Metagenome / Metatranscriptome Family F097941

Basic Information
Family ID	F097941
Family Type	Metagenome / Metatranscriptome
Number of Sequences	104
Average Sequence Length	39 residues
Representative Sequence	MHVKYTSEKLTKIVIVSAIFWLFLLLALSMADYATRLWT
Number of Associated Samples	98
Number of Associated Scaffolds	104

Quality Assessment
Transcriptomic Evidence	Yes
Most common taxonomic group	Bacteria
% of genes with valid RBS motifs	0.00 %
% of genes near scaffold ends (potentially truncated)	96.15 %
% of genes from short scaffolds (< 2000 bps)	90.38 %
Associated GOLD sequencing projects	91
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.55

Most Common Taxonomy
Group	Bacteria (65.385 % of family members)
NCBI Taxonomy ID	2
Taxonomy	All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (15.385 % of family members)
Environment Ontology (ENVO)	Unclassified (26.923 % of family members)
Earth Microbiome Project Ontology (EMPO)	Free-living → Non-saline → Soil (non-saline) (52.885 % of family members)

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Predicted Topology & Secondary Structure
Classification:	Globular	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 55.22% β-sheet: 0.00% Coil/Unstructured: 44.78%
Feature Viewer

Powered by Feature Viewer

Pfam ID	Name	% Frequency in 104 Family Scaffolds
PF01565	FAD_binding_4	25.00
PF13240	zinc_ribbon_2	21.15
PF12838	Fer4_7	10.58
PF13248	zf-ribbon_3	5.77
PF00106	adh_short	0.96
PF04255	DUF433	0.96
PF07244	POTRA	0.96
PF13414	TPR_11	0.96
PF02812	ELFV_dehydrog_N	0.96
PF00510	COX3	0.96
PF13432	TPR_16	0.96
PF01609	DDE_Tnp_1	0.96
PF02913	FAD-oxidase_C	0.96
PF14534	DUF4440	0.96
PF13183	Fer4_8	0.96
PF00115	COX1	0.96
PF02424	ApbE	0.96
PF13534	Fer4_17	0.96

COG ID	Name	Functional Category	% Frequency in 104 Family Scaffolds
COG5659	SRSO17 transposase	Mobilome: prophages, transposons [X]	0.96
COG0277	FAD/FMN-containing lactate dehydrogenase/glycolate oxidase	Energy production and conversion [C]	0.96
COG0334	Glutamate dehydrogenase/leucine dehydrogenase	Amino acid transport and metabolism [E]	0.96
COG1477	FAD:protein FMN transferase ApbE	Posttranslational modification, protein turnover, chaperones [O]	0.96
COG1845	Heme/copper-type cytochrome/quinol oxidase, subunit 3	Energy production and conversion [C]	0.96
COG2442	Predicted antitoxin component of a toxin-antitoxin system, DUF433 family	Defense mechanisms [V]	0.96
COG3039	Transposase and inactivated derivatives, IS5 family	Mobilome: prophages, transposons [X]	0.96
COG3293	Transposase	Mobilome: prophages, transposons [X]	0.96
COG3385	IS4 transposase InsG	Mobilome: prophages, transposons [X]	0.96
COG5421	Transposase	Mobilome: prophages, transposons [X]	0.96
COG5433	Predicted transposase YbfD/YdcC associated with H repeats	Mobilome: prophages, transposons [X]	0.96

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	65.38 %
Unclassified	root	N/A	34.62 %

Name	Rank	Taxonomy	Distribution
cellular organisms	root	All Organisms → cellular organisms	65.38 %
Unclassified	root	N/A	34.62 %

Name	Rank	Taxonomy	Distribution
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	65.38 %
Unclassified	root	N/A	34.62 %

