Basic Information | |
---|---|
Family ID | F097951 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 104 |
Average Sequence Length | 44 residues |
Representative Sequence | LNVPGRQRHSRRAQKARPKFPHATATKTTVTGKPQVTVFAPGFC |
Number of Associated Samples | 88 |
Number of Associated Scaffolds | 104 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Unclassified |
% of genes with valid RBS motifs | 0.00 % |
% of genes near scaffold ends (potentially truncated) | 96.15 % |
% of genes from short scaffolds (< 2000 bps) | 84.62 % |
Associated GOLD sequencing projects | 83 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.26 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Unclassified (62.500 % of family members) |
NCBI Taxonomy ID | N/A |
Taxonomy | N/A |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil (20.192 % of family members) |
Environment Ontology (ENVO) | Unclassified (25.962 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (45.192 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 11.11% Coil/Unstructured: 88.89% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.26 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 104 Family Scaffolds |
---|---|---|
PF02371 | Transposase_20 | 1.92 |
PF12770 | CHAT | 1.92 |
PF13613 | HTH_Tnp_4 | 1.92 |
PF01548 | DEDD_Tnp_IS110 | 1.92 |
PF13676 | TIR_2 | 1.92 |
PF02909 | TetR_C_1 | 0.96 |
PF00583 | Acetyltransf_1 | 0.96 |
PF01924 | HypD | 0.96 |
PF05977 | MFS_3 | 0.96 |
PF01243 | Putative_PNPOx | 0.96 |
PF08388 | GIIM | 0.96 |
PF14338 | Mrr_N | 0.96 |
PF13006 | Nterm_IS4 | 0.96 |
PF13398 | Peptidase_M50B | 0.96 |
PF00144 | Beta-lactamase | 0.96 |
PF13607 | Succ_CoA_lig | 0.96 |
PF00498 | FHA | 0.96 |
PF11716 | MDMPI_N | 0.96 |
PF13374 | TPR_10 | 0.96 |
PF04116 | FA_hydroxylase | 0.96 |
PF13542 | HTH_Tnp_ISL3 | 0.96 |
PF07040 | DUF1326 | 0.96 |
PF00415 | RCC1 | 0.96 |
COG ID | Name | Functional Category | % Frequency in 104 Family Scaffolds |
---|---|---|---|
COG3547 | Transposase | Mobilome: prophages, transposons [X] | 3.85 |
COG5184 | Alpha-tubulin suppressor ATS1 and related RCC1 domain-containing proteins | Cell cycle control, cell division, chromosome partitioning [D] | 1.92 |
COG0409 | Hydrogenase maturation factor HypD | Posttranslational modification, protein turnover, chaperones [O] | 0.96 |
COG1309 | DNA-binding protein, AcrR family, includes nucleoid occlusion protein SlmA | Transcription [K] | 0.96 |
COG1680 | CubicO group peptidase, beta-lactamase class C family | Defense mechanisms [V] | 0.96 |
COG1686 | D-alanyl-D-alanine carboxypeptidase | Cell wall/membrane/envelope biogenesis [M] | 0.96 |
COG2367 | Beta-lactamase class A | Defense mechanisms [V] | 0.96 |
COG2814 | Predicted arabinose efflux permease AraJ, MFS family | Carbohydrate transport and metabolism [G] | 0.96 |
COG3000 | Sterol desaturase/sphingolipid hydroxylase, fatty acid hydroxylase superfamily | Lipid transport and metabolism [I] | 0.96 |
COG5588 | Uncharacterized conserved protein, DUF1326 domain | Function unknown [S] | 0.96 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
Unclassified | root | N/A | 62.50 % |
All Organisms | root | All Organisms | 37.50 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2189573003|GZIR7W401CUYXQ | Not Available | 547 | Open in IMG/M |
3300000364|INPhiseqgaiiFebDRAFT_100608119 | All Organisms → cellular organisms → Bacteria | 1251 | Open in IMG/M |
3300005471|Ga0070698_100620920 | Not Available | 1022 | Open in IMG/M |
3300005537|Ga0070730_10991916 | Not Available | 524 | Open in IMG/M |
3300006102|Ga0075015_100629154 | Not Available | 631 | Open in IMG/M |
3300006173|Ga0070716_100032267 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2855 | Open in IMG/M |
