NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F097882

Metagenome Family F097882

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F097882
Family Type Metagenome
Number of Sequences 104
Average Sequence Length 44 residues
Representative Sequence PDHMPNGQRLLHVVADRIQWQTALDLARRRAAEADLPATGRAA
Number of Associated Samples 85
Number of Associated Scaffolds 104

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 6.73 %
% of genes near scaffold ends (potentially truncated) 92.31 %
% of genes from short scaffolds (< 2000 bps) 94.23 %
Associated GOLD sequencing projects 80
AlphaFold2 3D model prediction Yes
3D model pTM-score0.52

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (97.115 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil
(20.192 % of family members)
Environment Ontology (ENVO) Unclassified
(27.885 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(43.269 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 49.30%    β-sheet: 0.00%    Coil/Unstructured: 50.70%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.52
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 104 Family Scaffolds
PF12728HTH_17 54.81
PF14657Arm-DNA-bind_4 20.19
PF14659Phage_int_SAM_3 15.38
PF05016ParE_toxin 1.92
PF02589LUD_dom 0.96
PF00589Phage_integrase 0.96


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms99.04 %
UnclassifiedrootN/A0.96 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300004152|Ga0062386_100909455All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia727Open in IMG/M
3300004635|Ga0062388_101266880All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales733Open in IMG/M
3300005435|Ga0070714_100240873All Organisms → cellular organisms → Bacteria1669Open in IMG/M
3300005436|Ga0070713_101643152All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales624Open in IMG/M
3300005439|Ga0070711_101176627All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces662Open in IMG/M
3300005471|Ga0070698_100638572All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales1006Open in IMG/M
3300005548|Ga0070665_101274963All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia745Open in IMG/M
3300005577|Ga0068857_100551340All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales1086Open in IMG/M
3300006028|Ga0070717_11306023All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales659Open in IMG/M
3300006028|Ga0070717_11491588All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia613Open in IMG/M
3300006046|Ga0066652_102065244All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales506Open in IMG/M
3300006102|Ga0075015_100885433All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia541Open in IMG/M
3300006162|Ga0075030_101413004All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia545Open in IMG/M
3300006173|Ga0070716_101270124All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia594Open in IMG/M
3300006175|Ga0070712_100336329All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1232Open in IMG/M
3300006755|Ga0079222_10476820All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia903Open in IMG/M
3300007265|Ga0099794_10344198All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia775Open in IMG/M
3300009029|Ga0066793_10487084All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Thermomonospora → Thermomonospora echinospora705Open in IMG/M
3300009088|Ga0099830_10073539All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia2486Open in IMG/M
3300009098|Ga0105245_10361057All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Nonomuraea → Nonomuraea pusilla1442Open in IMG/M
3300009177|Ga0105248_10263094All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1942Open in IMG/M
3300009520|Ga0116214_1348493All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae573Open in IMG/M
3300009521|Ga0116222_1224999All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales809Open in IMG/M
3300009522|Ga0116218_1470036All Organisms → cellular organisms → Bacteria561Open in IMG/M