Name	Rank	Taxonomy	Distribution
Acidobacteria	phylum	All Organisms → cellular organisms → Bacteria → Acidobacteria	34.62 %
Unclassified	root	N/A	34.62 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	0.96 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	34.62 %
Acidobacteriia	class	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia	7.69 %
unclassified Acidobacteria	no rank	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria	5.77 %
delta/epsilon subdivisions	subphylum	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions	0.96 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	34.62 %
Acidobacteriales	order	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales	6.73 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	5.77 %
Bryobacterales	order	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales	0.96 %
Deltaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	0.96 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	34.62 %
Acidobacteriaceae	family	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae	5.77 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	5.77 %
unclassified Terriglobales	no rank	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales	0.96 %
Solibacteraceae	family	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae	0.96 %
Syntrophobacterales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales	0.96 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	34.62 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	5.77 %
Candidatus Koribacter	genus	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter	0.96 %
Candidatus Solibacter	genus	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter	0.96 %
Syntrophaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae	0.96 %
Terriglobales bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Terriglobales bacterium	0.96 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	34.62 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	5.77 %
Candidatus Solibacter usitatus	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus	0.96 %
unclassified Syntrophaceae	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → unclassified Syntrophaceae	0.96 %
Candidatus Koribacter	genus	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter	0.96 %
Terriglobales bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Terriglobales bacterium	0.96 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	34.62 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	5.77 %
Syntrophaceae bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → unclassified Syntrophaceae → Syntrophaceae bacterium	0.96 %
Candidatus Solibacter usitatus	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus	0.96 %
Candidatus Koribacter	genus	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter	0.96 %
Terriglobales bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Terriglobales bacterium	0.96 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
3300002561\|JGI25384J37096_10265042	All Organisms → cellular organisms → Bacteria	500	Open in IMG/M
3300005187\|Ga0066675_10375440	All Organisms → cellular organisms → Bacteria	1045	Open in IMG/M
3300005344\|Ga0070661_100080667	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae	2401	Open in IMG/M
3300005434\|Ga0070709_11721178	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae	512	Open in IMG/M
3300005445\|Ga0070708_101803685	All Organisms → cellular organisms → Bacteria	568	Open in IMG/M
3300005534\|Ga0070735_10175086	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter	1322	Open in IMG/M
3300005552\|Ga0066701_10444103	All Organisms → cellular organisms → Bacteria	805	Open in IMG/M
3300005554\|Ga0066661_10673619	Not Available	609	Open in IMG/M
3300005555\|Ga0066692_10078642	All Organisms → cellular organisms → Bacteria	1909	Open in IMG/M
3300005566\|Ga0066693_10466259	All Organisms → cellular organisms → Bacteria	519	Open in IMG/M
3300005602\|Ga0070762_10010749	All Organisms → cellular organisms → Bacteria	4588	Open in IMG/M
3300005610\|Ga0070763_10269847	All Organisms → cellular organisms → Bacteria → Acidobacteria	927	Open in IMG/M
3300005712\|Ga0070764_10080779	All Organisms → cellular organisms → Bacteria	1711	Open in IMG/M
3300005712\|Ga0070764_10618570	All Organisms → cellular organisms → Bacteria	662	Open in IMG/M
3300005764\|Ga0066903_103868212	All Organisms → cellular organisms → Bacteria	804	Open in IMG/M
3300005944\|Ga0066788_10050388	All Organisms → cellular organisms → Bacteria	981	Open in IMG/M
3300006041\|Ga0075023_100480948	All Organisms → cellular organisms → Bacteria	555	Open in IMG/M
3300006047\|Ga0075024_100230520	All Organisms → cellular organisms → Bacteria → Acidobacteria	880	Open in IMG/M
3300006173\|Ga0070716_100101610	All Organisms → cellular organisms → Bacteria	1764	Open in IMG/M
3300006176\|Ga0070765_100017705	All Organisms → cellular organisms → Bacteria	5231	Open in IMG/M
3300006871\|Ga0075434_101905351	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae	600	Open in IMG/M
3300009038\|Ga0099829_10131174	All Organisms → cellular organisms → Bacteria	1984	Open in IMG/M
3300009088\|Ga0099830_10387343	All Organisms → cellular organisms → Bacteria → Acidobacteria	1129	Open in IMG/M
3300009637\|Ga0116118_1256638	Not Available	535	Open in IMG/M
3300009665\|Ga0116135_1422442	All Organisms → cellular organisms → Bacteria	544	Open in IMG/M
3300009683\|Ga0116224_10285271	Not Available	786	Open in IMG/M
3300009700\|Ga0116217_10276688	All Organisms → cellular organisms → Bacteria → Acidobacteria	1084	Open in IMG/M
3300009700\|Ga0116217_11032731	Not Available	503	Open in IMG/M
3300009759\|Ga0116101_1166293	All Organisms → cellular organisms → Bacteria → Acidobacteria	548	Open in IMG/M
3300010303\|Ga0134082_10456137	All Organisms → cellular organisms → Bacteria → Acidobacteria	553	Open in IMG/M
3300010329\|Ga0134111_10282292	All Organisms → cellular organisms → Bacteria → Acidobacteria	688	Open in IMG/M
3300010337\|Ga0134062_10755308	All Organisms → cellular organisms → Bacteria	516	Open in IMG/M
3300010376\|Ga0126381_102871309	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	687	Open in IMG/M