3300006804|Ga0079221_10185893 | All Organisms → cellular organisms → Bacteria | 1124 | Open in IMG/M |
3300006804|Ga0079221_11040364 | Not Available | 619 | Open in IMG/M |
3300006854|Ga0075425_100045422 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 4908 | Open in IMG/M |
3300006954|Ga0079219_10251307 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1052 | Open in IMG/M |
3300009029|Ga0066793_10394823 | Not Available | 795 | Open in IMG/M |
3300009038|Ga0099829_11681119 | Not Available | 522 | Open in IMG/M |
3300009089|Ga0099828_11260902 | Not Available | 655 | Open in IMG/M |
3300009089|Ga0099828_11747940 | Not Available | 547 | Open in IMG/M |
3300009090|Ga0099827_11451973 | Not Available | 597 | Open in IMG/M |
3300009090|Ga0099827_11914436 | Not Available | 517 | Open in IMG/M |
3300009520|Ga0116214_1145658 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 881 | Open in IMG/M |
3300009521|Ga0116222_1154889 | Not Available | 986 | Open in IMG/M |
3300009521|Ga0116222_1520757 | Not Available | 521 | Open in IMG/M |
3300009698|Ga0116216_10295012 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae | 988 | Open in IMG/M |
3300009698|Ga0116216_10394150 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 840 | Open in IMG/M |
3300009700|Ga0116217_11036527 | Not Available | 502 | Open in IMG/M |
3300009824|Ga0116219_10042873 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2697 | Open in IMG/M |
3300009824|Ga0116219_10266831 | Not Available | 969 | Open in IMG/M |
3300009824|Ga0116219_10704449 | Not Available | 552 | Open in IMG/M |
3300009839|Ga0116223_10674473 | Not Available | 594 | Open in IMG/M |
3300010329|Ga0134111_10481346 | Not Available | 542 | Open in IMG/M |
3300010341|Ga0074045_10080040 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2289 | Open in IMG/M |
3300010343|Ga0074044_10681773 | Not Available | 671 | Open in IMG/M |
3300010379|Ga0136449_103263871 | Not Available | 625 | Open in IMG/M |
3300010379|Ga0136449_103920476 | Not Available | 557 | Open in IMG/M |
3300011269|Ga0137392_10430843 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1095 | Open in IMG/M |
3300011271|Ga0137393_11262966 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Kineosporiales → Kineosporiaceae → Kineococcus | 626 | Open in IMG/M |
3300012189|Ga0137388_10758943 | Not Available | 900 | Open in IMG/M |
3300012199|Ga0137383_11253936 | Not Available | 530 | Open in IMG/M |
3300012201|Ga0137365_10896789 | Not Available | 647 | Open in IMG/M |
3300012207|Ga0137381_10103448 | All Organisms → cellular organisms → Bacteria | 2417 | Open in IMG/M |
3300012207|Ga0137381_10602780 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 957 | Open in IMG/M |
3300012210|Ga0137378_10533014 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1082 | Open in IMG/M |
3300012354|Ga0137366_10634354 | Not Available | 765 | Open in IMG/M |
3300012357|Ga0137384_10360075 | Not Available | 1205 | Open in IMG/M |
3300012357|Ga0137384_11285253 | Not Available | 578 | Open in IMG/M |
3300012361|Ga0137360_10477032 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1059 | Open in IMG/M |
3300012361|Ga0137360_11306885 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 626 | Open in IMG/M |
3300014501|Ga0182024_10223991 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2546 | Open in IMG/M |
3300017924|Ga0187820_1335192 | Not Available | 503 | Open in IMG/M |
3300017943|Ga0187819_10677522 | Not Available | 582 | Open in IMG/M |
3300017955|Ga0187817_10189419 | Not Available | 1310 | Open in IMG/M |
3300017995|Ga0187816_10529641 | Not Available | 531 | Open in IMG/M |
