQKAVEAVPQARALYQNAHKIMAQRMGGSVDQP |
Ga0193726_12456022 | 3300020021 | Soil | AAAPQDQKAVEATPQARALYQNARKIVAQRTGGSIDQP |
Ga0210407_108321891 | 3300020579 | Soil | AADPQVQKAVESIPQARALYENARKVVAQRSGSGHDQP |
Ga0210403_107185021 | 3300020580 | Soil | LKVLLEADPQVQKAVEAIPQARALYQNAKKIVAQRAGGAIDQP |
Ga0210403_110100371 | 3300020580 | Soil | KVLLEADPQVQKAVDTIPQARTLYENARKIVAQRTGGSFEHP |
Ga0210404_100358001 | 3300021088 | Soil | DPQVQKAVEAIPQARALYENARKIVAQRAGLTSNQP |
Ga0210400_101799211 | 3300021170 | Soil | LEADPQVQKAVDSIPQARALYENARKVVAQRMGNTPDQP |
Ga0210385_102601803 | 3300021402 | Soil | DPQVQKAVDSIPQARALYENARKIVAQRMGGNAPDQP |
Ga0210397_114663562 | 3300021403 | Soil | VLLAADPQVQKAVDSIPQARALYENARKVVAQRNGSNHDQP |
Ga0210384_105879461 | 3300021432 | Soil | DPQVQKAVESIPQARALYENARKIVAQRNGSGHDQP |
Ga0210391_114146311 | 3300021433 | Soil | EADPQVQKAVDSIPQARALYENARKVVAQRMGNTPDQP |
Ga0210390_112339151 | 3300021474 | Soil | DPQVQKAVDSIPQARALYENARRIVAQRMGNTPDQP |
Ga0242654_103158971 | 3300022726 | Soil | GDKVLLAADPQVQKAIESIPQARALYENARKVVAQRNGSGHDQP |
Ga0209236_10046739 | 3300026298 | Grasslands Soil | VLLEADPQVQKAVEVIPQARALYQNARKIIAQRMGESVDQP |
Ga0209236_11176833 | 3300026298 | Grasslands Soil | PDSVKVELEADPQVQKAVESIPQARALYENVRKVIAQRSGEPVSKP |
Ga0209239_11924551 | 3300026310 | Grasslands Soil | PQVQKAVEAIPQARALYQNAKKIVAQRAGNSIERP |
Ga0209154_10469911 | 3300026317 | Soil | DPQVQKAVEAVPQARALYQNAHKIMAQRMGGSADRPY |
Ga0209160_11278393 | 3300026532 | Soil | LLEADPQVQKAVEAIPQARALYQNAKKIVAQRAGGTIEQP |
Ga0209388_10056863 | 3300027655 | Vadose Zone Soil | EADPQVQKAVEAIPQARALYETARKIVAQRAGLTPDQP |
Ga0209626_10460193 | 3300027684 | Forest Soil | VLLEADPQVQKAVEAIPQARALYQNAKKIVAQRAGGPVEQP |
Ga0209447_100037019 | 3300027701 | Bog Forest Soil | PQVMKAIEAIPQARALYQNARKVVAQRTSGSLDQP |
Ga0209038_101282861 | 3300027737 | Bog Forest Soil | ELEADRQVQASIEAVPQARALYENARKIMADRQGMTTFRP |
Ga0209772_101533071 | 3300027768 | Bog Forest Soil | ESVLLLADPQVEKAAESVPQARALYQNARKIVAQRSGGNTLEQP |
Ga0209074_103976632 | 3300027787 | Agricultural Soil | ESDPQVQKAVEAIPQARALYENARKIVAQRAGLRQDRP |
Ga0209656_104889431 | 3300027812 | Bog Forest Soil | QVEKAAESVPQARALYQNARKIVAQRTGTPTLDQP |
Ga0209039_100441763 | 3300027825 | Bog Forest Soil | ILLEADPQVQKAIEAIPQARALYENARKVVAQRSGATPDQP |
Ga0209039_101793502 | 3300027825 | Bog Forest Soil | ILLEADPQVQKAIEAIPQARALYENARKVVAQRAGASPDQP |
Ga0209283_100662171 | 3300027875 | Vadose Zone Soil | VELEADPQVQKAVDSIPQARALYENVRKVIAQRSGEPVSKP |
Ga0209068_103387991 | 3300027894 | Watersheds | LLEADPQVQAAVDAIPQARALYQNVKKIIAQRSGAAVEQP |
Ga0209526_102913773 | 3300028047 | Forest Soil | LLEADPQVQKAVDAIPQARALYQNARKIVAQRTGTPIDQP |
Ga0138301_18900691 | 3300031022 | Soil | PQVQKAVDSIPQARALYQNARKIVAQRTGAPIDQP |
Ga0170822_140578701 | 3300031122 | Forest Soil | GLLEADPQLQKGIEAMPQARALYQNARKIVAQRAGAGSDQP |
Ga0170824_1190132902 | 3300031231 | Forest Soil | LEADPQVQKAVEALPQARALYENARKVVAQRNGGGSDQP |
Ga0306917_111215721 | 3300031719 | Soil | ADPQVQKGVEAVPQARALYQNARKIVAQRAGGSVDQP |
Ga0307469_123755152 | 3300031720 | Hardwood Forest Soil | VLLAADPQVQKAVESIPQARALYENARKVVAQRSGSGHDQP |
Ga0306918_113416251 | 3300031744 | Soil | FKVLLEADPQVQRAIEAVPQARALYENARKVVAQGNAATSHFKQP |
Ga0307477_100591291 | 3300031753 | Hardwood Forest Soil | EADPQVQKAVEAIPQARALYQNARKIVAQRMGGSFDQP |
Ga0307475_102434371 | 3300031754 | Hardwood Forest Soil | DPQVQKAVEAIPQARALYENARKIVAQRAGVTPDQP |
Ga0307475_112916631 | 3300031754 | Hardwood Forest Soil | LLEADPQVQKAVEAIPQARALYQNAKRIVAQRAGGTIEQP |
Ga0307478_100973935 | 3300031823 | Hardwood Forest Soil | PQVQAAVEAIPQARALYENARKIVAQRSGGANDQP |
Ga0307479_109156641 | 3300031962 | Hardwood Forest Soil | DPQVQKAVEAIPQARALYENARKIVAQRAGITPNQP |
Ga0318524_106623052 | 3300032067 | Soil | ADPQVQKAIESIPQARALYENARKVVAQRNGADHDQP |
Ga0335081_106375001 | 3300032892 | Soil | LKVLVEADPQVDKAIESIPQARALYQNARKIIAQRNGGASPDQP |
Ga0335069_126705431 | 3300032893 | Soil | EADPQVQKAMEAIPQARALYENARKVVAQRAGNTAHLNQP |
Ga0335071_120230031 | 3300032897 | Soil | LLSSDPQVQKAIESVPQARALYENARKVVAQRNGAGPDQP |
Ga0335077_113640472 | 3300033158 | Soil | LLEADPQVQKAVEALPQARALYENARKVVAQRSGGGADQP |
Ga0310914_116687241 | 3300033289 | Soil | DPQVQKAIESIPQARALYENARKVVAQRNGADHDQP |
⦗Top⦘ |