3300011077\|Ga0138572_1102848	Not Available	825	Open in IMG/M
3300011270\|Ga0137391_10934627	Not Available	708	Open in IMG/M
3300012189\|Ga0137388_11635974	Not Available	579	Open in IMG/M
3300012189\|Ga0137388_11899832	Not Available	525	Open in IMG/M
3300012205\|Ga0137362_10287025	All Organisms → cellular organisms → Bacteria → Acidobacteria	1424	Open in IMG/M
3300012360\|Ga0137375_10836797	Not Available	737	Open in IMG/M
3300012362\|Ga0137361_10353756	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae	1348	Open in IMG/M
3300012582\|Ga0137358_10929847	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	568	Open in IMG/M
3300012918\|Ga0137396_10957834	Not Available	623	Open in IMG/M
3300012922\|Ga0137394_11276295	All Organisms → cellular organisms → Bacteria → Acidobacteria	597	Open in IMG/M
3300012929\|Ga0137404_11972559	Not Available	544	Open in IMG/M
3300012944\|Ga0137410_11569700	Not Available	576	Open in IMG/M
3300012944\|Ga0137410_11935531	Not Available	523	Open in IMG/M
3300012957\|Ga0164303_11535014	All Organisms → cellular organisms → Bacteria → Acidobacteria	505	Open in IMG/M
3300015052\|Ga0137411_1171861	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → unclassified Syntrophaceae → Syntrophaceae bacterium	818	Open in IMG/M
3300015089\|Ga0167643_1038993	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	733	Open in IMG/M
3300015199\|Ga0167647_1078276	All Organisms → cellular organisms → Bacteria	865	Open in IMG/M
3300017933\|Ga0187801_10031741	All Organisms → cellular organisms → Bacteria → Acidobacteria	1856	Open in IMG/M
3300017936\|Ga0187821_10002346	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae	6038	Open in IMG/M
3300017943\|Ga0187819_10089877	All Organisms → cellular organisms → Bacteria → Acidobacteria	1834	Open in IMG/M
3300017966\|Ga0187776_11623548	All Organisms → cellular organisms → Bacteria	501	Open in IMG/M
3300017972\|Ga0187781_11151954	Not Available	570	Open in IMG/M
3300018012\|Ga0187810_10210822	All Organisms → cellular organisms → Bacteria → Acidobacteria	791	Open in IMG/M
3300018017\|Ga0187872_10265620	Not Available	763	Open in IMG/M
3300018022\|Ga0187864_10355182	Not Available	641	Open in IMG/M
3300018043\|Ga0187887_10581351	Not Available	661	Open in IMG/M
3300018088\|Ga0187771_10008278	All Organisms → cellular organisms → Bacteria	7451	Open in IMG/M
3300018088\|Ga0187771_10579244	Not Available	951	Open in IMG/M
3300018090\|Ga0187770_10863052	All Organisms → cellular organisms → Bacteria	726	Open in IMG/M
3300018468\|Ga0066662_10814781	All Organisms → cellular organisms → Bacteria	907	Open in IMG/M
3300020581\|Ga0210399_10163849	Not Available	1842	Open in IMG/M
3300020581\|Ga0210399_10353973	All Organisms → cellular organisms → Bacteria	1226	Open in IMG/M
3300021170\|Ga0210400_10764593	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	793	Open in IMG/M
3300021178\|Ga0210408_10319718	All Organisms → cellular organisms → Bacteria	1238	Open in IMG/M
3300021559\|Ga0210409_10821542	Not Available	802	Open in IMG/M
3300021560\|Ga0126371_11387988	All Organisms → cellular organisms → Bacteria → Acidobacteria	834	Open in IMG/M
3300025612\|Ga0208691_1138206	All Organisms → cellular organisms → Bacteria	549	Open in IMG/M
3300025922\|Ga0207646_11100313	Not Available	699	Open in IMG/M
3300025927\|Ga0207687_11855078	All Organisms → cellular organisms → Bacteria → Acidobacteria	516	Open in IMG/M
3300025929\|Ga0207664_11981475	Not Available	505	Open in IMG/M
3300025934\|Ga0207686_10138083	All Organisms → cellular organisms → Bacteria	1681	Open in IMG/M
3300025981\|Ga0207640_11997872	Not Available	525	Open in IMG/M
3300025986\|Ga0207658_11586017	Not Available	598	Open in IMG/M
3300026078\|Ga0207702_12025859	Not Available	566	Open in IMG/M
3300026215\|Ga0209849_1032490	Not Available	902	Open in IMG/M
3300026317\|Ga0209154_1209411	All Organisms → cellular organisms → Bacteria → Acidobacteria	742	Open in IMG/M
3300026318\|Ga0209471_1126010	All Organisms → cellular organisms → Bacteria	1085	Open in IMG/M
3300026358\|Ga0257166_1035498	Not Available	690	Open in IMG/M
3300026514\|Ga0257168_1153447	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	513	Open in IMG/M
3300026528\|Ga0209378_1102035	All Organisms → cellular organisms → Bacteria → Acidobacteria	1265	Open in IMG/M
3300026538\|Ga0209056_10273256	All Organisms → cellular organisms → Bacteria → Acidobacteria	1186	Open in IMG/M
3300027680\|Ga0207826_1056408	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	1086	Open in IMG/M
3300027812\|Ga0209656_10045584	All Organisms → cellular organisms → Bacteria	2510	Open in IMG/M
3300027862\|Ga0209701_10076590	All Organisms → cellular organisms → Bacteria	2111	Open in IMG/M
3300027879\|Ga0209169_10364320	All Organisms → cellular organisms → Bacteria → Acidobacteria	760	Open in IMG/M
3300027986\|Ga0209168_10127733	All Organisms → cellular organisms → Bacteria	1298	Open in IMG/M
3300028016\|Ga0265354_1006154	All Organisms → cellular organisms → Bacteria → Acidobacteria	1196	Open in IMG/M
3300028047\|Ga0209526_10546442	Not Available	749	Open in IMG/M
3300029817\|Ga0247275_1001431	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus	19453	Open in IMG/M
3300030659\|Ga0316363_10092798	All Organisms → cellular organisms → Bacteria → Acidobacteria	1352	Open in IMG/M
3300030707\|Ga0310038_10337367	Not Available	670	Open in IMG/M
3300031718\|Ga0307474_10647652	All Organisms → cellular organisms → Bacteria → Acidobacteria	834	Open in IMG/M
3300031720\|Ga0307469_11549600	Not Available	636	Open in IMG/M
3300031912\|Ga0306921_12621821	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Terriglobales bacterium	520	Open in IMG/M
3300032001\|Ga0306922_10080542	All Organisms → cellular organisms → Bacteria	3418	Open in IMG/M
3300032160\|Ga0311301_12281093	Not Available	617	Open in IMG/M
3300032180\|Ga0307471_103188107	Not Available	581	Open in IMG/M
3300032783\|Ga0335079_10665927	Not Available	1091	Open in IMG/M
3300032893\|Ga0335069_11216243	Not Available	824	Open in IMG/M
3300033158\|Ga0335077_11413160	Not Available	670	Open in IMG/M

