Basic Information | |
---|---|
Family ID | F097933 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 104 |
Average Sequence Length | 40 residues |
Representative Sequence | YYGRSAVLLVAWVAAFAIIRGVRDIVLAFRVREVQHAAAR |
Number of Associated Samples | 91 |
Number of Associated Scaffolds | 104 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 0.96 % |
% of genes near scaffold ends (potentially truncated) | 97.12 % |
% of genes from short scaffolds (< 2000 bps) | 90.38 % |
Associated GOLD sequencing projects | 89 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.59 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (86.538 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (28.846 % of family members) |
Environment Ontology (ENVO) | Unclassified (32.692 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (49.038 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Transmembrane (alpha-helical) | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 55.88% β-sheet: 0.00% Coil/Unstructured: 44.12% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.59 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 104 Family Scaffolds |
---|---|---|
PF01694 | Rhomboid | 10.58 |
PF03706 | LPG_synthase_TM | 10.58 |
PF06210 | DUF1003 | 6.73 |
PF00069 | Pkinase | 5.77 |
PF06182 | ABC2_membrane_6 | 2.88 |
PF03699 | UPF0182 | 1.92 |
PF02597 | ThiS | 1.92 |
PF12831 | FAD_oxidored | 0.96 |
PF06224 | HTH_42 | 0.96 |
PF03816 | LytR_cpsA_psr | 0.96 |
PF05239 | PRC | 0.96 |
PF06202 | GDE_C | 0.96 |
PF01475 | FUR | 0.96 |
PF12680 | SnoaL_2 | 0.96 |
PF13459 | Fer4_15 | 0.96 |
PF05137 | PilN | 0.96 |
PF03729 | DUF308 | 0.96 |
PF02371 | Transposase_20 | 0.96 |
PF13385 | Laminin_G_3 | 0.96 |
PF13515 | FUSC_2 | 0.96 |
PF03176 | MMPL | 0.96 |
PF05988 | DUF899 | 0.96 |
PF01594 | AI-2E_transport | 0.96 |
PF00296 | Bac_luciferase | 0.96 |
PF11139 | SfLAP | 0.96 |
PF01613 | Flavin_Reduct | 0.96 |
PF00512 | HisKA | 0.96 |
PF01872 | RibD_C | 0.96 |
PF00753 | Lactamase_B | 0.96 |
PF00781 | DAGK_cat | 0.96 |
PF12697 | Abhydrolase_6 | 0.96 |
PF01266 | DAO | 0.96 |
PF06262 | Zincin_1 | 0.96 |
PF03466 | LysR_substrate | 0.96 |
PF03358 | FMN_red | 0.96 |
PF13411 | MerR_1 | 0.96 |
COG ID | Name | Functional Category | % Frequency in 104 Family Scaffolds |
---|---|---|---|
COG0515 | Serine/threonine protein kinase | Signal transduction mechanisms [T] | 23.08 |
COG0392 | Predicted membrane flippase AglD2/YbhN, UPF0104 family | Cell wall/membrane/envelope biogenesis [M] | 10.58 |
COG0705 | Membrane-associated serine protease, rhomboid family | Posttranslational modification, protein turnover, chaperones [O] | 10.58 |
COG4420 | Uncharacterized membrane protein | Function unknown [S] | 6.73 |
COG3694 | ABC-type uncharacterized transport system, permease component | General function prediction only [R] | 2.88 |
COG1597 | Phosphatidylglycerol kinase, diacylglycerol kinase family | Lipid transport and metabolism [I] | 1.92 |
COG1615 | Uncharacterized membrane protein, UPF0182 family | Function unknown [S] | 1.92 |
COG1977 | Molybdopterin synthase sulfur carrier subunit MoaD | Coenzyme transport and metabolism [H] | 1.92 |
COG2104 | Sulfur carrier protein ThiS (thiamine biosynthesis) | Coenzyme transport and metabolism [H] | 1.92 |
COG3166 | Type IV pilus assembly protein PilN | Cell motility [N] | 1.92 |
COG0262 | Dihydrofolate reductase | Coenzyme transport and metabolism [H] | 0.96 |
COG0628 | Predicted PurR-regulated permease PerM | General function prediction only [R] | 0.96 |
COG0735 | Fe2+ or Zn2+ uptake regulation protein Fur/Zur | Inorganic ion transport and metabolism [P] | 0.96 |
COG1033 | Predicted exporter protein, RND superfamily | General function prediction only [R] | 0.96 |
COG1316 | Anionic cell wall polymer biosynthesis enzyme TagV/TagU, LytR-Cps2A-Psr (LCP) family (peptidoglycan teichoic acid transferase) | Cell wall/membrane/envelope biogenesis [M] | 0.96 |
COG1853 | FMN reductase RutF, DIM6/NTAB family | Energy production and conversion [C] | 0.96 |
COG1985 | Pyrimidine reductase, riboflavin biosynthesis | Coenzyme transport and metabolism [H] | 0.96 |
COG2141 | Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase) | Coenzyme transport and metabolism [H] | 0.96 |
COG2409 | Predicted lipid transporter YdfJ, MMPL/SSD domain, RND superfamily | General function prediction only [R] | 0.96 |