3300009683|Ga0116224_10346051All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia707Open in IMG/M
3300009839|Ga0116223_10110430All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Dactylosporangium → unclassified Dactylosporangium → Dactylosporangium sp.1733Open in IMG/M
3300010359|Ga0126376_12619184All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae553Open in IMG/M
3300010373|Ga0134128_10829578All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Catenulisporales → Catenulisporaceae → Catenulispora → Catenulispora pinistramenti1024Open in IMG/M
3300010373|Ga0134128_11541673All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Catenulisporales → Catenulisporaceae → Catenulispora → Catenulispora pinistramenti731Open in IMG/M
3300010379|Ga0136449_101636045All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae975Open in IMG/M
3300010379|Ga0136449_102937928All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia668Open in IMG/M
3300011269|Ga0137392_10009175All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia6467Open in IMG/M
3300012096|Ga0137389_10076722All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia2600Open in IMG/M
3300012189|Ga0137388_11237213All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia685Open in IMG/M
3300012198|Ga0137364_10115785All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1905Open in IMG/M
3300012200|Ga0137382_10500618All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria863Open in IMG/M
3300012201|Ga0137365_10109139All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia2081Open in IMG/M
3300012207|Ga0137381_10257314All Organisms → Viruses → Predicted Viral1518Open in IMG/M
3300012207|Ga0137381_11468040All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia574Open in IMG/M
3300012208|Ga0137376_11348322All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales604Open in IMG/M
3300012209|Ga0137379_10832129All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales828Open in IMG/M
3300012209|Ga0137379_11139700All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales686Open in IMG/M
3300012350|Ga0137372_10247013All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1405Open in IMG/M
3300012350|Ga0137372_10295947All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales1256Open in IMG/M
3300012350|Ga0137372_10815748All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria668Open in IMG/M
3300012351|Ga0137386_10418767All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales965Open in IMG/M
3300012351|Ga0137386_10908936All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria630Open in IMG/M
3300012351|Ga0137386_11021503All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia587Open in IMG/M
3300012499|Ga0157350_1051329All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia524Open in IMG/M
3300012683|Ga0137398_10893126All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia619Open in IMG/M
3300012917|Ga0137395_10562376Not Available823Open in IMG/M
3300014156|Ga0181518_10507059All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria571Open in IMG/M
3300014501|Ga0182024_12219248All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria600Open in IMG/M
3300016371|Ga0182034_10704462All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae859Open in IMG/M
3300016422|Ga0182039_12038867All Organisms → cellular organisms → Bacteria528Open in IMG/M
3300016422|Ga0182039_12087101All Organisms → cellular organisms → Bacteria522Open in IMG/M
3300017821|Ga0187812_1210832All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria620Open in IMG/M
3300017924|Ga0187820_1257326All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales562Open in IMG/M
3300017928|Ga0187806_1113302All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria874Open in IMG/M
3300017932|Ga0187814_10078968All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales1209Open in IMG/M
3300017932|Ga0187814_10422898All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia520Open in IMG/M