3300018007|Ga0187805_10494610 | Not Available | 573 | Open in IMG/M |
3300018032|Ga0187788_10562559 | Not Available | 500 | Open in IMG/M |
3300018058|Ga0187766_10998067 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 596 | Open in IMG/M |
3300018433|Ga0066667_11474462 | Not Available | 600 | Open in IMG/M |
3300018468|Ga0066662_11893518 | Not Available | 624 | Open in IMG/M |
3300021420|Ga0210394_11319487 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 616 | Open in IMG/M |
3300025928|Ga0207700_11100146 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 710 | Open in IMG/M |
3300025983|Ga0210106_1081224 | Not Available | 536 | Open in IMG/M |
3300026294|Ga0209839_10032593 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1965 | Open in IMG/M |
3300026309|Ga0209055_1300586 | Not Available | 505 | Open in IMG/M |
3300026469|Ga0257169_1037240 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Nonomuraea → Nonomuraea cypriaca | 741 | Open in IMG/M |
3300027854|Ga0209517_10256626 | Not Available | 1043 | Open in IMG/M |
3300027903|Ga0209488_10738680 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 702 | Open in IMG/M |
3300027905|Ga0209415_10269876 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Frankiales → Frankiaceae → Frankia → Frankia casuarinae | 1505 | Open in IMG/M |
3300028787|Ga0307323_10287380 | All Organisms → cellular organisms → Bacteria | 591 | Open in IMG/M |
3300028879|Ga0302229_10130430 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1172 | Open in IMG/M |
3300030058|Ga0302179_10097881 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Frankiales → Frankiaceae → Frankia → Frankia soli | 1298 | Open in IMG/M |
3300030494|Ga0310037_10033039 | All Organisms → cellular organisms → Bacteria | 2489 | Open in IMG/M |
3300030494|Ga0310037_10157693 | Not Available | 1026 | Open in IMG/M |
3300030706|Ga0310039_10058201 | Not Available | 1694 | Open in IMG/M |
3300030707|Ga0310038_10005900 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 8515 | Open in IMG/M |
3300030718|Ga0307919_1059392 | Not Available | 531 | Open in IMG/M |
3300031231|Ga0170824_121809497 | Not Available | 590 | Open in IMG/M |
3300031544|Ga0318534_10213122 | All Organisms → cellular organisms → Bacteria | 1115 | Open in IMG/M |
3300031680|Ga0318574_10438779 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 764 | Open in IMG/M |
3300031680|Ga0318574_10810845 | Not Available | 548 | Open in IMG/M |
3300031708|Ga0310686_106427167 | Not Available | 628 | Open in IMG/M |
3300031723|Ga0318493_10350002 | Not Available | 803 | Open in IMG/M |
3300031782|Ga0318552_10640945 | Not Available | 542 | Open in IMG/M |
3300031819|Ga0318568_10666868 | Not Available | 647 | Open in IMG/M |
3300031831|Ga0318564_10112621 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1211 | Open in IMG/M |
3300031835|Ga0318517_10344149 | Not Available | 674 | Open in IMG/M |
3300031846|Ga0318512_10454126 | Not Available | 647 | Open in IMG/M |
3300031893|Ga0318536_10561803 | Not Available | 572 | Open in IMG/M |
3300031897|Ga0318520_10374391 | Not Available | 867 | Open in IMG/M |
3300031897|Ga0318520_11110980 | Not Available | 501 | Open in IMG/M |
3300031946|Ga0310910_11580827 | Not Available | 502 | Open in IMG/M |
3300032001|Ga0306922_11302693 | Not Available | 735 | Open in IMG/M |
3300032009|Ga0318563_10637695 | Not Available | 574 | Open in IMG/M |
3300032054|Ga0318570_10285881 | Not Available | 749 | Open in IMG/M |
3300032066|Ga0318514_10325902 | Not Available | 813 | Open in IMG/M |
3300032076|Ga0306924_11335260 | Not Available | 768 | Open in IMG/M |
3300032160|Ga0311301_12826038 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 529 | Open in IMG/M |