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Environmental	Environmental	92.31%
Host-Associated	Host-Associated	7.69%

Habitat	Taxonomy	Distribution
Terrestrial	Environmental → Terrestrial	78.85%
Aquatic	Environmental → Aquatic	13.46%
Plants	Host-Associated → Plants	7.69%

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil	78.85%
Freshwater	Environmental → Aquatic → Freshwater	11.54%
Rhizosphere	Host-Associated → Plants → Rhizosphere	5.77%
Sediment	Environmental → Aquatic → Sediment	1.92%
Rhizoplane	Host-Associated → Plants → Rhizoplane	1.92%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified	54.81%
Loam	Environmental → Terrestrial → Soil → Loam	13.46%
Wetlands	Environmental → Aquatic → Freshwater → Wetlands	11.54%
Wetlands	Environmental → Terrestrial → Soil → Wetlands	10.58%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	2.88%
Soil	Host-Associated → Plants → Rhizosphere → Soil	2.88%
Unclassified	Environmental → Aquatic → Sediment → Unclassified	1.92%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	1.92%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified → Unclassified	32.69%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil	11.54%
Grasslands	Environmental → Terrestrial → Soil → Unclassified → Grasslands	10.58%
Unclassified	Environmental → Terrestrial → Soil → Wetlands → Unclassified	8.65%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil	8.65%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil	4.81%
Bog	Environmental → Aquatic → Freshwater → Wetlands → Bog	3.85%
Unclassified	Environmental → Aquatic → Freshwater → Wetlands → Unclassified	3.85%
Sediment	Environmental → Aquatic → Freshwater → Wetlands → Sediment	3.85%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	2.88%
Unclassified	Host-Associated → Plants → Rhizosphere → Soil → Unclassified	2.88%
Unclassified	Environmental → Aquatic → Sediment → Unclassified → Unclassified	1.92%
Permafrost	Environmental → Terrestrial → Soil → Wetlands → Permafrost	1.92%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	1.92%