COG3214 | DNA glycosylase YcaQ, repair of DNA interstrand crosslinks | Replication, recombination and repair [L] | 0.96 |
COG3247 | Acid resistance membrane protein HdeD, DUF308 family | General function prediction only [R] | 0.96 |
COG3408 | Glycogen debranching enzyme (alpha-1,6-glucosidase) | Carbohydrate transport and metabolism [G] | 0.96 |
COG3547 | Transposase | Mobilome: prophages, transposons [X] | 0.96 |
COG3824 | Predicted Zn-dependent protease, minimal metalloprotease (MMP)-like domain | Posttranslational modification, protein turnover, chaperones [O] | 0.96 |
COG4312 | Predicted dithiol-disulfide oxidoreductase, DUF899 family | General function prediction only [R] | 0.96 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 86.54 % |
Unclassified | root | N/A | 13.46 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2162886013|SwBSRL2_contig_6960934 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → unclassified Thermoleophilia → Thermoleophilia bacterium | 908 | Open in IMG/M |
2170459005|F1BAP7Q02GT3Y1 | Not Available | 510 | Open in IMG/M |
3300001139|JGI10220J13317_10625442 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 941 | Open in IMG/M |
3300003996|Ga0055467_10157730 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 682 | Open in IMG/M |
3300004114|Ga0062593_100939942 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 879 | Open in IMG/M |
3300004114|Ga0062593_103213871 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 524 | Open in IMG/M |
3300004156|Ga0062589_100009494 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 3943 | Open in IMG/M |
3300005294|Ga0065705_10588429 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 714 | Open in IMG/M |
3300005329|Ga0070683_101033379 | All Organisms → cellular organisms → Bacteria | 789 | Open in IMG/M |
3300005367|Ga0070667_100547571 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1063 | Open in IMG/M |
3300005471|Ga0070698_101835195 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae | 559 | Open in IMG/M |
3300005526|Ga0073909_10407722 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 641 | Open in IMG/M |
3300005545|Ga0070695_101807780 | All Organisms → cellular organisms → Bacteria | 513 | Open in IMG/M |
3300005577|Ga0068857_100049255 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 3738 | Open in IMG/M |
3300005764|Ga0066903_108776343 | All Organisms → cellular organisms → Bacteria | 513 | Open in IMG/M |
3300005843|Ga0068860_100424749 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1318 | Open in IMG/M |
3300006173|Ga0070716_100207297 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1307 | Open in IMG/M |
3300006173|Ga0070716_101598806 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 535 | Open in IMG/M |
3300006237|Ga0097621_101471583 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 646 | Open in IMG/M |
3300006806|Ga0079220_11071881 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 649 | Open in IMG/M |
3300006844|Ga0075428_101660846 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 667 | Open in IMG/M |
3300006871|Ga0075434_100324548 | Not Available | 1560 | Open in IMG/M |
3300006871|Ga0075434_100543393 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1182 | Open in IMG/M |
3300006904|Ga0075424_100688401 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1092 | Open in IMG/M |
3300009100|Ga0075418_13014700 | Not Available | 513 | Open in IMG/M |
3300009147|Ga0114129_12573705 | Not Available | 608 | Open in IMG/M |
3300010093|Ga0127490_1013792 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 543 | Open in IMG/M |
3300010154|Ga0127503_10481510 | All Organisms → cellular organisms → Bacteria | 1409 | Open in IMG/M |
3300010359|Ga0126376_12998876 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 522 | Open in IMG/M |
3300010376|Ga0126381_100603851 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1561 | Open in IMG/M |
3300010376|Ga0126381_103730020 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium RBG_16_68_12 | 596 | Open in IMG/M |
3300010403|Ga0134123_13575380 | Not Available | 504 | Open in IMG/M |
3300011000|Ga0138513_100081993 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 501 | Open in IMG/M |