3300017942|Ga0187808_10314706All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Catenulisporales → Catenulisporaceae → Catenulispora → Catenulispora pinistramenti707Open in IMG/M
3300017942|Ga0187808_10561308All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia531Open in IMG/M
3300017955|Ga0187817_10245323All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae1141Open in IMG/M
3300017959|Ga0187779_10326531All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae987Open in IMG/M
3300017959|Ga0187779_11338436All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia508Open in IMG/M
3300018085|Ga0187772_10385377All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales973Open in IMG/M
3300018086|Ga0187769_10737421All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria745Open in IMG/M
3300018090|Ga0187770_11617748All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia528Open in IMG/M
3300018468|Ga0066662_11069628All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia804Open in IMG/M
3300020580|Ga0210403_11215989All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Nonomuraea → Nonomuraea solani580Open in IMG/M
3300021088|Ga0210404_10314469All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria864Open in IMG/M
3300021401|Ga0210393_10621789All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria882Open in IMG/M
3300021407|Ga0210383_11336203All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria598Open in IMG/M
3300025928|Ga0207700_11954920All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Frankiales → Frankiaceae → Frankia513Open in IMG/M
3300026142|Ga0207698_11291936All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Catenulisporales → Catenulisporaceae → Catenulispora → Catenulispora pinistramenti744Open in IMG/M
3300026294|Ga0209839_10101884All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia980Open in IMG/M
3300027432|Ga0209421_1080505All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia660Open in IMG/M
3300027570|Ga0208043_1178746All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Dactylosporangium → unclassified Dactylosporangium → Dactylosporangium sp.543Open in IMG/M
3300027570|Ga0208043_1197895All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia509Open in IMG/M
3300027662|Ga0208565_1157684All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium659Open in IMG/M
3300027884|Ga0209275_10935249All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces500Open in IMG/M
3300027895|Ga0209624_10329613All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae1017Open in IMG/M
3300027895|Ga0209624_10616318All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia719Open in IMG/M
3300027905|Ga0209415_10310148All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae1351Open in IMG/M
3300027905|Ga0209415_10581683All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae836Open in IMG/M
3300027905|Ga0209415_10831344All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycobacterium638Open in IMG/M
3300027905|Ga0209415_10951437All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia578Open in IMG/M
3300030013|Ga0302178_10269331All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria793Open in IMG/M
3300030707|Ga0310038_10225523All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria880Open in IMG/M
3300031546|Ga0318538_10278983All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Catenulisporales → Catenulisporaceae → Catenulispora → Catenulispora pinistramenti899Open in IMG/M
3300031708|Ga0310686_116953777All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria818Open in IMG/M
3300031781|Ga0318547_10744366All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria610Open in IMG/M
3300031805|Ga0318497_10305364All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria887Open in IMG/M
3300031819|Ga0318568_10291920All Organisms → Viruses → Predicted Viral1012Open in IMG/M
3300032010|Ga0318569_10087432All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae1396Open in IMG/M