Habitat	Taxonomy	Distribution
Vadose Zone Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil	15.38%
Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil	8.65%
Peatlands Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil	6.73%
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	6.73%
Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil	5.77%
Tropical Peatland	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland	4.81%
Peatland	Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland	3.85%
Freshwater Sediment	Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment	3.85%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere	3.85%
Peatland	Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland	2.88%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil	2.88%
Hardwood Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil	2.88%
Soil	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil	2.88%
Watersheds	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds	1.92%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil	1.92%
Glacier Forefield Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil	1.92%
Surface Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil	1.92%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil	1.92%
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	1.92%
Soil	Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil	1.92%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil	1.92%
Corn Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere	1.92%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	1.92%
Bog Forest Soil	Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil	0.96%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	0.96%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	0.96%
Bog Forest Soil	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil	0.96%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil	0.96%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil	0.96%
Populus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere	0.96%
Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere	0.96%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere	0.96%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere	0.96%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
3300002561	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_40cm	Environmental	Open in IMG/M
3300005187	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124	Environmental	Open in IMG/M
3300005344	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG	Host-Associated	Open in IMG/M
3300005434	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG	Environmental	Open in IMG/M
3300005445	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG	Environmental	Open in IMG/M
3300005534	Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1	Environmental	Open in IMG/M
3300005552	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150	Environmental	Open in IMG/M
3300005554	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110	Environmental	Open in IMG/M
3300005555	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141	Environmental	Open in IMG/M
3300005566	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142	Environmental	Open in IMG/M
3300005602	Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2	Environmental	Open in IMG/M
3300005610	Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3	Environmental	Open in IMG/M
3300005712	Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4	Environmental	Open in IMG/M
3300005764	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)	Environmental	Open in IMG/M
3300005944	Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 2 DNA2013-048	Environmental	Open in IMG/M
3300006041	Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014	Environmental	Open in IMG/M
3300006047	Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013	Environmental	Open in IMG/M
3300006173	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG	Environmental	Open in IMG/M
3300006176	Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5	Environmental	Open in IMG/M
3300006871	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3	Host-Associated	Open in IMG/M
3300009038	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG	Environmental	Open in IMG/M
3300009088	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG	Environmental	Open in IMG/M
3300009637	Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_40	Environmental	Open in IMG/M
3300009665	Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_10	Environmental	Open in IMG/M
3300009683	Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_b_LC metaG	Environmental	Open in IMG/M
3300009700	Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG	Environmental	Open in IMG/M
3300009759	Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_4_10	Environmental	Open in IMG/M
3300010303	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09182015	Environmental	Open in IMG/M
3300010329	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_11112015	Environmental	Open in IMG/M
3300010337	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015	Environmental	Open in IMG/M
3300010343	Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1	Environmental	Open in IMG/M