3300032160|Ga0311301_13062116 | Not Available | 500 | Open in IMG/M |
3300032770|Ga0335085_10203935 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2419 | Open in IMG/M |
3300032805|Ga0335078_10191726 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2848 | Open in IMG/M |
3300032828|Ga0335080_11744394 | Not Available | 609 | Open in IMG/M |
3300032892|Ga0335081_10717009 | Not Available | 1210 | Open in IMG/M |
3300032893|Ga0335069_11444489 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Micromonospora → Micromonospora deserti | 742 | Open in IMG/M |
3300032896|Ga0335075_10005074 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 20495 | Open in IMG/M |
3300032898|Ga0335072_10228261 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 2168 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 20.19% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 18.27% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 18.27% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 6.73% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 4.81% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 2.88% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.88% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.88% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.92% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.92% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.92% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.92% |
Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 1.92% |
Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 1.92% |
Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 0.96% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.96% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.96% |
Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil | 0.96% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.96% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.96% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 0.96% |
Prmafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil | 0.96% |
Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 0.96% |
Soil | Environmental → Terrestrial → Soil → Clay → Unclassified → Soil | 0.96% |
Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 0.96% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.96% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2189573003 | Grass soil microbial communities from Rothamsted Park, UK - FE2 (NaCl 30g/L 5ml) | Environmental | Open in IMG/M |
3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
3300005537 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 | Environmental | Open in IMG/M |
3300005568 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 | Environmental | Open in IMG/M |
3300006102 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013 | Environmental | Open in IMG/M |
3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
3300009029 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 1 DNA2013-189 | Environmental | Open in IMG/M |
3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
3300009520 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaG | Environmental | Open in IMG/M |
3300009521 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaG | Environmental | Open in IMG/M |
3300009698 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG | Environmental | Open in IMG/M |
3300009700 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG | Environmental | Open in IMG/M |
3300009824 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG | Environmental | Open in IMG/M |
3300009839 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG | Environmental | Open in IMG/M |