3300012208|Ga0137376_10164077 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1914 | Open in IMG/M |
3300012208|Ga0137376_11376983 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 596 | Open in IMG/M |
3300012350|Ga0137372_10395027 | All Organisms → cellular organisms → Bacteria | 1049 | Open in IMG/M |
3300012473|Ga0157340_1013367 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 615 | Open in IMG/M |
3300012513|Ga0157326_1026156 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 748 | Open in IMG/M |
3300012885|Ga0157287_1065689 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 606 | Open in IMG/M |
3300012901|Ga0157288_10052036 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 956 | Open in IMG/M |
3300012909|Ga0157290_10401435 | Not Available | 535 | Open in IMG/M |
3300012914|Ga0157297_10111965 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 836 | Open in IMG/M |
3300012915|Ga0157302_10518195 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → unclassified Actinobacteria → Actinobacteria bacterium 13_1_20CM_3_68_9 | 519 | Open in IMG/M |
3300012957|Ga0164303_10351415 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 891 | Open in IMG/M |
3300012960|Ga0164301_10017321 | All Organisms → cellular organisms → Bacteria | 3125 | Open in IMG/M |
3300012961|Ga0164302_10756938 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 727 | Open in IMG/M |
3300012986|Ga0164304_10584674 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 831 | Open in IMG/M |
3300012987|Ga0164307_11050237 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 666 | Open in IMG/M |
3300012988|Ga0164306_10052243 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 2479 | Open in IMG/M |
3300012988|Ga0164306_10804052 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 757 | Open in IMG/M |
3300012988|Ga0164306_11182400 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 640 | Open in IMG/M |
3300012989|Ga0164305_10645942 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 857 | Open in IMG/M |
3300013296|Ga0157374_12470191 | Not Available | 547 | Open in IMG/M |
3300015077|Ga0173483_10209126 | Not Available | 903 | Open in IMG/M |
3300015262|Ga0182007_10118329 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 885 | Open in IMG/M |
3300015371|Ga0132258_11058362 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2051 | Open in IMG/M |
3300016371|Ga0182034_10981509 | All Organisms → cellular organisms → Bacteria | 729 | Open in IMG/M |
3300017947|Ga0187785_10608163 | All Organisms → cellular organisms → Bacteria | 562 | Open in IMG/M |
3300017959|Ga0187779_10067098 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2112 | Open in IMG/M |
3300017966|Ga0187776_10586681 | All Organisms → cellular organisms → Bacteria | 774 | Open in IMG/M |
3300018028|Ga0184608_10495083 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 523 | Open in IMG/M |
3300018073|Ga0184624_10175012 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 951 | Open in IMG/M |
3300018431|Ga0066655_11324177 | All Organisms → cellular organisms → Bacteria | 518 | Open in IMG/M |
3300018476|Ga0190274_13847911 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 508 | Open in IMG/M |
3300019362|Ga0173479_10460864 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 630 | Open in IMG/M |
3300021078|Ga0210381_10211730 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 679 | Open in IMG/M |
3300021372|Ga0213877_10062551 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1088 | Open in IMG/M |
3300024249|Ga0247676_1057971 | Not Available | 634 | Open in IMG/M |
3300024290|Ga0247667_1047818 | Not Available | 798 | Open in IMG/M |
3300024290|Ga0247667_1072970 | Not Available | 632 | Open in IMG/M |
3300025910|Ga0207684_11020985 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 691 | Open in IMG/M |
3300025914|Ga0207671_10702011 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 804 | Open in IMG/M |
3300025915|Ga0207693_10263898 | Not Available | 1350 | Open in IMG/M |
3300025917|Ga0207660_10856310 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 742 | Open in IMG/M |
3300025927|Ga0207687_11321845 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 620 | Open in IMG/M |
3300025934|Ga0207686_10182668 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1488 | Open in IMG/M |