3300032055|Ga0318575_10582835All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria567Open in IMG/M
3300032076|Ga0306924_12641106All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria500Open in IMG/M
3300032160|Ga0311301_11243979All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Mycobacteriaceae → Mycolicibacterium948Open in IMG/M
3300032174|Ga0307470_10028119All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2639Open in IMG/M
3300032954|Ga0335083_10351121All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1277Open in IMG/M
3300033134|Ga0335073_11088232All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales816Open in IMG/M
3300033134|Ga0335073_11831535All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae565Open in IMG/M
3300034124|Ga0370483_0002492All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia4993Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil20.19%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil15.38%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil9.62%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment7.69%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere7.69%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland4.81%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil3.85%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil2.88%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil2.88%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil1.92%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds1.92%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil1.92%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere1.92%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog0.96%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.96%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil0.96%
Unplanted SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Unplanted Soil0.96%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil0.96%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil0.96%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil0.96%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil0.96%
Untreated Peat SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil0.96%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Soil0.96%
Prmafrost SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil0.96%
PermafrostEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost0.96%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil0.96%
Agricultural SoilEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil0.96%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa0.96%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.96%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.96%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere0.96%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300004152Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3EnvironmentalOpen in IMG/M
3300004635Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3EnvironmentalOpen in IMG/M
3300005435Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaGEnvironmentalOpen in IMG/M
3300005436Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaGEnvironmentalOpen in IMG/M
3300005439Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaGEnvironmentalOpen in IMG/M
3300005471Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaGEnvironmentalOpen in IMG/M
3300005548Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaGHost-AssociatedOpen in IMG/M
3300005577Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2Host-AssociatedOpen in IMG/M
3300006028Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaGEnvironmentalOpen in IMG/M
3300006046Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101EnvironmentalOpen in IMG/M
3300006102Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013EnvironmentalOpen in IMG/M
3300006162Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012EnvironmentalOpen in IMG/M
3300006173Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaGEnvironmentalOpen in IMG/M
3300006175Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaGEnvironmentalOpen in IMG/M
3300006755Agricultural soil microbial communities from Georgia to study Nitrogen management - GA PlitterEnvironmentalOpen in IMG/M
3300007265Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1EnvironmentalOpen in IMG/M
3300009029Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 1 DNA2013-189EnvironmentalOpen in IMG/M
3300009088Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaGEnvironmentalOpen in IMG/M
3300009098Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaGHost-AssociatedOpen in IMG/M
3300009177Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaGHost-AssociatedOpen in IMG/M
3300009520Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaGEnvironmentalOpen in IMG/M
3300009521Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaGEnvironmentalOpen in IMG/M
3300009522Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaGEnvironmentalOpen in IMG/M
3300009683Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_b_LC metaGEnvironmentalOpen in IMG/M
3300009839Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaGEnvironmentalOpen in IMG/M
3300010359Tropical forest soil microbial communities from Panama - MetaG Plot_15EnvironmentalOpen in IMG/M
3300010373Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4EnvironmentalOpen in IMG/M
3300010379Sb_50d combined assemblyEnvironmentalOpen in IMG/M
3300011269Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaGEnvironmentalOpen in IMG/M
3300012096Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaGEnvironmentalOpen in IMG/M
3300012189Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaGEnvironmentalOpen in IMG/M
3300012198Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012200Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaGEnvironmentalOpen in IMG/M
3300012201Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaGEnvironmentalOpen in IMG/M
3300012207Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaGEnvironmentalOpen in IMG/M
3300012208Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012209Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaGEnvironmentalOpen in IMG/M
3300012350Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaGEnvironmentalOpen in IMG/M
3300012351Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaGEnvironmentalOpen in IMG/M
3300012499Unplanted soil (control) microbial communities from North Carolina - M.Soil.2.yng.030610EnvironmentalOpen in IMG/M
3300012683Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaGEnvironmentalOpen in IMG/M
3300012917Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaGEnvironmentalOpen in IMG/M
3300014156Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_60_metaGEnvironmentalOpen in IMG/M
3300014501Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300016371Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172EnvironmentalOpen in IMG/M
3300016422Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111EnvironmentalOpen in IMG/M
3300017821Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_2EnvironmentalOpen in IMG/M
3300017924Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_5EnvironmentalOpen in IMG/M
3300017928Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_1EnvironmentalOpen in IMG/M
3300017932Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_4EnvironmentalOpen in IMG/M
3300017942Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_3EnvironmentalOpen in IMG/M
3300017955Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2EnvironmentalOpen in IMG/M
3300017959Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MGEnvironmentalOpen in IMG/M
3300018085Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300018086Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MGEnvironmentalOpen in IMG/M
3300018090Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300018468Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111EnvironmentalOpen in IMG/M