3300010329 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_11112015 | Environmental | Open in IMG/M |
3300010341 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM2 | Environmental | Open in IMG/M |
3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
3300012354 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG | Environmental | Open in IMG/M |
3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
3300014501 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
3300017924 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_5 | Environmental | Open in IMG/M |
3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
3300017995 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_1 | Environmental | Open in IMG/M |
3300018007 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_5 | Environmental | Open in IMG/M |
3300018032 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_BV01_MP10_20_MG | Environmental | Open in IMG/M |
3300018058 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MG | Environmental | Open in IMG/M |
3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025983 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Tolay_CordC_D2 (SPAdes) | Environmental | Open in IMG/M |
3300026294 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-050 (SPAdes) | Environmental | Open in IMG/M |
3300026309 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 (SPAdes) | Environmental | Open in IMG/M |
3300026469 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-17-B | Environmental | Open in IMG/M |
3300027854 | Peat soil microbial communities from Weissenstadt, Germany - SII-2010 (SPAdes) | Environmental | Open in IMG/M |
3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
3300027905 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes) | Environmental | Open in IMG/M |
3300028562 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N1_3 | Environmental | Open in IMG/M |
3300028787 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_381 | Environmental | Open in IMG/M |
3300028879 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N1_3 | Environmental | Open in IMG/M |
3300030058 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_1 | Environmental | Open in IMG/M |
3300030494 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG (v2) | Environmental | Open in IMG/M |
3300030706 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG (v2) | Environmental | Open in IMG/M |
3300030707 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG (v2) | Environmental | Open in IMG/M |
3300030718 | Metatranscriptome of soil microbial communities from Risofladan, Vaasa, Finland - OX-1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031544 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26 | Environmental | Open in IMG/M |
3300031680 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22 | Environmental | Open in IMG/M |
3300031681 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20 | Environmental | Open in IMG/M |
3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
3300031723 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23 | Environmental | Open in IMG/M |
3300031782 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f20 | Environmental | Open in IMG/M |
3300031819 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21 | Environmental | Open in IMG/M |
3300031831 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f20 | Environmental | Open in IMG/M |
3300031835 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f21 | Environmental | Open in IMG/M |
3300031846 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f19 | Environmental | Open in IMG/M |