3300025938|Ga0207704_10232709 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1371 | Open in IMG/M |
3300028707|Ga0307291_1031283 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1245 | Open in IMG/M |
3300028707|Ga0307291_1157083 | All Organisms → cellular organisms → Bacteria | 580 | Open in IMG/M |
3300028712|Ga0307285_10204762 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 553 | Open in IMG/M |
3300028718|Ga0307307_10112699 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Acidimicrobiia → Acidimicrobiales → Acidimicrobiaceae → unclassified Acidimicrobiaceae → Acidimicrobiaceae bacterium | 835 | Open in IMG/M |
3300028720|Ga0307317_10279178 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 564 | Open in IMG/M |
3300028755|Ga0307316_10034726 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1658 | Open in IMG/M |
3300028755|Ga0307316_10132725 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 881 | Open in IMG/M |
3300028782|Ga0307306_10180069 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 598 | Open in IMG/M |
3300028802|Ga0307503_10002263 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 4576 | Open in IMG/M |
3300028811|Ga0307292_10139085 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 975 | Open in IMG/M |
3300028814|Ga0307302_10098283 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1396 | Open in IMG/M |
3300028814|Ga0307302_10534461 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 582 | Open in IMG/M |
3300030993|Ga0308190_1054460 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 781 | Open in IMG/M |
3300031572|Ga0318515_10542542 | All Organisms → cellular organisms → Bacteria | 620 | Open in IMG/M |
3300031720|Ga0307469_12164116 | Not Available | 541 | Open in IMG/M |
3300031740|Ga0307468_101271272 | All Organisms → cellular organisms → Bacteria | 668 | Open in IMG/M |
3300031771|Ga0318546_10339287 | All Organisms → cellular organisms → Bacteria | 1044 | Open in IMG/M |
3300031799|Ga0318565_10499754 | All Organisms → cellular organisms → Bacteria | 587 | Open in IMG/M |
3300032009|Ga0318563_10741213 | Not Available | 527 | Open in IMG/M |
3300032261|Ga0306920_101710578 | All Organisms → cellular organisms → Bacteria | 891 | Open in IMG/M |
3300032770|Ga0335085_10211515 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 2365 | Open in IMG/M |
3300032770|Ga0335085_10998727 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 904 | Open in IMG/M |
3300032954|Ga0335083_10081075 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3271 | Open in IMG/M |
3300032954|Ga0335083_10134957 | All Organisms → cellular organisms → Bacteria | 2358 | Open in IMG/M |
3300033134|Ga0335073_11558436 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 633 | Open in IMG/M |
3300033158|Ga0335077_10335836 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1642 | Open in IMG/M |
3300033550|Ga0247829_10533855 | All Organisms → cellular organisms → Bacteria | 973 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 28.85% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 6.73% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 5.77% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 5.77% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 5.77% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 2.88% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 2.88% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 2.88% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 2.88% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.92% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.92% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.92% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.92% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.92% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 1.92% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.92% |
Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.96% |
Soil | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil | 0.96% |
Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 0.96% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.96% |
Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Bulk Soil | 0.96% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.96% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.96% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.96% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 0.96% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.96% |
Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 0.96% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.96% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.96% |
Soil | Environmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil | 0.96% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.96% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.96% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.96% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.96% |
Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.96% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.96% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.96% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.96% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.96% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2162886013 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk Soil | Environmental | Open in IMG/M |
2170459005 | Grass soil microbial communities from Rothamsted Park, UK - July 2009 direct MP BIO1O1 lysis 0-21cm | Environmental | Open in IMG/M |
3300001139 | Soil microbial communities from Great Prairies - Wisconsin, Switchgrass soil | Environmental | Open in IMG/M |
3300003996 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailB_D2 | Environmental | Open in IMG/M |
3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
3300004156 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1 | Environmental | Open in IMG/M |
3300005294 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk Soil | Environmental | Open in IMG/M |
3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Environmental | Open in IMG/M |
3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Host-Associated | Open in IMG/M |
3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
3300005526 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 | Environmental | Open in IMG/M |
3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Environmental | Open in IMG/M |
3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Host-Associated | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
3300010093 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_2_16_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300010154 | Soil microbial communities from Willow Creek, Wisconsin, USA - WC-WI-TBF metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
3300011000 | Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t6i015 | Environmental | Open in IMG/M |
3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
3300012350 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG | Environmental | Open in IMG/M |
3300012473 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.12.yng.090610 | Host-Associated | Open in IMG/M |
3300012513 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 | Host-Associated | Open in IMG/M |
3300012885 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S104-311B-1 | Environmental | Open in IMG/M |
3300012901 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S119-311C-1 | Environmental | Open in IMG/M |
3300012909 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S149-409B-1 | Environmental | Open in IMG/M |
3300012914 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S028-104C-2 | Environmental | Open in IMG/M |
3300012915 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S103-311B-2 | Environmental | Open in IMG/M |
3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
3300012987 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MG | Environmental | Open in IMG/M |
3300012988 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MG | Environmental | Open in IMG/M |
3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
3300015077 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S178-409R-2 (version 2) | Environmental | Open in IMG/M |
3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Host-Associated | Open in IMG/M |
3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
3300017947 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_4_20_MG | Environmental | Open in IMG/M |