3300010376	Tropical forest soil microbial communities from Panama - MetaG Plot_28	Environmental	Open in IMG/M
3300011077	Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 57 (Metagenome Metatranscriptome) (version 2)	Environmental	Open in IMG/M
3300011270	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG	Environmental	Open in IMG/M
3300012189	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG	Environmental	Open in IMG/M
3300012205	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG	Environmental	Open in IMG/M
3300012360	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaG	Environmental	Open in IMG/M
3300012362	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG	Environmental	Open in IMG/M
3300012582	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG	Environmental	Open in IMG/M
3300012918	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG	Environmental	Open in IMG/M
3300012922	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG	Environmental	Open in IMG/M
3300012929	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly)	Environmental	Open in IMG/M
3300012944	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly)	Environmental	Open in IMG/M
3300012957	Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG	Environmental	Open in IMG/M
3300015052	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (PacBio error correction)	Environmental	Open in IMG/M
3300015089	Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G8A, Adjacent to main proglacial river, end of transect (Watson river))	Environmental	Open in IMG/M
3300015199	Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-2c, rock/snow interface)	Environmental	Open in IMG/M
3300017933	Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_1	Environmental	Open in IMG/M
3300017936	Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_1	Environmental	Open in IMG/M
3300017943	Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4	Environmental	Open in IMG/M
3300017966	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MG	Environmental	Open in IMG/M
3300017972	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG	Environmental	Open in IMG/M
3300018012	Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_5	Environmental	Open in IMG/M
3300018017	Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_40	Environmental	Open in IMG/M
3300018022	Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_40	Environmental	Open in IMG/M
3300018043	Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_10	Environmental	Open in IMG/M
3300018088	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MG	Environmental	Open in IMG/M
3300018090	Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MG	Environmental	Open in IMG/M
3300018468	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111	Environmental	Open in IMG/M
3300020581	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M	Environmental	Open in IMG/M
3300021170	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M	Environmental	Open in IMG/M
3300021178	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M	Environmental	Open in IMG/M
3300021559	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M	Environmental	Open in IMG/M
3300021560	Tropical forest soil microbial communities from Panama - MetaG Plot_4	Environmental	Open in IMG/M
3300025612	Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_10 (SPAdes)	Environmental	Open in IMG/M
3300025922	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes)	Environmental	Open in IMG/M
3300025927	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025929	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes)	Environmental	Open in IMG/M
3300025934	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025981	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes)	Host-Associated	Open in IMG/M
3300025986	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300026078	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026215	Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 2 DNA2013-048 (SPAdes)	Environmental	Open in IMG/M
3300026317	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 (SPAdes)	Environmental	Open in IMG/M
3300026318	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 (SPAdes)	Environmental	Open in IMG/M
3300026358	Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - CO-14-B	Environmental	Open in IMG/M
3300026514	Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-13-B	Environmental	Open in IMG/M
3300026528	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 (SPAdes)	Environmental	Open in IMG/M
3300026538	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes)	Environmental	Open in IMG/M
3300027680	Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 80 (SPAdes)	Environmental	Open in IMG/M
3300027812	Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2 (SPAdes)	Environmental	Open in IMG/M
3300027862	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes)	Environmental	Open in IMG/M
3300027879	Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 (SPAdes)	Environmental	Open in IMG/M
3300027986	Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 (SPAdes)	Environmental	Open in IMG/M
3300028016	Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1	Host-Associated	Open in IMG/M
3300028047	Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes)	Environmental	Open in IMG/M