3300031893 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f28 | Environmental | Open in IMG/M |
3300031897 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16 | Environmental | Open in IMG/M |
3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
3300032009 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f19 | Environmental | Open in IMG/M |
3300032054 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f23 | Environmental | Open in IMG/M |
3300032066 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f18 | Environmental | Open in IMG/M |
3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
3300032893 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1 | Environmental | Open in IMG/M |
3300032896 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.4 | Environmental | Open in IMG/M |
3300032898 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
FE2_08008870 | 2189573003 | Grass Soil | PGRQRHSERAQKARPKFPHASATKTTVTGKPKVTVFAPGSC |
INPhiseqgaiiFebDRAFT_1006081192 | 3300000364 | Soil | RAALRTLNITGRQRHSRRAQKARPKFAHTSATKTTVTGKPQVIVYAPGFT* |
Ga0070698_1006209202 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | TLNVPGRERHSDRAQKARPKFRHTAVTKPTVTGKPQVTVFAPGFS* |
Ga0070730_109919161 | 3300005537 | Surface Soil | ARACLHTLNLPGRQRHSERAQKARPKFPHATATKITVTGKPQVTVFAPGFC* |
Ga0066703_106548382 | 3300005568 | Soil | PRVQKARPKFGHTSATKKTVTGKHQVIVYAPGRC* |
Ga0075015_1006291542 | 3300006102 | Watersheds | LPGRQRHSKRAQKARPKFPYATATKTTVTGKPQVTVFAPGFS* |
Ga0070716_1000322671 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | RAALHILNVPGRQRHSERAQKARPKFRHATATKQTVTGKPQVTAFAPGFS* |
Ga0079221_101858931 | 3300006804 | Agricultural Soil | ILNVPGRQRHSERAQKARPKFRHATATKQTVTGKPQVTAFAPGFS* |
Ga0079221_110403641 | 3300006804 | Agricultural Soil | IPGRERHSPRVQKARPKFGHTSATKKTVTGKHQVIVHAPGRC* |
Ga0075425_1000454221 | 3300006854 | Populus Rhizosphere | NIPGRQRHSERAQKARPKFRHTTATKRTVTGKPQVTVFAPGFS* |
Ga0079219_102513071 | 3300006954 | Agricultural Soil | LHTLNLPGRQRHSERAQKARLKFPHVTATKTTVTGKPQVTVFAPGFY* |
Ga0066793_103948231 | 3300009029 | Prmafrost Soil | LHTLNIPGRQRHSKRAQKARPKFPHATATKQTVTGKPQVTVFAPGFC* |
Ga0099829_116811191 | 3300009038 | Vadose Zone Soil | IPGRQRHSRRAQKARPKFPHAAATKVTVTGKPQVTVFAPGFS* |
Ga0099828_112609021 | 3300009089 | Vadose Zone Soil | LPARQRHSRRAQKARPKFPHATATKTTITGKPQVTVFAPGFY* |
Ga0099828_117479403 | 3300009089 | Vadose Zone Soil | LRTLNVPGRQRHSRRAQKARPKFPHTAVTKPTVTGKPRVTVFAPGYT* |
Ga0099827_114519731 | 3300009090 | Vadose Zone Soil | LNIPGRQRHSKRAQKARPKFRHATATKNTVTCKPQVTVFAPGFS* |
Ga0099827_119144361 | 3300009090 | Vadose Zone Soil | SKRAQKARPKFAHASATKQTDTRKPQARVFAPGFS* |
Ga0116214_11456581 | 3300009520 | Peatlands Soil | LNVPGRQRHSRRAQKARPKFPHATATKTTVTGKPQVTVFAPGFC* |
Ga0116222_11548891 | 3300009521 | Peatlands Soil | HTLSLPGRQRHSKRAQKARPKFPHATATKTTVTGKPQVTVFAPGFS* |
Ga0116222_15207571 | 3300009521 | Peatlands Soil | PGRQRHSKPAKKTRPKFPHSTATKTTVTGKPQVTVFAPGFC* |
Ga0116216_102950122 | 3300009698 | Peatlands Soil | VPGRQRHSERAQKARPKFRHATATKQTVTGKPQVTVFAPGFS* |
Ga0116216_103941502 | 3300009698 | Peatlands Soil | KRAQKARPKFPHATGTKTTVTGKPQVTVFAPGYC* |
Ga0116217_109329291 | 3300009700 | Peatlands Soil | SKRAQKARPKFAHTSATKKTVTGKPQVTVYAPGFS* |
Ga0116217_110365271 | 3300009700 | Peatlands Soil | GRQRHSERAQKARPKFPHATATKTTITGKPQVTVFAPGSY* |
Ga0116219_100428731 | 3300009824 | Peatlands Soil | LNVPGRQRHSRRAQKARPKFPHATATKTTVTGKPQVTVFAPGSC* |
Ga0116219_102668311 | 3300009824 | Peatlands Soil | LHTLNLPGRQRHSARAQKASPKFPHATATKTTATGKPQVTVFAPGRC* |
Ga0116219_107044491 | 3300009824 | Peatlands Soil | AALHTLNVPGRQRHSERARKARPKFPHATATKTTVTGKPQVTVFAPGSC* |