3300017959 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG | Environmental | Open in IMG/M |
3300017966 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MG | Environmental | Open in IMG/M |
3300018028 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coex | Environmental | Open in IMG/M |
3300018073 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_b1 | Environmental | Open in IMG/M |
3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
3300018476 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T | Environmental | Open in IMG/M |
3300019362 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S104-311B-1 (version 2) | Environmental | Open in IMG/M |
3300021078 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_coex redo | Environmental | Open in IMG/M |
3300021372 | Vellozia epidendroides bulk soil microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - BS_R01 | Environmental | Open in IMG/M |
3300024249 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK17 | Environmental | Open in IMG/M |
3300024290 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK08 | Environmental | Open in IMG/M |
3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) | Environmental | Open in IMG/M |
3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300028707 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_148 | Environmental | Open in IMG/M |
3300028712 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_139 | Environmental | Open in IMG/M |
3300028718 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_194 | Environmental | Open in IMG/M |
3300028720 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_357 | Environmental | Open in IMG/M |
3300028755 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_356 | Environmental | Open in IMG/M |
3300028782 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_193 | Environmental | Open in IMG/M |
3300028802 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 17_S | Environmental | Open in IMG/M |
3300028811 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_149 | Environmental | Open in IMG/M |
3300028814 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_183 | Environmental | Open in IMG/M |
3300030993 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_185 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031572 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19 | Environmental | Open in IMG/M |
3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
3300031799 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f21 | Environmental | Open in IMG/M |
3300032009 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f19 | Environmental | Open in IMG/M |
3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
3300032954 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2 | Environmental | Open in IMG/M |
3300033134 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2 | Environmental | Open in IMG/M |
3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
3300033550 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day4 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
SwBSRL2_0304.00007560 | 2162886013 | Switchgrass Rhizosphere | AGYYGRSAILLVAWVAAFAIIRGVRDLIAAFRVRELQHPKPAS |
E41_00686340 | 2170459005 | Grass Soil | SGPPAYYGRSAVLLIAWVAAFTLIRGVRDIVLAFRVRELQHA |
JGI10220J13317_106254422 | 3300001139 | Soil | GRSAVVLVAWVSAIALIRGVRDIVLAFRVREVQHGAPA* |
Ga0055467_101577301 | 3300003996 | Natural And Restored Wetlands | MAIRRTYGRSAVLPVARVTAFAIIRGLRDLVAAFRLRELQHPKPAG* |
Ga0062593_1009399421 | 3300004114 | Soil | YYGRSATLLVAWVAAFAIIRGVRDIVLAFRVHGVQHATPA* |
Ga0062593_1032138713 | 3300004114 | Soil | YYGRSAVLLIAWVAAFTLIRGVRDIVLAFRVRELQHGDTA* |
Ga0062589_1000094941 | 3300004156 | Soil | AAGYYGRSAILLVAWVAAFALIRGVRDLIAAFRVRELQHPKPAN* |
Ga0065705_105884291 | 3300005294 | Switchgrass Rhizosphere | FWAAGYYGRSATLLVAWVAAFAIIRGVRDIILAFRVREIQHAPGV* |
Ga0070683_1010333791 | 3300005329 | Corn Rhizosphere | WAAGYYGRSAVLLIAWVAAYTLIHGVTDIIRAFQVREIQHAGDRTLQPS* |
Ga0070667_1005475712 | 3300005367 | Switchgrass Rhizosphere | YYGRSAVLLVAWVAAYTIIRGVTDIVLAFRIHQIQHAPAA* |
Ga0070698_1018351951 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | AGYYGRSAVLLVAWVAAFAIIRGVTNIVMAFRVRELQHAAPV* |
Ga0073909_104077222 | 3300005526 | Surface Soil | WAAGYYGRSAVLLVAWVAAFAIVRGVRDLVLAFRVRELQHAT* |
Ga0070695_1018077802 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | AGYYGRSAILLVAWVAAFAIIRGVTNIVLAFRIRGLQHAEA* |
Ga0068857_1000492551 | 3300005577 | Corn Rhizosphere | WAAGYYGRSAILLVAWVAAFALIRGVRDLIAAFRVRELQHPKPAN* |
Ga0066903_1087763432 | 3300005764 | Tropical Forest Soil | GRAAVLLVAWVTAIAIRRGIRDFVLAFGMREVEHTAMSQA* |
Ga0068860_1004247491 | 3300005843 | Switchgrass Rhizosphere | YYGRSSVLLVAWVAAFAIIRGVRDIVLAFRVREIQHAPGV* |
Ga0070716_1002072971 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | FWAAGYYGRSAVLLIAWVAAFTLIRGVRDLVLAFRVRDLQHAR* |
Ga0070716_1015988061 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | YGRSAILLVAWVAAFAIIRGVTNIVLAFRVLEVERATTP* |
Ga0097621_1014715832 | 3300006237 | Miscanthus Rhizosphere | GYYGRSATLLIAWVAAFAIIRGVRDIVLAFRVRELQHAAAA* |
Ga0079220_110718811 | 3300006806 | Agricultural Soil | AGYYGRSATLLIAWVAAFAIIRGVRDIILAFRIRDVQHAAGV* |
Ga0075428_1016608461 | 3300006844 | Populus Rhizosphere | WAAGYYGRSAVLLVAWVAAIAIIRGFMNILFAFRVREVQHGAPSEVST* |
Ga0075434_1003245481 | 3300006871 | Populus Rhizosphere | VLLVAWVAAFAVVRGVRDIVIAFRLHELQHPAPA* |
Ga0075434_1005433933 | 3300006871 | Populus Rhizosphere | AAGYYGRSAVLLIAWVAAFAIIRGVRDIVLAFRVREVQHAAAR* |
Ga0075424_1006884016 | 3300006904 | Populus Rhizosphere | AVLLIAWVAAFTLIRGVRDIVLAFRVRELQHGDAV* |
Ga0075418_130147001 | 3300009100 | Populus Rhizosphere | ILLVAWVAAFAIIRGVRDLVAAFRVRELQHPKPAS* |
Ga0114129_125737051 | 3300009147 | Populus Rhizosphere | RSAVLLVAWVAAIAIIRGIRDIVLAFRIREAQHTAPA* |
Ga0127490_10137922 | 3300010093 | Grasslands Soil | AILLVAWVAAFALIRGVTNIVMAFRVREVQHAGPG* |
Ga0127503_104815103 | 3300010154 | Soil | YYGRSSVLLIAWVAAFALIRGVRDFVFAFRVRELQHA* |
Ga0126376_129988762 | 3300010359 | Tropical Forest Soil | WAAGYYGRSAVLLIAWLAAFAVIRGVRDIVPAFRVREVQHAAPA* |
Ga0126381_1006038511 | 3300010376 | Tropical Forest Soil | GRSAVLLVAWVAAIAILRGVRDIVLAFRVREVQHARTA* |
Ga0126381_1037300202 | 3300010376 | Tropical Forest Soil | YYGRSAVLLIAWVAAFTIIRGVRDIVLAFRVREVQHSAT* |
Ga0134123_135753801 | 3300010403 | Terrestrial Soil | LLVAWVAAFAIIRGVRDLIAAFRVRELQHPKPAS* |
Ga0138513_1000819932 | 3300011000 | Soil | HSAILLVAWVAAFAVIRGVRDIVLAFRVHDLQHAST* |
Ga0137376_101640771 | 3300012208 | Vadose Zone Soil | RSAILLVAWVAAFAIIRGVMDIVLAFRVHALQHASASA* |
Ga0137376_113769832 | 3300012208 | Vadose Zone Soil | GYYGRSAVLLVAWVSAFAIIRGVTNIVMAFRVRELQHAAPG* |
Ga0137372_103950272 | 3300012350 | Vadose Zone Soil | AAGYYGRSAVLLVAWVAAFAVIRGVTNIVLAFRVRELQHAAPV* |
Ga0157340_10133672 | 3300012473 | Arabidopsis Rhizosphere | WAAGYYGRSAVLLIAWVAAFTLIRGVRDIVLAFRVREVQHGTA* |
Ga0157326_10261562 | 3300012513 | Arabidopsis Rhizosphere | AGYYGRSAVLLIAWVAAFTLIRGVRDIVLAFRVREVQHGTA* |
Ga0157287_10656892 | 3300012885 | Soil | GYYGRSSVLLVAWVAAFAIIRGVRDIILAFRVREVQHAPGV* |
Ga0157288_100520362 | 3300012901 | Soil | WAAGYYGRSAILLVAWVAAFALIRGVRDLIAAFRVRELQHPKPAS* |
Ga0157290_104014351 | 3300012909 | Soil | GRSAILLVAWVAAFAIIRGVRDLIAAFRVRELQHPKPAS* |
Ga0157297_101119652 | 3300012914 | Soil | AAGYYGRSATLLVAWVAAFAIIRGVRDIVLAFRVREIQHPSGP* |
Ga0157302_105181951 | 3300012915 | Soil | YGRSAVLLVAWVAAIAIIRGVTNIVTAFRVRELQHAGSP* |
Ga0164303_103514152 | 3300012957 | Soil | VLLVAWVAAYTIIRGVTEIVLAFRVHQIQHAPAA* |
Ga0164301_100173213 | 3300012960 | Soil | YYGRSAVLLIAWVAAFTLIRGVRDLVLAFRVRELQHAR* |
Ga0164302_107569381 | 3300012961 | Soil | WAAGYYGRSAVLLVAWIAAFAVIRGVRDIVLAFRVHDLQRAKPATA* |
Ga0164304_105846741 | 3300012986 | Soil | YGRSATLLIAWVAAFAIIRGVRDVVLAFRVRELQHPAMA* |
Ga0164307_110502373 | 3300012987 | Soil | GRSAVLLIAWVAAFAIIRGVRDFVLAFRVREVQHA* |
Ga0164306_100522433 | 3300012988 | Soil | GYYGRSAVLLIAWVAAFTLIRGVRDLVLAFRVRELQHAR* |
Ga0164306_108040522 | 3300012988 | Soil | VLLVAWIAAFAVIRGVRDIVLAFRVHDLQRAKPATA* |
Ga0164306_111824002 | 3300012988 | Soil | WAAGYYGRSAVLLIAWVAAFTLIRGVRDLVLAFRVRELQHAR* |
Ga0164305_106459422 | 3300012989 | Soil | RSAVLLVAWVAAFAIIRGVRDIVLAFRVRELEHA* |
Ga0157374_124701911 | 3300013296 | Miscanthus Rhizosphere | AGYYGRSAVVLVAWVSAIALIRGVRDIVLAFRVREVQHGAPA* |
Ga0173483_102091262 | 3300015077 | Soil | SAILLVAWVAAFAIIRGVRDLIAAFRVRELQHPKAAS* |
Ga0182007_101183292 | 3300015262 | Rhizosphere | AGYFGRSAVLLVAWAAAFVIIRGIRDIVMAFRVRAIEHATDV* |
Ga0132258_110583624 | 3300015371 | Arabidopsis Rhizosphere | LALGLWAAGYYGRSAVLLVAWVAAFTIIRGVRDIVLSFRVREVQHAAAT* |
Ga0182034_109815092 | 3300016371 | Soil | YYGRSAVLLVAWVAAIAILRGIRDIVLAFRVREAQHARTA |
Ga0187785_106081632 | 3300017947 | Tropical Peatland | YYGRSAVLLVAWVAAIAIMRGIRDIVLAFRVREIQHAAPAPS |
Ga0187779_100670986 | 3300017959 | Tropical Peatland | GYYGRSSILLIAWVAAFALIRGVRDIVLAFRVRELQH |
Ga0187776_105866812 | 3300017966 | Tropical Peatland | YYGRSAVLLVAWVAAFAIIRGVRDIVLAFRVREVQHAAAR |
Ga0184608_104950831 | 3300018028 | Groundwater Sediment | AVLLIAWIAAFAIIRGVRDIVFAFRVHALQHAAPPESSL |
Ga0184624_101750121 | 3300018073 | Groundwater Sediment | AAGYYGRSAILLVAWVSAIALIRGVNDIVLAFRVREVQHASAT |
Ga0066655_113241771 | 3300018431 | Grasslands Soil | KNSRAPGYYGRSALLLVARVAAFAVIRGVTNIVLAFRVRALQHAPS |
Ga0190274_138479111 | 3300018476 | Soil | DYYGRSAVLLVAWVAAFAIIRGVRDIVAAFRVRELQHPKPAS |
Ga0173479_104608641 | 3300019362 | Soil | GYYGRSATLLVAWVAAFAIIRGVRDIILAFRVRDVQHAPGV |
Ga0210381_102117302 | 3300021078 | Groundwater Sediment | YYGRSAVLLIAWIAAFAIIRGVRDIVFAFRVHALQHAAPPESSL |
Ga0213877_100625511 | 3300021372 | Bulk Soil | WAAGYYGRSAVLLVAWVAAYAIIRSSRDIIIGFRVRELQHAAK |
Ga0247676_10579712 | 3300024249 | Soil | GDYGRSAVVLIAWVAAFALIRGVRDIVYAFRIRELQHA |
Ga0247667_10478183 | 3300024290 | Soil | AGDYGRSAVVLIAWVAAFALIRGVRDIVYAFRIRELQHG |
Ga0247667_10729701 | 3300024290 | Soil | DYGRSAVVLIAWVAAFALIRGVRDIVYAFRIRELQHA |
Ga0207684_110209852 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | AGYYCRSAVLLVAWVAAFAVIRGVRDIVIAFRIRELQHGSHN |
Ga0207671_107020112 | 3300025914 | Corn Rhizosphere | YGRSAVLLVAWVAAYTIIRGVTDIVLAFRIHQIQHAPAA |
Ga0207693_102638982 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | YGRSAVLLIAWVAAFTLIRGVRDLVLAFRVRELQHAR |
Ga0207660_108563101 | 3300025917 | Corn Rhizosphere | SVLLVAWVAAFAIIRGVRDIVLAFRVREIQHAPGV |
Ga0207687_113218452 | 3300025927 | Miscanthus Rhizosphere | YYGRSSVLLVAWVAAFAIIRGVRDIVLAFRVREIQHAPGV |
Ga0207686_101826684 | 3300025934 | Miscanthus Rhizosphere | AILLVAWVAAFAIIRGVRDLIAAFRVRELQHPKPAS |
Ga0207704_102327091 | 3300025938 | Miscanthus Rhizosphere | AAGYYGRSAVLLVAWVAAFAIIRGVRDIVTAFRVREVQHPDVPSQPVRA |
Ga0307291_10312831 | 3300028707 | Soil | YGRSAVLLVAWVAAFAVIRGVRDIVIAFRVREVQHV |
Ga0307291_11570831 | 3300028707 | Soil | YGRSATLLIAWVAAFAIIRGVRDIVFAFRVREIQHAPGV |
Ga0307285_102047621 | 3300028712 | Soil | YYGRSAVLLVAWVAAFAIIRGVRDIVFAFRVRDVQHGVPADALT |
Ga0307307_101126992 | 3300028718 | Soil | AGYYGRSAVLLVAWVAAFAVIRGVRDIVIAFRVREVQHV |
Ga0307317_102791782 | 3300028720 | Soil | AVLLIAWVAVIALVRGVRDIVLAFRVRELQQGTLSV |
Ga0307316_100347261 | 3300028755 | Soil | YYGRSAVLLIAWVAAFAVIRGVRDIVLAFRVRELQHPAHA |
Ga0307316_101327251 | 3300028755 | Soil | GRSAVLLVAWVAAFAIVRGVTNIVMAFRVREVQHAGP |
Ga0307306_101800691 | 3300028782 | Soil | WAAGYYGRSAILLVAWVAAFTIIRGVTNIVLAFRVREAQHAANT |
Ga0307503_100022631 | 3300028802 | Soil | GDYGRSAVVLIAWVAAFALIRGVRDIVYAFRIRGLQHA |
Ga0307292_101390852 | 3300028811 | Soil | YYGRSAVLLVAWVAAYTVIRGVTEIVLASRIHQIQHTAAA |
Ga0307302_100982832 | 3300028814 | Soil | GYYGRSAVLLVAWVAAYTIIRGITEIVLAFRVHQIQHAPAA |
Ga0307302_105344611 | 3300028814 | Soil | AGYYGRSATLLIAWVAAFAIIRGVRDIVLAFRVRELQHADGA |
Ga0308190_10544602 | 3300030993 | Soil | RSAILLVAWVAAFAIVRGVTNIVMAFRVREVQHAGP |
Ga0318515_105425421 | 3300031572 | Soil | VLLVAWVAAIAIMRGIRDIVLAFRVRDVQHSPPAPA |
Ga0307469_121641161 | 3300031720 | Hardwood Forest Soil | RSAVLLIAWVAAFALIRGVRDIVLAFRVREVQHAR |
Ga0307468_1012712721 | 3300031740 | Hardwood Forest Soil | AGYYGRSAVLLIAWVAAFTFIRGVRDIVLAFRVRELQHA |
Ga0318546_103392871 | 3300031771 | Soil | AVLLVAWVAAIAIMRGIRDIVLAFRVRDVQHSPPAPA |
Ga0318565_104997541 | 3300031799 | Soil | AAGYYGRSAVLLVAWVAAIAILRGIRDIVLAFRVREAQHARTA |
Ga0318563_107412132 | 3300032009 | Soil | YGRSAVLLVAWVAAFAIIRGIRDFVLAFRVREVQHAGG |
Ga0306920_1017105782 | 3300032261 | Soil | SAVLLVAWVAAIAILRGIRDIVLAFRVREAQHARTA |
Ga0335085_102115151 | 3300032770 | Soil | AVLLVAWVAAIAILRGIRDIVLAFRVRGVQHAPVAQS |
Ga0335085_109987271 | 3300032770 | Soil | SAVLLVAWVAAWAIIRGIRDIVLAFRVREVQHAATA |
Ga0335083_100810752 | 3300032954 | Soil | LRSVSGQPAGYYGRSAILLVAWVAAFAIIRGVRDIVLAFHVHALQHAEL |
Ga0335083_101349573 | 3300032954 | Soil | RSAVLLVAWVAAIAILRGIRDIVLAFRVRGVQHAPVAQS |
Ga0335073_115584361 | 3300033134 | Soil | SAVLLVAWVAAFTLIRGIRDIVLAFRIHSLKSATA |
Ga0335077_103358363 | 3300033158 | Soil | AGYYGRSAVLLVAWVAVIAIIRGVRDIVLAFRVREVQHA |
Ga0247829_105338552 | 3300033550 | Soil | GRSAILLVAWVAAFAIIRGVRDLIAAFRVRELQHPTPAS |
⦗Top⦘ |