3300029817	Soil microbial communities from Marcell Experimental Forest, Minnesota, USA - Bog25	Environmental	Open in IMG/M
3300030659	Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG (v2)	Environmental	Open in IMG/M
3300030707	Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG (v2)	Environmental	Open in IMG/M
3300031718	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05	Environmental	Open in IMG/M
3300031720	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515	Environmental	Open in IMG/M
3300031912	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2)	Environmental	Open in IMG/M
3300032001	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2)	Environmental	Open in IMG/M
3300032160	Sb_50d combined assembly (MetaSPAdes)	Environmental	Open in IMG/M
3300032180	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515	Environmental	Open in IMG/M
3300032783	Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3	Environmental	Open in IMG/M
3300032893	Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1	Environmental	Open in IMG/M
3300033158	Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1	Environmental	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
JGI25384J37096_102650422	3300002561	Grasslands Soil	FFMHVRYTSEKLTAMVIVSALFWLLILLTLSLADYSTRPIG*
Ga0066675_103754403	3300005187	Soil	MHLKYTSEKMTSVVVISALFWLLILLALSLADYTTRPLGVN*
Ga0070661_1000806673	3300005344	Corn Rhizosphere	VLIFMHVKYASERLVKAVVVSAIFFLLLLLGLSLADYTTRLL*
Ga0070709_117211782	3300005434	Corn, Switchgrass And Miscanthus Rhizosphere	FFMHVKYTHERLTPLVIVSALFFLGLLLSLSMADFGTRGWH*
Ga0070708_1018036851	3300005445	Corn, Switchgrass And Miscanthus Rhizosphere	LFFMHVKYTSEKLTAMVIVSALFWLLILLTLSLADYSTRPIG*
Ga0070735_101750861	3300005534	Surface Soil	VKYTSERLTKIVIVSAMFWLFLLLGLSMADYVTRFLS*
Ga0066701_104441032	3300005552	Soil	VLFFMHVKYTSERLTKMVIVSALFWMFILLSLSMADYATRLWK*
Ga0066661_106736191	3300005554	Soil	KYTHEKMTGLVVASAIFWLFILLALSMADYTTRLWR*
Ga0066692_100786421	3300005555	Soil	LKYTSEKMTSVVVISALFWLLILLALSLADYTTRPLGVN*
Ga0066693_104662591	3300005566	Soil	TSEKLTTMVIVSALFWLLILLALSLADYSTRPIS*
Ga0070762_100107491	3300005602	Soil	VKYTSEKLTKIVIVSAIFWLFLLLALSMADYATRLWT*
Ga0070763_102698473	3300005610	Soil	YTSEKLTKIVIVSAIFWLFLLLALSMADYATRLWT*
Ga0070764_100807791	3300005712	Soil	HVKYTSEKLTKIVIVSAIFWLFLLLALSMADYATRLLS*
Ga0070764_106185702	3300005712	Soil	FFMHVKYASEKLTKMVIVASIFWLLLLLLLSLADYGTRYARHG*
Ga0066903_1038682121	3300005764	Tropical Forest Soil	KYAHDKITKVVIVAALFWLAILLALSMADYTTRLWT*
Ga0066788_100503883	3300005944	Soil	VKYISDRLTKMVVVAVIFWLFLLLGLSLMDYGTRHFG*
Ga0075023_1004809482	3300006041	Watersheds	VLIFMHVKYTSEKLTKAVIISAIFFLGLLLTLSLADFGTRAWL*
Ga0075024_1002305201	3300006047	Watersheds	IFMHVKYTSDKLVKVVVISAVFFLLLLLGLSLADYTTRLLM*
Ga0070716_1001016101	3300006173	Corn, Switchgrass And Miscanthus Rhizosphere	LIFMHVKYTSDRLVKVVVISAVFFLLLLLGLSLADYTTRLLM*
Ga0070765_1000177054	3300006176	Soil	TSEKLTKIVIVSAIFWLFLLLALSMADYATRLWT*
Ga0075434_1019053511	3300006871	Populus Rhizosphere	MHVKGASEKMTKVVIFSGIFFLLLLLTLTMADYGTRLWT*
Ga0099829_101311742	3300009038	Vadose Zone Soil	VVLFFMHVKYTHEKLTGLVVLSAIFWLFVLLALSMADYATRLWR*
Ga0099830_103873433	3300009088	Vadose Zone Soil	KYTSEKLTKMVIASAMFWLFILLSLSMADYATRLWK*
Ga0116118_12566381	3300009637	Peatland	KYTHEKLTGLVIVSAIFFLFILLALSMADYTTRLWR*
Ga0116135_14224422	3300009665	Peatland	LFFMHVKYASEKLTKLVIASAIFFLILLLSLSMIDYLTRYLA*
Ga0116224_102852712	3300009683	Peatlands Soil	LFYMHVKYTHEKLTGLVIVSAIFFLFILLALSMADYTTRLWR*
Ga0116217_102766881	3300009700	Peatlands Soil	KYTSEKMTKVVVVSAIFWLLTLLALSLADYTTRLLA*
Ga0116217_110327312	3300009700	Peatlands Soil	YTSEKLTKIVIVSAIFWLLLLLALSMADYTTRLWT*
Ga0116101_11662931	3300009759	Peatland	LFFMHVKYTSEKLTKIVIVSAIFWLFLLLALSMADYATRLLS*
Ga0134082_104561372	3300010303	Grasslands Soil	HLKYTSERMTSVVVVSALFWLLILLALSLADYTTRPLGVN*
Ga0134111_102822922	3300010329	Grasslands Soil	FMHLKYTSEKMTSVVVISAIVHVLILLALSLADYSTLPLGVS*
Ga0134062_107553081	3300010337	Grasslands Soil	MHVKYTSEKLTAMVIVSALFWLLILLTLSLADYSTRPIG*
Ga0074044_100147666	3300010343	Bog Forest Soil	MHVKYSSERLTKVVIVSSVFWLVILLLLSLADYSTRGNVRIM*
Ga0126381_1028713091	3300010376	Tropical Forest Soil	KYTSEKMTKVVIACALFWLLILLALSMTDYATRHLA*
Ga0138572_11028481	3300011077	Peatlands Soil	THEKLTGLVIVSAIFFLFILLALSMADYTTRLWR*
Ga0137391_109346272	3300011270	Vadose Zone Soil	VLIFMHVKYASEKLIKVVVISAVFFLMLLLGLSLADYTTRMLM*
Ga0137388_116359741	3300012189	Vadose Zone Soil	LFFMHVKYTHEKMTGLVVASAIFWLFILLALSMADYTTRLWR*
Ga0137388_118998321	3300012189	Vadose Zone Soil	KYTHEKLTGLVVLSAIFWLFVLLALSMADYTTRLWR*
Ga0137362_102870251	3300012205	Vadose Zone Soil	KYTSEKMTSVVVISALFWLLILLALSLADYTTRPLGVN*
Ga0137375_108367972	3300012360	Vadose Zone Soil	VKYAHEKMTKLVIVTGIFFLFILLALSMADYGTRLWS*
Ga0137361_103537561	3300012362	Vadose Zone Soil	LFFMHVKYAHEKMTKLVIVTAIFFLFILLALSMADYGTRLWS*
Ga0137358_109298471	3300012582	Vadose Zone Soil	MHVKYTHEKLTGLVVVSAIFWLFVLLALSMADYTTRLWR*
Ga0137396_109578342	3300012918	Vadose Zone Soil	MHVKYTHEKLTGLVVASAIFWLFILLALSMADYTTRLWR*
Ga0137394_112762952	3300012922	Vadose Zone Soil	LFFMHLKYTSEKMTSVVVISALFWLLILLALSLADYTTRPLGVN*
Ga0137404_119725591	3300012929	Vadose Zone Soil	IFMHVKYTSEKLVKAVVLSAVFFLLLLLGLSLADYTTRLLM*
Ga0137410_115697002	3300012944	Vadose Zone Soil	KYASDKLVKVVVISALFFLMLLLGLSLADYSTRLL*
Ga0137410_119355312	3300012944	Vadose Zone Soil	MHVKYAHEKMTKLVIVTGIFFLFILLALSMADYGTRLWS*