3300020580Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-MEnvironmentalOpen in IMG/M
3300021088Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-MEnvironmentalOpen in IMG/M
3300021401Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-OEnvironmentalOpen in IMG/M
3300021407Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-OEnvironmentalOpen in IMG/M
3300025928Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026142Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026294Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-050 (SPAdes)EnvironmentalOpen in IMG/M
3300027432Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_O2 (SPAdes)EnvironmentalOpen in IMG/M
3300027570Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027662Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_2_FS metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027884Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes)EnvironmentalOpen in IMG/M
3300027895Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 (SPAdes)EnvironmentalOpen in IMG/M
3300027905Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes)EnvironmentalOpen in IMG/M
3300030013Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_3EnvironmentalOpen in IMG/M
3300030707Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG (v2)EnvironmentalOpen in IMG/M
3300031546Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23EnvironmentalOpen in IMG/M
3300031708FICUS49499 Metagenome Czech Republic combined assemblyEnvironmentalOpen in IMG/M
3300031781Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20EnvironmentalOpen in IMG/M
3300031805Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23EnvironmentalOpen in IMG/M
3300031819Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21EnvironmentalOpen in IMG/M
3300032010Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f22EnvironmentalOpen in IMG/M
3300032055Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f23EnvironmentalOpen in IMG/M
3300032076Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2)EnvironmentalOpen in IMG/M
3300032160Sb_50d combined assembly (MetaSPAdes)EnvironmentalOpen in IMG/M
3300032174Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05EnvironmentalOpen in IMG/M
3300032954Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2EnvironmentalOpen in IMG/M
3300033134Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2EnvironmentalOpen in IMG/M
3300034124Peat soil microbial communities from wetlands in Alaska, United States - Goldstream_06D_14EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
Ga0062386_10090945533300004152Bog Forest SoilDHMPNGQRLLHVVADRITWKQALDEARRRADGHSPPDLPATGRAA*
Ga0062388_10126688013300004635Bog Forest SoilWEPVKPGDPDHMPPGQRLLHVVADRIQWQTALKQARRAAEADRPATRRAA*
Ga0070714_10024087313300005435Agricultural SoilGDPDHMPNGQRLLHVVADRIQWQTALELARRKAAMPPDSDHPVAGRAT*
Ga0070713_10164315213300005436Corn, Switchgrass And Miscanthus RhizospherePGDPDHMPNGQRLLHVVADRIQWQTALELARRRAAESDLSATGRAA*
Ga0070711_10117662733300005439Corn, Switchgrass And Miscanthus RhizosphereDHMPNGQRLLHVVADRIQWQTALDLARRRAAEADPSATGRAA*
Ga0070698_10063857213300005471Corn, Switchgrass And Miscanthus RhizospherePGDPDHMPNGQRLLHVVADRIQWQNALDLARRRAAEADLPATGRAA*
Ga0070665_10127496313300005548Switchgrass RhizosphereGDPDHMPNGQRLLHVVADRIQWQTALDLARRRAAEADPSATGRAA*
Ga0068857_10055134033300005577Corn RhizosphereRLLHVVADRIQWQTALELARRRAAETDLPATERAA*
Ga0070717_1130602313300006028Corn, Switchgrass And Miscanthus RhizosphereQRLLHVVADRIQWQTALELARRRAAEADLSATGSAA*
Ga0070717_1149158813300006028Corn, Switchgrass And Miscanthus RhizospherePGDDDHMPNGQRLLHVVADRQRWHTALAEARRRAAMPPDGDHPVTGRAA*
Ga0066652_10206524413300006046SoilLLHVVADRIQWQTALDLARRRAGEADLPATGQAA*
Ga0075015_10088543333300006102WatershedsPDHMPNGQRLLHVVADRIQWQTALEQARRRAATADLPATGRAA*
Ga0075030_10141300413300006162WatershedsVKPGDPDHMPNGQRLLHVVADRIQWQTALELARRRAEGGDDRVSATGRAA*
Ga0070716_10127012413300006173Corn, Switchgrass And Miscanthus RhizosphereARYTWEPVKPGDHDHMPNGQRLLHVVADRIQWQAALAEARQRAAMPPNDDRSAVGRAA*
Ga0070712_10033632913300006175Corn, Switchgrass And Miscanthus RhizosphereMPNGQRLLHVVADRIQWQTALELARRRAAEADLPATGQAA*
Ga0079222_1047682013300006755Agricultural SoilPGDHDHMPNGQRLLHVVADRIQWQTALELARRRAAEAELPANGMAA*
Ga0099794_1034419823300007265Vadose Zone SoilMPNGQRLLHVVADRIQWQTALDLARRRAAEVDLPAIGRAA*
Ga0066793_1048708413300009029Prmafrost SoilTWEPVSPGDFDHMPPARRLLHVVADRITWKQALDEARRKAAGLGPPDLPATGRAA*
Ga0099830_1007353913300009088Vadose Zone SoilLLHVVADRITWEQTLDEARRRAAGPSPPDLPATGRAA*
Ga0105245_1036105733300009098Miscanthus RhizosphereQRLLHVVADRIQWQTALELARRRAAETDLPATERAA*
Ga0105248_1026309413300009177Switchgrass RhizospherePDHMPNGQRLLHVVADRIQWQTALDLARRRAAEADLPATGSAA*
Ga0116214_134849313300009520Peatlands SoilTPVKPGDPDHMPPAQRLLHVVADRQRWHTALTEARRRATEPAILSATGTAA*
Ga0116222_122499913300009521Peatlands SoilPNGQRLLHVVADRIQWQTALEQARRRAAEADLSATGQAA*
Ga0116218_147003613300009522Peatlands SoilDPDHMPNGQRLLHVVADRIQWQTALEQARRRAAEADLPATGRAA*
Ga0116224_1034605123300009683Peatlands SoilGQRLLHVVADRIQWQTALEQARRRAAMPTTPELSATGTAA*
Ga0116223_1011043013300009839Peatlands SoilMPNGQRLLHVVADRIQWQTALEQARRRAAEADLSATGQAA*
Ga0126376_1261918433300010359Tropical Forest SoilLHVVADRITWQQALDEARRRAAGNDPPDLSATESAA*
Ga0134128_1082957833300010373Terrestrial SoilGDPDHMPNGQRLLHVVADRIQWQTALELARRRAAEADLSATGRAA*
Ga0134128_1154167333300010373Terrestrial SoilDPDHMPNGQRLLHVVADRIQWQTALELARRRAAEADLSATGRAA*
Ga0136449_10163604513300010379Peatlands SoilNGQRLLHVVADRIQWQTALEQARRRAADADLPATSRAA*
Ga0136449_10293792813300010379Peatlands SoilPSDEDHMPTAQRLLHVVADRVRWQQALEQARRRAQGLPPGELSATGAAA*
Ga0137392_10009175103300011269Vadose Zone SoilMPNGQRLLHVVADRIQWQTALEQARRRAAEAGLPATGRAA*
Ga0137389_1007672233300012096Vadose Zone SoilMRAVVRPREPVKPGDPDHMPNGQRLLHVVADRIQWQTALEQARRRAAEAGLPATGRAA*
Ga0137388_1123721333300012189Vadose Zone SoilLLHVVADRIQWQTALEQARRRAAMSIAPELSETGTAA*
Ga0137364_1011578543300012198Vadose Zone SoilPNGQRLLHVVADRIQWQTALDLARRRAGEADLPATGQAA*
Ga0137382_1050061813300012200Vadose Zone SoilNGQRLLHVVADRIQWQTALDLARRRAAEADLSATGRAA*
Ga0137365_1010913923300012201Vadose Zone SoilMPNGQRLLHVVADRIQWQTALELARRRAAEADPSATGRAA*
Ga0137381_1025731413300012207Vadose Zone SoilGDPDHMPNGQRLLHVVADRIQWQTALDLARRREAEADLPATGSAA*
Ga0137381_1146804023300012207Vadose Zone SoilGDPDHMPNGQRLLHVVADRIQWQTALDLARRREAEADLPATGRAA*
Ga0137376_1134832233300012208Vadose Zone SoilESVKPGDPDHMPNGQRLLHVVADRIQWQTALDLARRRAAEADLPATGSAA*
Ga0137379_1083212933300012209Vadose Zone SoilYTWEAVKPGDPDHMPNGQRLLHVVADRIQWQTALDLARRRAAEADHPATGRAA*
Ga0137379_1113970013300012209Vadose Zone SoilPGDPDHMPNGQRLLHVVADRIQWQTALEQARRRAAEADLPATGSAA*
Ga0137372_1024701313300012350Vadose Zone SoilPDHMPNGQRLLHVVADRIQWQTALDLARRRAAEADLPATGRAA*
Ga0137372_1029594713300012350Vadose Zone SoilNGQRLLHVVADRIQWQTALELARRRAAESDLSATGRAA*
Ga0137372_1081574813300012350Vadose Zone SoilRLLHVVADRIQWQTALELARRRAAEADLPATGQAA*
Ga0137386_1041876713300012351Vadose Zone SoilLLHVVADRIQWQTALELARRRAAEADLPATGQAA*
Ga0137386_1090893613300012351Vadose Zone SoilRLLHVVADRIQWQTALDLARRRTSEADLSATGRVA*
Ga0137386_1102150313300012351Vadose Zone SoilGDPDHMPNGQRLLHVVADRIRWQTALDQARRRAATPITPEISATGTAA*
Ga0157350_105132913300012499Unplanted SoilLLHVVADRIQWQTALDLARRRAAEADLPATGRAA*
Ga0137398_1089312613300012683Vadose Zone SoilMPNGQRLLHVVADRIQWQTALDLARRRTNEADLSATGRVA*
Ga0137395_1056237623300012917Vadose Zone SoilMPNGQRLMHVVADRIQWQTALEQARRRAAEAGLSATSRAA*
Ga0181518_1050705913300014156BogKPGDPDHMLNGQRLLHVVADRIQWQTALELARRRAAEADLSATGSAA*
Ga0182024_1221924833300014501PermafrostHVVADRIRWKQALDEARRRAEGLPPNDISATGRPT*
Ga0182034_1070446233300016371SoilYSSEPVEPGDRDFMPGAQRLLHVVADRMRWLQALDQARRRAQGLPDDLPATMEAA
Ga0182039_1203886713300016422SoilVRPSDPDHMPNGQRLLHVVADRIQWQTALDLARRRAAEADPSATGRAA
Ga0182039_1208710113300016422SoilVRPSDPDHMPNGQRLLHVVADRIQWQTALDLARRRAAEADLSATGRAA
Ga0187812_121083213300017821Freshwater SedimentSDPDHMPTGQRLLHVVADRIQWHTALELARRRAAESDLPATGSAA
Ga0187820_125732613300017924Freshwater SedimentRLLHVVADRIQWQTALDQARRRAAEAGPPPSGQAA
Ga0187806_111330233300017928Freshwater SedimentPNGQRLLHIVADRLLWQTALAEARYRAAIALDADQSAAGRAA
Ga0187814_1007896813300017932Freshwater SedimentKPGDPDHMPNGQRLLHVVADRIQWQTALEQARRRAAEAGLPATGRAA
Ga0187814_1042289823300017932Freshwater SedimentMPTGQRLLHVVADRMNWLQALDQARRRAQGPPDDLSATGRAA
Ga0187808_1031470633300017942Freshwater SedimentEPVKPGDPDHMPNGQRLLHVVADRIQWQTALELARRRAAEADLSATGRAA
Ga0187808_1056130813300017942Freshwater SedimentVRPGDPDHMPTGQRLLHIGADRIQWQTALEQARRRAAEDELPASGRAA
Ga0187817_1024532313300017955Freshwater SedimentQRLLHVVADRIQWQTALEQARRRAAEAGPPANGQAG
Ga0187779_1032653113300017959Tropical PeatlandRLLHVVADRIQWQTAIDQARRRAAEAGLSATGRAA
Ga0187779_1133843613300017959Tropical PeatlandHMPNGQRLLHVVADRIRWQTALELARRRAAETDLPATGRAA
Ga0187772_1038537713300018085Tropical PeatlandDHMPTARRLLHVAADRMRWLAALDQARRRATGGTDPDLSATGRAA
Ga0187769_1073742113300018086Tropical PeatlandKPGDLDHMPNGQRLLHVVADRLRWQTALAEARHRAAIALDADQSAAGRAA
Ga0187770_1161774813300018090Tropical PeatlandEAVKPGDPDHMPNGQRLLHVVADRIQWQTALEMARRRAAEADLSATGSAA
Ga0066662_1106962833300018468Grasslands SoilPNGQRLLHVVADRIQWQTALELARRRAAEADLPATERAA
Ga0210403_1121598913300020580SoilDPDHMPNGQRLLHVVADRIQWQTALELARRRAAEADLPATEQAA
Ga0210404_1031446913300021088SoilDPDHMPNGQRLLHVVADRIQWQTALDLARRRAAEANPSATGRAA
Ga0210393_1062178933300021401SoilVEPGDRDHMPTGQRLLHVVADRMHWLQALDQARRRAQGPPDDLSATGRAA
Ga0210383_1133620313300021407SoilYTWEPVTPSDHDHMPGPQRLLHVVADRIRWQQALDEARRRAQGQPPDDFPATGRAAA
Ga0207700_1195492013300025928Corn, Switchgrass And Miscanthus RhizospherePVKPGDPDHMPNGQRLLHVVADRIQWQTALDLARRRAAEADPSATGRAA
Ga0207698_1129193613300026142Corn RhizospherePVKPGDPDHMPNGQRLLHVVADRIQWQTALDLARRRAAEADLPATGSAA
Ga0209839_1010188433300026294SoilHMPPGQRLLHLVADRIQWQTALDQARRRAAGADLPATGRAA
Ga0209421_108050523300027432Forest SoilMPGDPDYMPHARRLLHVVADRIAWKQALDEARRRAAGQPDPDLSATEREAA
Ga0208043_117874613300027570Peatlands SoilPNGQRLLHVVADRIQWQTALEQARRRAAEADLSATGQAA
Ga0208043_119789513300027570Peatlands SoilGDPDHMPTGQRLLHVVADRIQWQTALELARRRAAESELPATGRAA
Ga0208565_115768433300027662Peatlands SoilMPNGQRLLHVVADRVQWQTALEQARRRAAEADLPATGRAA
Ga0209275_1093524933300027884SoilTWELVTPADQDHMPNGRRLLHVVADRMRWHTALDQARRRAAELSATGQAA
Ga0209624_1032961333300027895Forest SoilVNPGDHDHMPVARRLLHVVADRIRWQHALDQARRRAQGLPPDEISATGQAA
Ga0209624_1061631813300027895Forest SoilQDHMPTGQRLLHVVADRMQWLQALDQARRRAQGSPDDLSATGRAA
Ga0209415_1031014833300027905Peatlands SoilPDHMPNGQRLLHVVADRIQWQTALEQARRRAAETELPAKGRAA
Ga0209415_1058168313300027905Peatlands SoilPGDPDHMPTGQRLLHVVADRIQWQTALEQARRRAAEDGPPANGQAA
Ga0209415_1083134433300027905Peatlands SoilHMPTGQRLLHVVADRIQWQTALDQARRRAAEADLPANGRAA
Ga0209415_1095143723300027905Peatlands SoilLHVVADRIRWQTALEQARRRAAMPTTPELSATGTAA
Ga0302178_1026933113300030013PalsaDPDHMPTGQRLLHVVADRIQWQTALEMARRRAAMNDLSATGSAA
Ga0310038_1022552333300030707Peatlands SoilYMPNGQRLLHVVAERVQWQTALEQARRRAAEPDLPATGRAA
Ga0318538_1027898333300031546SoilYSWEPVEPGDRDFMPGAQRLLHVVADRMRWLQALDQARRRAEGLQSDDPSANGRAA
Ga0310686_11695377733300031708SoilPGDQDHMPTARRLLHVVADRIRWQQALDQARRRAQGLPPQDLSATGAAA
Ga0318547_1074436633300031781SoilMPNGQRLLHVVADRIQWQTALDLARRRAAEADPSATGRAA
Ga0318497_1030536413300031805SoilRPSDPDHMPNGQRLLHVVADRIQWQTALDLARRRAAEADPSATGRAA
Ga0318568_1029192013300031819SoilEPGDRDFMPGAQRLLHVVADRMRWLQALDQARRRAEGLQSDDPSANGRAA
Ga0318569_1008743213300032010SoilYMPTGQRLLHVVADRMRWLQALDQARRRAEGLRSDDLPATGRAA
Ga0318575_1058283513300032055SoilRLLHVVADRIQWQTALELARRRAAEADLSATGRAA
Ga0306924_1264110613300032076SoilLDHMPNGQRLLHVVADRIQWQTALDLARRRAAEADLSATGRAA
Ga0311301_1124397933300032160Peatlands SoilGDPDHMPNGQRLLHVVADRIQWQTALEQARRRAGETDLPATGRAA
Ga0307470_1002811963300032174Hardwood Forest SoilWEPVKPGDDDHMPNGQRLLHVVADRIQWQTALDLARRRAAEADLPATGRAA
Ga0335083_1035112143300032954SoilPGDPDHMPNGQRLLHVIADRIQWHTALEMARRRAAEADLPQPGRPHDEPT
Ga0335073_1108823213300033134SoilPNGQRLLHVVADRIQWQTALELARRRAAEADLPATGRAA
Ga0335073_1183153513300033134SoilTWELVAPGDQDHMPTGQRLLHVVADRMHWLQALDQARRRAQGLIDDLSATGEAA
Ga0370483_0002492_3_1193300034124Untreated Peat SoilPSQRLLHVVADRIQWQTALDQARRRAAGPDLPATGRAA

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.