Ga0116223_106744732 | 3300009839 | Peatlands Soil | HSRRAQKARPKFPHATATKTTVTGKPQVTVFAPGFY* |
Ga0134111_104813461 | 3300010329 | Grasslands Soil | LNLPGRQRHSEWAQKARPKFPHASATKITLTGKPQVTVFAPGFY* |
Ga0074045_100800401 | 3300010341 | Bog Forest Soil | SRRAQKARPKFPHASATKTTVTGKPQVTVFAPGFC* |
Ga0074044_106817731 | 3300010343 | Bog Forest Soil | LSIPGRQRHSRRAQKARPKFPHAAATKVTVTGKPQVTVFAPGFS* |
Ga0136449_1032638711 | 3300010379 | Peatlands Soil | SLPGRQRHSKRAQKARPKFPHATATKTTATGKPQVTVFAPGFS* |
Ga0136449_1039204761 | 3300010379 | Peatlands Soil | GRQRHSKRAQKARPKFPHASATKTTVTGKPQVQVFVPGFS* |
Ga0137392_104308431 | 3300011269 | Vadose Zone Soil | LNLPARQRHSRRAQKARPKFPHATATKTTITGKPQVTVFAPGFY* |
Ga0137393_112629662 | 3300011271 | Vadose Zone Soil | RHSQRAQKARPKFGHTAATKQTVTGKPEVTVFAPGFS* |
Ga0137388_107589431 | 3300012189 | Vadose Zone Soil | KRAQKASPKFRHATATRQPITGKPRVTVFAPGFP* |
Ga0137383_112539362 | 3300012199 | Vadose Zone Soil | AHLHTLNIPGRDRHSPRTQKAGPNFPHTPATKQTVTGKYQVIVYAPGHR* |
Ga0137365_108967892 | 3300012201 | Vadose Zone Soil | ARACLHTLNIPGRERHSPRVQKARPKFGHTSATKTTLTGKHEVIVYAPGRC* |
Ga0137381_101034483 | 3300012207 | Vadose Zone Soil | GRQRRSRRAQKARPKFGHTAATKNTVTGKPEVTVFIPGSS* |
Ga0137381_106027801 | 3300012207 | Vadose Zone Soil | TLNIPGRERHSPRVQKARPKFGHTSATKTTLTGKHEVIVYAPGRC* |
Ga0137378_105330142 | 3300012210 | Vadose Zone Soil | AALHTLNLPRRQRHSTRAQKARPKFPHATATKTTVTGKPQVTVFAPGFY* |
Ga0137366_106343543 | 3300012354 | Vadose Zone Soil | RHSKRAQKARPKFPHATGTKTTFTGKPQVTVFAPGFC* |
Ga0137384_103600751 | 3300012357 | Vadose Zone Soil | RAILRTLNIPGRQRHSERKQKARPKFPHTAATKHTVTGKPRVTVFAPGFS* |
Ga0137384_112852531 | 3300012357 | Vadose Zone Soil | RRSQRAQKARPKFRHTAATKQTITGKPRVTIFTPSAG* |
Ga0137360_104770321 | 3300012361 | Vadose Zone Soil | RAALHSLNVPARQRHSKRAQKARPKFGHTSATKKTVTGKPQVQVFAPGFS* |
Ga0137360_113068851 | 3300012361 | Vadose Zone Soil | GRQRHSERAQKARPKFRHATATKQTVTGKPQVTVFAPGFS* |
Ga0182024_102239911 | 3300014501 | Permafrost | SQRAQKARPKFAHTSATKTTVTGKPQVTVFVPGAG* |
Ga0187820_13351922 | 3300017924 | Freshwater Sediment | HTLNVPGRQRHSERAQKARPKFPHATATKTTITGKPRVTVFAPGFC |
Ga0187819_106775221 | 3300017943 | Freshwater Sediment | RQRHSERAQKARPKFRHATATKQTVTGKPQVTVFAPGFS |
Ga0187817_101894192 | 3300017955 | Freshwater Sediment | AAARAMLHTLNVPGRQRHAQRAQKARPKFAHTPATKTTITGKPQVTVFAPGFC |
Ga0187816_105296411 | 3300017995 | Freshwater Sediment | RAALHTLNIPGRQRHSERAQKARPKFRHATATKQTITGKPQVTVFAPGFS |
Ga0187805_104946101 | 3300018007 | Freshwater Sediment | LNLPGRQRHSERAQKARPKFPHASATKITVTGKPQVTVFAPGFC |
Ga0187788_105625591 | 3300018032 | Tropical Peatland | ARAALHTLSLPQRQRHSARAQKARPKFPHVTATKTTVTGNPQVTVFAPGFY |
Ga0187766_109980671 | 3300018058 | Tropical Peatland | LNIPGRQRHSKRAQKARPKFPHATATKTTVTGKPQVQVFAPGFS |
Ga0066667_114744621 | 3300018433 | Grasslands Soil | LHTLNVPGRQRHSERAQKARPKFRHATATKQTVTGKPQVTVFAPGFS |
Ga0066662_118935181 | 3300018468 | Grasslands Soil | TLNVPGRQRHSGRAQKARPKFPHTAATKPTVTGKPQVTVFTPGFS |
Ga0210394_113194872 | 3300021420 | Soil | SRAAMHSLNVPGRQRHSQRAQKARPIFAHASATKQTATGKPEVTVFAPGSS |
Ga0207700_111001461 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | NLPGRQRHSERAQKARLKFPHATATKTTTTGKPQLTVFAPGLC |
Ga0210106_10812241 | 3300025983 | Natural And Restored Wetlands | AARAALHTLNVPGRQRHSERAQKARPKFRHATATKTTVTGKPEVRVFAPGFY |
Ga0209839_100325931 | 3300026294 | Soil | AAARAALHTLNVPGRQRHSERAQKARLKFPHATATKATVTGKPQVTVFAPGSC |
Ga0209055_13005862 | 3300026309 | Soil | ILHTLNLPGRQRHSERAQKARPKFPHASATKTTVTGKPQVTVFAPGFY |
Ga0257169_10372401 | 3300026469 | Soil | ARAALHALNVPGRQRHSERAQKARPKFPHATATKTTVTGKPQVTVFAPGSC |
Ga0209517_102566261 | 3300027854 | Peatlands Soil | RSERAQKARPKFPHATATKTTVTGKPQVTVFAPGFY |
Ga0209488_107386801 | 3300027903 | Vadose Zone Soil | TLNVPGRQRHSKRAQKARPKFPHATATKPTITGKPRVTVFAPGFC |
Ga0209415_102698762 | 3300027905 | Peatlands Soil | HTLNIPGRQRHSKRAQKARPKFPHAFATKTTVTGKPQVTVFAPGFC |
Ga0302151_102949031 | 3300028562 | Bog | HSPREQKARPKFPHTSATKQTATGKYQVIVYAPGRC |
Ga0307323_102873801 | 3300028787 | Soil | RQRHSERAQKARPKFPHATATKTTVTGKPQVTVFAPGFY |
Ga0302229_101304302 | 3300028879 | Palsa | PRAALHTLSVPGRQWHSRRAQKARPKFPPATATKVTVTGKPQVTVFASGFS |
Ga0302179_100978811 | 3300030058 | Palsa | HSRRAQKACPKFPHATATKATVTGKPQVTVFAPGFS |
Ga0310037_100330395 | 3300030494 | Peatlands Soil | SKRAQKARPKFPHATATKTTVTGKPQVTVFAPGSC |
Ga0310037_101576931 | 3300030494 | Peatlands Soil | PGRQRHSKRTQKARPKFPHATATKATITGKPQVTVFAPGFC |
Ga0310039_100582013 | 3300030706 | Peatlands Soil | RRSERAQKARPKFPHATATKTTVTGKPQVTVFAPGFY |
Ga0310038_100059006 | 3300030707 | Peatlands Soil | QRHSERARKARPKFPHATATKTTVTGKPQVTVFAPGFC |
Ga0307919_10593921 | 3300030718 | Soil | LNLPGRQRHSERAQKASPKFPHATATKTTITGKPQVTVYAPGSC |
Ga0170824_1218094971 | 3300031231 | Forest Soil | HSERAQKVRPKFRHATATKQTVTGKPQVTVFAPGFS |
Ga0318534_102131221 | 3300031544 | Soil | DCLHTLSLPGRQRHSTRAQKARPKFPHASTTKTTVTGKPQVTVFAPGFS |
Ga0318574_104387791 | 3300031680 | Soil | RAALHTLNIPGRERHSERAQKAHPKFPHASATKTTVTGKPQVTVFAPGFS |
Ga0318574_108108452 | 3300031680 | Soil | HLHTLNIPGRDRHSPRQQKARPKFPHTSATKQTLTGKYQVIAYAPGRR |
Ga0318572_106359062 | 3300031681 | Soil | NIPGRDRHSPRQQKARPKFPHTSATKQTLTGKYQVIAYAPGRR |
Ga0310686_1064271671 | 3300031708 | Soil | ALNIPGRQRHSKRAQKARPKFPHATATKATITGKPQVTVFAPGFY |
Ga0318493_103500021 | 3300031723 | Soil | LHTLNIPGRDRHSPRQQKARPKFPHTSATKQTLTGKYQVIAYAPGRR |
Ga0318552_106409452 | 3300031782 | Soil | ALHVLNVPGRQRHSRRAQKARPKFPHATGTKTTVTGKPQVTVFAPGFY |
Ga0318568_106668681 | 3300031819 | Soil | RHSRRAQKARPKFPHATGTKTTVTGKPQVTVFAPGFY |
Ga0318564_101126211 | 3300031831 | Soil | LHTLHVPGRQRHSKRAQKARPKFPHAIATKTTVTGKPQVQVFAPGFS |
Ga0318517_103441491 | 3300031835 | Soil | RAHLHTLNIPGRDRHSPRQQKARPKFPHTSATKQTLTGKYQVIAYAPGRR |
Ga0318512_104541261 | 3300031846 | Soil | RAALHTLNVYGRERHSKRVQKARPKFAHASMTKQTVTGKPQVTVFAPGYS |
Ga0318536_105618031 | 3300031893 | Soil | SKRGQKARPNFPHATATKTTVTGKPQVTVFAPGFY |
Ga0318520_103743912 | 3300031897 | Soil | SAAAARAHLHTLNIPGRDRHSPRQQKARPKFPHTSATKQTLTGKYQVIAYAPGRR |
Ga0318520_111109801 | 3300031897 | Soil | HTLNIPGRERHSERAQKAHPKFPHASATKTTVTGKPQVTVFAPGFS |
Ga0310910_115808271 | 3300031946 | Soil | AALHVLNIPGRQRHSRRAQKARPKFPHATGTKTTVTGKPQVTVFAPGFY |
Ga0306922_113026931 | 3300032001 | Soil | AALHTLNIPGRQRHSERAQKARPKFAHTSATKTTVTGKPQVNVYAPGFS |
Ga0318563_106376952 | 3300032009 | Soil | TLNVPGRQRHSERAQKARPKFRHATATKQTVTGKPQVTVFAPGFS |
Ga0318570_102858812 | 3300032054 | Soil | ARAALHTLNIPGRERHSERAQKAHPKFPHASATKTTVTGKPQVTVFAPGFS |
Ga0318514_103259023 | 3300032066 | Soil | LNLPGRHRHSGRTQKARPKFPHATATKTTATGKPQVTVFAPGFR |
Ga0306924_113352601 | 3300032076 | Soil | SERAQKARPKFRHATATKQTVTGKPQVTVFAPGFS |
Ga0311301_128260382 | 3300032160 | Peatlands Soil | GRERHSQRAQKARPKFRHTAATKQTVTGKPHVTVFAPDTR |
Ga0311301_130621161 | 3300032160 | Peatlands Soil | HSKRAQKARPKFAHASATKQTVTGKPQVTVFAPGFS |
Ga0335085_102039353 | 3300032770 | Soil | AHAERPGRERHSQRAQKARPKFPHAAATKQTVTGKPQVTVFAPGFS |
Ga0335078_101917261 | 3300032805 | Soil | RAALHTLNLPDRQRHSKRAQKARPKFPHAPASKTTVTGKPQVTVFAPGFY |
Ga0335080_117443942 | 3300032828 | Soil | RQRHSKRAQKARPKFPHATATKTTVTGKPKVTVFAPGFS |
Ga0335081_107170091 | 3300032892 | Soil | ARAHLHALNIPGRNRHSPREQKARPKFPHTSATKPTVTRKYEVIVYAPGRH |
Ga0335069_114444892 | 3300032893 | Soil | AARASLHTLNLPGRQRHSERAQKARPRFPHASATKITVTGKPQVTVFAPGLC |
Ga0335075_100050741 | 3300032896 | Soil | RTLNIPGRRRHSERAQKARPKFPHATATKPTVTGKPQVTVFASGFS |
Ga0335072_102282611 | 3300032898 | Soil | LNIPGRRRHSERAQKARPKFPHATATKPTVTGKPQVTVFAPGFS |
⦗Top⦘ |