Ga0164303_115350141	3300012957	Soil	KYTSEKLVKVVVISAIFFLLLLLGLSLADYTTRLLM*
Ga0137411_11718611	3300015052	Vadose Zone Soil	VVLFFMHVKYTSERMTKAKVVIVAAIFWLLLLLGLSLADYATRLRG*
Ga0167643_10389931	3300015089	Glacier Forefield Soil	HVKYTSEKLTKVVIVSAIFFLVILLSLSMADYGTRLMQ*
Ga0167647_10782763	3300015199	Glacier Forefield Soil	IFMHVKYTSEKLTKLVVISAVFWLFILLALSLFDYGTRTLG*
Ga0187801_100317413	3300017933	Freshwater Sediment	FMHVKYTSEKLTKIVIASAIFWLFLLLALSMADYGTRFLS
Ga0187821_100023461	3300017936	Freshwater Sediment	YASDRLTKVVLISALFWLFLLLGLSLADYTTRALR
Ga0187819_100898773	3300017943	Freshwater Sediment	LFFMHVKYTSEKLTKIVIASAIFWLFLLLALSMADYGTRLLS
Ga0187776_116235482	3300017966	Tropical Peatland	LVVLFFMHVKYTHERLTPLVILSAIFFLGLLLALSMADYGTRLWH
Ga0187781_111519541	3300017972	Tropical Peatland	VKYASEKLTKVVIISSVFWLLLLLILSLADYSTRGNVRIM
Ga0187810_102108221	3300018012	Freshwater Sediment	LFFMHVKYTSEKLTKIVIISSIFWLLLLLALSMADYTTRLIS
Ga0187872_102656201	3300018017	Peatland	YMHVKYTHEKLTGLVIVSAIFFLFILLALSMADYTTRLWR
Ga0187864_103551821	3300018022	Peatland	KYTHEKLTGLVIVSAIFFLFILLALSMADYTTRLWR
Ga0187887_105813511	3300018043	Peatland	VVLFFMHVKYTHEKLTGLVVVSAIFWLGLLLGLSMLDYGTRLWQ
Ga0187771_100082781	3300018088	Tropical Peatland	HVKYASEKLTKMVIVSALFWLLILLFLSLADYTTRGIGHA
Ga0187771_105792442	3300018088	Tropical Peatland	MHVKYASEKLTKVVILSSLFWLILLLVLSLADYSTRSVHAM
Ga0187770_108630522	3300018090	Tropical Peatland	VKYTSEKLTKLVIVASIFWLLVLLFLSLADYSTRYGHA
Ga0066662_108147812	3300018468	Grasslands Soil	YTSEKLTAMVIVSALFWLLILLTLSLADYSTRPIG
Ga0210399_101638492	3300020581	Soil	FMHVKYAHERLTKLVIVTAIFFFLILLTLSMADYATRLWT
Ga0210399_103539733	3300020581	Soil	VRYASDKLIKVVVVSALFFLLLLLGLSLADYSTRMLA
Ga0210400_107645932	3300021170	Soil	YTHEKLTKMVIATAIFFFLILLVLSMADYGTRLWT
Ga0210408_103197183	3300021178	Soil	LLVVMIFMHVRYASDKLIKVVVVSALFFLLLLLGLSLADYSTRMLA
Ga0210409_108215422	3300021559	Soil	FMHVKYTSEKLTKIVIVAAIFWLFLLLALSMADYATRLWT
Ga0126371_113879881	3300021560	Tropical Forest Soil	YGTSERMTKVVIVSGLFFLMLLLGLSLADYATRAWS
Ga0208691_11382061	3300025612	Peatland	VLFFMHVKYASEKLTKLVIASAIFFLILLLSLSMIDYLTRYLA
Ga0207646_111003131	3300025922	Corn, Switchgrass And Miscanthus Rhizosphere	HVKYTHEKMTGLVVASAIFWLFILLALSMADYTTRLWR
Ga0207687_118550782	3300025927	Miscanthus Rhizosphere	IFMHVKYTSEKLVKVVVISAIFFLLLLLGLSLADYTTRLLM
Ga0207664_119814752	3300025929	Agricultural Soil	FMHVKYAHDKMTKVVIVAALFWLAILLALSMADYTTRLWT
Ga0207686_101380833	3300025934	Miscanthus Rhizosphere	FMHVKYASERLVKVVVVSAIFFLLLLLGLSLADYTTRLL
Ga0207640_119978722	3300025981	Corn Rhizosphere	VKYTSEKLTKTVGLATLFWLALLLFLTLTDYATRGVPS
Ga0207658_115860171	3300025986	Switchgrass Rhizosphere	KYASERLVKAVVVSAIFFLLLLLGLSLADYTTRLL
Ga0207702_120258592	3300026078	Corn Rhizosphere	HVKYTSDSLVKVVVISAVFFLLLLLGLSLADYTTRLLM
Ga0209849_10324902	3300026215	Soil	MHVKYISDRLTKMVVVAVIFWLFLLLGLSLMDYGTRHFG
Ga0209154_12094111	3300026317	Soil	KYTSEKMTSVVVISALFWLLILLALSLADYTTRPLGVN
Ga0209471_11260101	3300026318	Soil	VVLFFMHVKYTSERLTVMVIVSALFWLLILLTLSLADYSTRPIG
Ga0257166_10354981	3300026358	Soil	FFMHVKYTHEKLTGLVVVSAIFWLFVLLALSMADYTTRLWR
Ga0257168_11534471	3300026514	Soil	FMHVKYTHEKLTGLVVVSAIFWLFILLALSMADYTTRLWR
Ga0209378_11020351	3300026528	Soil	HLKYTSEKMTSVVVISALFWLLILLALSLADYTTRPLGVN
Ga0209056_102732561	3300026538	Soil	HLKYTNEKMTSVVVISALFWLLILLALSLADYSTRPLGVS
Ga0207826_10564083	3300027680	Tropical Forest Soil	MHVKYTHEKLVPLVSVSAIFFMGLLLALSMADYGTRFWQ
Ga0209656_100455841	3300027812	Bog Forest Soil	FFMHVKYTSEKLTKIVIVSAIFWLLLLLVLSMADYATRLLA
Ga0209701_100765902	3300027862	Vadose Zone Soil	LFFMHVKYTSEKLTKMVIASAMFWLFILLSLSMADYATRLWK
Ga0209169_103643201	3300027879	Soil	LFFLHVKYTSEKLTKIVIVSAIFWLFLLLALSMADYATRLLS
Ga0209168_101277333	3300027986	Surface Soil	VKYTSERLTKIVIVSAMFWLFLLLGLSMADYVTRFLS
Ga0265354_10061541	3300028016	Rhizosphere	MHVKYTSEKLTKIVIVSAIFWLFLLLALSMADYATRLWT
Ga0209526_105464422	3300028047	Forest Soil	MHVKYTHEKLTGLVVVSAIFWLFVLLALSMADYTTRLWR
Ga0247275_100143118	3300029817	Soil	YTHEKLTGLVIVSAIFFLFILLALSMADYTTRLWR
Ga0316363_100927981	3300030659	Peatlands Soil	VVLFFMHVKYTSEKLTKIVITAAIFWLFLLLALSMADYGTRFLS
Ga0310038_103373671	3300030707	Peatlands Soil	KYTSEKMTKVVVVSAIFWLLTLLALSLADYTTRLLA
Ga0307474_106476522	3300031718	Hardwood Forest Soil	VLFFMHVKYTSERLTKIVIVSAIFWLFLLLALSMADYATRFLS
Ga0307469_115496001	3300031720	Hardwood Forest Soil	VKYLSERLVKVVVISALFFLLLLLGLSLADYTTRLLA
Ga0306921_126218211	3300031912	Soil	HVKYAHEKMTKLVIMTAIFFFLILLALTMADYGTRLWT
Ga0306922_100805423	3300032001	Soil	HVKYTHEKLVPLVIVSAIFFLFLLLGLSMADYATRLWH
Ga0311301_122810932	3300032160	Peatlands Soil	FFMHVKYTHEKLTGLVIASAILFLFILLSLSMADYATRYWQ
Ga0307471_1031881071	3300032180	Hardwood Forest Soil	YTHEKMTGLVVASAIFWLFILLALSMADYTTRLWR
Ga0335079_106659273	3300032783	Soil	FFMHAKYTSERMTKVVIAAGIFFLLLLLGLSLADYTTRL
Ga0335069_112162431	3300032893	Soil	KYTSEKLTKVVIVSGIFFLLLLLGLSLADYSTRLIG
Ga0335077_114131602	3300033158	Soil	YTSEKLTKMVIVSSIFWLLLLLGLSMADYTTRLIG

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.55
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.55
Powered by PDBe Molstar

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome / Metatranscriptome Family F097941

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Gene Neighborhood

Neighboring Pfam domains

Neighboring Clusters of Orthologous Genes (COGs)

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign