NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F097829

Metagenome / Metatranscriptome Family F097829

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F097829
Family Type Metagenome / Metatranscriptome
Number of Sequences 104
Average Sequence Length 39 residues
Representative Sequence KRRGKKIATIAIARKLLTRAWHLLAEMQATDASAPPRRP
Number of Associated Samples 86
Number of Associated Scaffolds 104

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Unclassified
% of genes with valid RBS motifs 0.00 %
% of genes near scaffold ends (potentially truncated) 100.00 %
% of genes from short scaffolds (< 2000 bps) 93.27 %
Associated GOLD sequencing projects 83
AlphaFold2 3D model prediction Yes
3D model pTM-score0.49

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Unclassified (59.615 % of family members)
NCBI Taxonomy ID N/A
Taxonomy N/A

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil
(11.539 % of family members)
Environment Ontology (ENVO) Unclassified
(35.577 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(49.038 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 44.78%    β-sheet: 0.00%    Coil/Unstructured: 55.22%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.49
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 104 Family Scaffolds
PF03050DDE_Tnp_IS66 1.92
PF02371Transposase_20 1.92
PF13006Nterm_IS4 1.92
PF01348Intron_maturas2 1.92
PF00196GerE 0.96
PF00400WD40 0.96
PF13578Methyltransf_24 0.96
PF02922CBM_48 0.96
PF00903Glyoxalase 0.96
PF01927Mut7-C 0.96
PF04493Endonuclease_5 0.96
PF12728HTH_17 0.96
PF02594DUF167 0.96
PF12681Glyoxalase_2 0.96
PF00933Glyco_hydro_3 0.96
PF08044DUF1707 0.96
PF01548DEDD_Tnp_IS110 0.96
PF14765PS-DH 0.96
PF00884Sulfatase 0.96
PF07366SnoaL 0.96

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 104 Family Scaffolds
COG3547TransposaseMobilome: prophages, transposons [X] 2.88
COG3436TransposaseMobilome: prophages, transposons [X] 1.92
COG1472Periplasmic beta-glucosidase and related glycosidasesCarbohydrate transport and metabolism [G] 0.96
COG1515Deoxyinosine 3'-endonuclease (endonuclease V)Replication, recombination and repair [L] 0.96
COG1656Uncharacterized conserved protein, contains PIN-related Mut7-C RNAse domainGeneral function prediction only [R] 0.96
COG1872Uncharacterized conserved protein YggU, UPF0235/DUF167 familyFunction unknown [S] 0.96


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
UnclassifiedrootN/A59.62 %
All OrganismsrootAll Organisms40.38 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2166559005|cont_contig105609All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces scabiei548Open in IMG/M
3300005162|Ga0066814_10103940All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces scabiei535Open in IMG/M
3300005337|Ga0070682_101438684All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces scabiei591Open in IMG/M
3300005338|Ga0068868_101879875All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces scabiei567Open in IMG/M
3300005345|Ga0070692_11333533Not Available516Open in IMG/M
3300005564|Ga0070664_100518065All Organisms → cellular organisms → Bacteria1100Open in IMG/M
3300005564|Ga0070664_101243928Not Available703Open in IMG/M
3300005617|Ga0068859_102602065Not Available557Open in IMG/M
3300005764|Ga0066903_104498362Not Available744Open in IMG/M
3300005841|Ga0068863_102199079All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces scabiei562Open in IMG/M
3300005921|Ga0070766_10148642All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces1432Open in IMG/M
3300006028|Ga0070717_10145414All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales2047Open in IMG/M
3300006046|Ga0066652_100972773All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces scabiei807Open in IMG/M
3300006050|Ga0075028_100916417Not Available541Open in IMG/M
3300006059|Ga0075017_101305091Not Available570Open in IMG/M
3300006102|Ga0075015_100555266Not Available668Open in IMG/M
3300006175|Ga0070712_100093219Not Available2210Open in IMG/M
3300006175|Ga0070712_100358329All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1195Open in IMG/M
3300006175|Ga0070712_100816871Not Available800Open in IMG/M
3300006175|Ga0070712_100866427All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia777Open in IMG/M
3300006237|Ga0097621_100535543All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales1065Open in IMG/M
3300006358|Ga0068871_102035765Not Available547Open in IMG/M
3300006791|Ga0066653_10303516All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces805Open in IMG/M
3300006804|Ga0079221_10781508Not Available680Open in IMG/M
3300006804|Ga0079221_10808048All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces scabiei673Open in IMG/M
3300006804|Ga0079221_11395598Not Available557Open in IMG/M
3300006806|Ga0079220_11527606Not Available574Open in IMG/M
3300006854|Ga0075425_100586279All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales1283Open in IMG/M
3300006954|Ga0079219_10397476All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia912Open in IMG/M
3300009012|Ga0066710_103121493Not Available640Open in IMG/M
3300009101|Ga0105247_10373375All Organisms → cellular organisms → Bacteria → Terrabacteria group1009Open in IMG/M
3300009174|Ga0105241_12277485Not Available539Open in IMG/M
3300009177|Ga0105248_10325160All Organisms → cellular organisms → Bacteria → Terrabacteria group1732Open in IMG/M
3300010046|Ga0126384_11413541Not Available649Open in IMG/M
3300010048|Ga0126373_10866398All Organisms → cellular organisms → Bacteria967Open in IMG/M
3300010154|Ga0127503_10729681Not Available500Open in IMG/M
3300010322|Ga0134084_10471519Not Available504Open in IMG/M
3300010361|Ga0126378_11281113Not Available828Open in IMG/M
3300010371|Ga0134125_11840255Not Available658Open in IMG/M
3300010375|Ga0105239_10187648All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2314Open in IMG/M
3300010375|Ga0105239_12965717Not Available553Open in IMG/M
3300010403|Ga0134123_10204236All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1684Open in IMG/M
3300010876|Ga0126361_10983273Not Available600Open in IMG/M
3300011271|Ga0137393_11218808All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia639Open in IMG/M
3300012199|Ga0137383_10170752All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → Actinomadura latina1593Open in IMG/M
3300012199|Ga0137383_10212889Not Available1416Open in IMG/M
3300012210|Ga0137378_10856709Not Available821Open in IMG/M
3300012211|Ga0137377_11159561All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium702Open in IMG/M
3300012211|Ga0137377_11241139Not Available675Open in IMG/M
3300012351|Ga0137386_10153014All Organisms → cellular organisms → Bacteria → Terrabacteria group1650Open in IMG/M
3300012351|Ga0137386_10669221All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii746Open in IMG/M
3300012357|Ga0137384_10169055All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1830Open in IMG/M
3300012507|Ga0157342_1034076Not Available655Open in IMG/M
3300012508|Ga0157315_1038248Not Available596Open in IMG/M
3300012922|Ga0137394_11452204Not Available546Open in IMG/M
3300012988|Ga0164306_11638685Not Available556Open in IMG/M
3300013105|Ga0157369_10919885Not Available897Open in IMG/M
3300013307|Ga0157372_10881396All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae1039Open in IMG/M
3300013307|Ga0157372_11352945Not Available821Open in IMG/M
3300013307|Ga0157372_12662059Not Available574Open in IMG/M
3300013308|Ga0157375_12586986Not Available606Open in IMG/M
3300014969|Ga0157376_11414180All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii727Open in IMG/M
3300015264|Ga0137403_10964372All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium700Open in IMG/M
3300016422|Ga0182039_12120046Not Available518Open in IMG/M
3300016445|Ga0182038_10338955All Organisms → cellular organisms → Bacteria → Terrabacteria group1242Open in IMG/M
3300017823|Ga0187818_10459424Not Available569Open in IMG/M
3300017926|Ga0187807_1156257All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium730Open in IMG/M
3300017932|Ga0187814_10002380Not Available7457Open in IMG/M
3300017932|Ga0187814_10247746All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia675Open in IMG/M
3300017932|Ga0187814_10263490Not Available655Open in IMG/M
3300018006|Ga0187804_10259338Not Available751Open in IMG/M
3300018042|Ga0187871_10031953All Organisms → cellular organisms → Bacteria → Terrabacteria group3285Open in IMG/M
3300018086|Ga0187769_10227587All Organisms → cellular organisms → Bacteria1384Open in IMG/M
3300018433|Ga0066667_11691133Not Available567Open in IMG/M
3300018433|Ga0066667_11695636Not Available567Open in IMG/M
3300020581|Ga0210399_10047249All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Rubrobacterales → Rubrobacteraceae → unclassified Rubrobacteraceae → Rubrobacteraceae bacterium3455Open in IMG/M
3300021407|Ga0210383_11377091Not Available587Open in IMG/M
3300021474|Ga0210390_11345559Not Available571Open in IMG/M
3300021478|Ga0210402_10719700All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia922Open in IMG/M
3300021560|Ga0126371_12000530Not Available697Open in IMG/M
3300024347|Ga0179591_1193627Not Available1912Open in IMG/M
3300025914|Ga0207671_11290762Not Available569Open in IMG/M
3300025915|Ga0207693_10489547Not Available960Open in IMG/M
3300025915|Ga0207693_10646975All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces yunnanensis821Open in IMG/M
3300025915|Ga0207693_11089347Not Available607Open in IMG/M
3300025916|Ga0207663_10993009Not Available673Open in IMG/M
3300025917|Ga0207660_11254116Not Available602Open in IMG/M
3300025928|Ga0207700_10798361Not Available844Open in IMG/M
3300025944|Ga0207661_10901966Not Available814Open in IMG/M
3300025945|Ga0207679_11444627Not Available631Open in IMG/M
3300025960|Ga0207651_12018622Not Available518Open in IMG/M
3300026118|Ga0207675_101567576Not Available679Open in IMG/M
3300027855|Ga0209693_10417487Not Available647Open in IMG/M
3300028047|Ga0209526_10828594Not Available570Open in IMG/M
3300028709|Ga0307279_10072521Not Available601Open in IMG/M
3300030054|Ga0302182_10372642Not Available599Open in IMG/M
3300030659|Ga0316363_10313525Not Available625Open in IMG/M
3300031090|Ga0265760_10247071Not Available617Open in IMG/M
3300031719|Ga0306917_11060703All Organisms → cellular organisms → Bacteria → Terrabacteria group632Open in IMG/M
3300031753|Ga0307477_11127005Not Available511Open in IMG/M
3300031797|Ga0318550_10075431All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1558Open in IMG/M
3300031797|Ga0318550_10246667All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria866Open in IMG/M
3300031954|Ga0306926_10243167All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2231Open in IMG/M
3300032261|Ga0306920_101260341Not Available1065Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil11.54%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere10.58%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment5.77%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil5.77%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil4.81%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil4.81%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil3.85%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere3.85%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere3.85%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds2.88%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil2.88%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil2.88%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere2.88%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere2.88%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere2.88%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil1.92%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil1.92%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil1.92%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere1.92%
Miscanthus RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere1.92%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere1.92%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.92%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland0.96%
SoilEnvironmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil0.96%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.96%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil0.96%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil0.96%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil0.96%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland0.96%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil0.96%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil0.96%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa0.96%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere0.96%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere0.96%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere0.96%
SimulatedEngineered → Modeled → Simulated Communities (Sequence Read Mixture) → Unclassified → Unclassified → Simulated0.96%
Boreal Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil0.96%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2166559005Simulated microbial communities from Lyon, FranceEngineeredOpen in IMG/M
3300005162Soil and rhizosphere microbial communities from Laval, Canada - mgLABEnvironmentalOpen in IMG/M
3300005337Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaGEnvironmentalOpen in IMG/M
3300005338Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2Host-AssociatedOpen in IMG/M
3300005345Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaGEnvironmentalOpen in IMG/M
3300005564Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaGHost-AssociatedOpen in IMG/M
3300005617Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2Host-AssociatedOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300005841Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2Host-AssociatedOpen in IMG/M
3300005921Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6EnvironmentalOpen in IMG/M
3300006028Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaGEnvironmentalOpen in IMG/M
3300006046Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101EnvironmentalOpen in IMG/M
3300006050Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014EnvironmentalOpen in IMG/M
3300006059Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012EnvironmentalOpen in IMG/M
3300006102Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013EnvironmentalOpen in IMG/M
3300006175Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaGEnvironmentalOpen in IMG/M
3300006237Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2)Host-AssociatedOpen in IMG/M
3300006358Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2Host-AssociatedOpen in IMG/M
3300006791Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102EnvironmentalOpen in IMG/M
3300006804Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200EnvironmentalOpen in IMG/M
3300006806Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100EnvironmentalOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300006954Agricultural soil microbial communities from Georgia to study Nitrogen management - GA ControlEnvironmentalOpen in IMG/M
3300009012Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159EnvironmentalOpen in IMG/M
3300009101Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaGHost-AssociatedOpen in IMG/M
3300009174Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaGHost-AssociatedOpen in IMG/M
3300009177Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaGHost-AssociatedOpen in IMG/M
3300010046Tropical forest soil microbial communities from Panama - MetaG Plot_36EnvironmentalOpen in IMG/M
3300010048Tropical forest soil microbial communities from Panama - MetaG Plot_11EnvironmentalOpen in IMG/M
3300010154Soil microbial communities from Willow Creek, Wisconsin, USA - WC-WI-TBF metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010322Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300010361Tropical forest soil microbial communities from Panama - MetaG Plot_23EnvironmentalOpen in IMG/M
3300010371Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1EnvironmentalOpen in IMG/M
3300010375Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaGHost-AssociatedOpen in IMG/M
3300010403Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3EnvironmentalOpen in IMG/M
3300010876Boreal forest soil eukaryotic communities from Alaska, USA - W5-5 Metatranscriptome (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300011271Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaGEnvironmentalOpen in IMG/M
3300012199Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012210Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaGEnvironmentalOpen in IMG/M
3300012211Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaGEnvironmentalOpen in IMG/M
3300012351Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaGEnvironmentalOpen in IMG/M
3300012357Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaGEnvironmentalOpen in IMG/M
3300012507Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610Host-AssociatedOpen in IMG/M
3300012508Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.old.270510Host-AssociatedOpen in IMG/M
3300012922Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaGEnvironmentalOpen in IMG/M
3300012988Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MGEnvironmentalOpen in IMG/M
3300013105Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaGHost-AssociatedOpen in IMG/M
3300013307Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaGHost-AssociatedOpen in IMG/M
3300013308Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaGHost-AssociatedOpen in IMG/M
3300014969Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaGHost-AssociatedOpen in IMG/M
3300015264Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300016422Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111EnvironmentalOpen in IMG/M
3300016445Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108EnvironmentalOpen in IMG/M
3300017823Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3EnvironmentalOpen in IMG/M
3300017926Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_2EnvironmentalOpen in IMG/M
3300017932Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_4EnvironmentalOpen in IMG/M
3300018006Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_4EnvironmentalOpen in IMG/M
3300018042Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_10EnvironmentalOpen in IMG/M
3300018086Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MGEnvironmentalOpen in IMG/M
3300018433Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116EnvironmentalOpen in IMG/M
3300020581Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-MEnvironmentalOpen in IMG/M
3300021407Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-OEnvironmentalOpen in IMG/M
3300021474Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-OEnvironmentalOpen in IMG/M
3300021478Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-MEnvironmentalOpen in IMG/M
3300021560Tropical forest soil microbial communities from Panama - MetaG Plot_4EnvironmentalOpen in IMG/M
3300024347Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal (PacBio error correction)EnvironmentalOpen in IMG/M
3300025914Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025915Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025916Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025917Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025928Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025944Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025945Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025960Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026118Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300027855Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 (SPAdes)EnvironmentalOpen in IMG/M
3300028047Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300028709Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_118EnvironmentalOpen in IMG/M
3300030054Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_N3_1EnvironmentalOpen in IMG/M
3300030659Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG (v2)EnvironmentalOpen in IMG/M
3300031090Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031719Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2)EnvironmentalOpen in IMG/M
3300031753Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515EnvironmentalOpen in IMG/M
3300031797Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f23EnvironmentalOpen in IMG/M
3300031954Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2)EnvironmentalOpen in IMG/M
3300032261Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2)EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
cont_0608.000059602166559005SimulatedIAKRRGNKIATTAISRKLLTRAYHLLADMQATDTTTPLLRP
Ga0066814_1010394013300005162SoilIAKRRGKKIATIAIARKLLTRAWHLLDQMQPAEASTPPRRP*
Ga0070682_10143868413300005337Corn RhizosphereAIAKRRGKKIATIAIARKLLTRAWHLLDQMQPAEAGTPPRRP*
Ga0068868_10187987513300005338Miscanthus RhizosphereKRRGKKIATIAIARKLLTRAWHLLNDLQAASADEPLRRP*
Ga0070692_1133353333300005345Corn, Switchgrass And Miscanthus RhizosphereIAKRRGKKIATIAVARKLLTRAWHLLNEMQATDTNAPLRRP*
Ga0070664_10051806513300005564Corn RhizosphereRGKKIATIAVARKLLTRAWHLLNEMQATDTNAPLRRP*
Ga0070664_10124392813300005564Corn RhizosphereRGKKIATIAIARKLLTRAWHLLDQMQPAEAGTPPRRP*
Ga0068859_10260206523300005617Switchgrass RhizosphereKIATIAIARKLLTRAWHLLAELQAAEASTPPRRP*
Ga0066903_10449836223300005764Tropical Forest SoilRRGKKIATIAISRKLLTRAWHLLSQPEPAEASTPPRRP*
Ga0068863_10219907913300005841Switchgrass RhizosphereGKKIATIAISRKLLTRAWHLLDQMQPAGASTPLRRP*
Ga0070766_1014864213300005921SoilAQRRGKKIATIAIARKLLTRAYHLLAGLQATSTNEPPRRP*
Ga0070717_1014541433300006028Corn, Switchgrass And Miscanthus RhizosphereIAKRRGKKIATIAIARKLLTRAWHLLNDLQAASADEPLRRP*
Ga0066652_10097277313300006046SoilKKIATIAIARKLLTRAWHLLAGMQATSTNEPPRRP*
Ga0075028_10091641713300006050WatershedsKKIATIAISRKLLTRAYHLLADMQATDASAPLQRP*
Ga0075017_10130509123300006059WatershedsRRGKKIATIAISRKLLTRAYHLLADMQATDTTTPLWRP*
Ga0075015_10055526613300006102WatershedsKRRGKKIATIAIARKLLTRAWHLLAEMQATDASAPPRRP*
Ga0070712_10009321913300006175Corn, Switchgrass And Miscanthus RhizosphereRGKKIATIAIARKLLTRAYHLLAEMQAAEETTPPRRM*
Ga0070712_10035832923300006175Corn, Switchgrass And Miscanthus RhizosphereRRGKKIATIAISRKLLTRAWHLLNQMQATAAATPPRP*
Ga0070712_10081687123300006175Corn, Switchgrass And Miscanthus RhizosphereRRGKKIATIAIARKLLTRAWHLLADMQAASMNEPPRRP*
Ga0070712_10086642723300006175Corn, Switchgrass And Miscanthus RhizosphereRRGKKIATIAIARKLLTRAYHLLAETPAPGATTPLQRP*
Ga0097621_10053554313300006237Miscanthus RhizosphereKKIATIAIARKLLTRAWHLLSDMQAAGPATPPRP*
Ga0068871_10203576523300006358Miscanthus RhizosphereRRGKKIATIAISRKLLTRAWHLLADMQATSTNEPPRRP*
Ga0066653_1030351613300006791SoilRRGKKIATIAISCKLLTRAWHLLAEIQAADASTPPRRP*
Ga0079221_1078150813300006804Agricultural SoilRRGKKIATIAVARKLLTRAWHLLTEMQAADGTPPRRP*
Ga0079221_1080804813300006804Agricultural SoilRGKKIATIAISRKLLTRAWHLLNDLQATNAATPPRRP*
Ga0079221_1139559823300006804Agricultural SoilRGKKIATIAIARKLLTRAWHLLADMQATGPATPPRP*
Ga0079220_1152760613300006806Agricultural SoilRRGKKIATIAIARKLLTRAWHLLAEMPATGTTTPPRRP*
Ga0075425_10058627933300006854Populus RhizosphereIAKRRGKKIATIAISRKLLTRAWHLLSEMQDTDTTTTPPRRP*
Ga0079219_1039747613300006954Agricultural SoilIARRRGKKIATIAISRKLLTRAWHLLAGMQATGPAAPPRP*
Ga0066710_10312149323300009012Grasslands SoilQKIATIAIARKLLTRAWHLLDQMERADAGTPPERP
Ga0105247_1037337513300009101Switchgrass RhizosphereRRGKKIATIAISRKLLTRAWHLLAGMQATSTNEPPRRP*
Ga0105241_1227748513300009174Corn RhizosphereKRRGKKIATIAISRKLLTRAYHLLAEMQATRTNAPPQRP*
Ga0105248_1032516013300009177Switchgrass RhizosphereIAQRRGKKIATIAVARKLLTRAWHLLNEMQATDTNAPLRRP*
Ga0126384_1141354113300010046Tropical Forest SoilKKIATIAIARKLLTRAWHLLAGLQAAAGPDAPPRP*
Ga0126373_1086639813300010048Tropical Forest SoilKRRGKKIATIAISRKLLTRAWHLLAGMQDIDATTPPRRS*
Ga0127503_1072968113300010154SoilKIATIAVARKLLTRAWHLLAELQAADASTPPRRP*
Ga0134084_1047151913300010322Grasslands SoilAKRRGKKIATIAVSRKLLTRAWHLLSEMQAADASTPPRRP*
Ga0126378_1128111313300010361Tropical Forest SoilGKKIATIAIARKLLTRAWHLLSEMPAAEASTPPGRP*
Ga0134125_1184025513300010371Terrestrial SoilKKIATIAISRKLLTRAWHLLNQMQATSTNEPPQRP*
Ga0105239_1018764833300010375Corn RhizosphereAIAKRRGKKIATIAISRKLLTRAWHLLAGMQATSTNEPPRRP*
Ga0105239_1296571713300010375Corn RhizosphereGKKIATIAIARKLLTRAWHLLAEMPATDATTPPRRP*
Ga0134123_1020423613300010403Terrestrial SoilKKIATIAISRKLLTRAWHLLNDLQATDAATPPRRP*
Ga0126361_1098327323300010876Boreal Forest SoilAKRRGKKIATIAISRKLLTRAYHLLADMQAADANAPLWRP*
Ga0137393_1121880813300011271Vadose Zone SoilRRGKKIATIAIARKLLTRAWHLLAELQAADASTPPRRP*
Ga0137383_1017075213300012199Vadose Zone SoilRRGKKIATIAIARKLLTRAWHLLNEMQATNASTQLRRP*
Ga0137383_1021288923300012199Vadose Zone SoilRRGKKIATIAIARKLLTRAWHLLSDMQATGPATPPRP*
Ga0137378_1085670913300012210Vadose Zone SoilGKKIATIAIARKLLTRAWHLLSDMQATGPATPPRP*
Ga0137377_1115956113300012211Vadose Zone SoilKKIATIAISRKLLTRAYHLLADLQATSTNEPLRRP*
Ga0137377_1124113913300012211Vadose Zone SoilRGKKIATIAIARKLLTRAWHLLNEMQATNASTQLRRP*
Ga0137386_1015301413300012351Vadose Zone SoilKIATITISRKLLTRAWPLLAEMQPAGTSTPPRRP*
Ga0137386_1066922113300012351Vadose Zone SoilRRGKKIATIAIARKLLTRAWHLLNEMQATGPATPPRRP*
Ga0137384_1016905523300012357Vadose Zone SoilAAIAKRRGKKIATIAIARKLLTRAWHLLSDMQATGPATPPRP*
Ga0157342_103407613300012507Arabidopsis RhizosphereKKIATIAIARKLLTRAWHLLNDLQAADAATPPRRP*
Ga0157315_103824823300012508Arabidopsis RhizosphereAAISKRRGKKIATIAIARKLLTRAWHLLDQMQPAEAGTPPRRP*
Ga0137394_1145220413300012922Vadose Zone SoilSAIAKRRGKKIATIAISRKLLTRAWHLLADMQATNTNEPPRRP*
Ga0164306_1163868513300012988SoilGKKIATIAISRKLLTRAWHLLSEMQAAEAGTPPRRP*
Ga0157369_1091988513300013105Corn RhizosphereRGKKIATIAIARKLLTRAWHLLSEMQAADASTPLRRP*
Ga0157372_1088139613300013307Corn RhizosphereKRRGKKIATIAVARKLLTRAWHLLSEMQDTDTTTTPPRRP*
Ga0157372_1135294513300013307Corn RhizosphereKRRGKKIATIAISRKLLTRAWHLLDQMQPAGASTPLRRP*
Ga0157372_1266205913300013307Corn RhizosphereRGKKIATIAIARKLLTRAWHLLAEMPATDATTPPRRP*
Ga0157375_1258698613300013308Miscanthus RhizosphereRGKKIATIAIARKLLTRAWHLLSDMQAAGPATPPRP*
Ga0157376_1141418013300014969Miscanthus RhizosphereAIAGRRGKKIATIAIARKLLTRGWHLLNDMQAADAATPLRRP*
Ga0137403_1096437213300015264Vadose Zone SoilAAIAKRRGKKIATIAISRKLLTRAYHLLADLQATSTNEPLRRP*
Ga0182039_1212004613300016422SoilKKIATIAIARKLLTRAWHLLSEMEPADASTPLRRP
Ga0182038_1033895533300016445SoilATIAQRRGKKIATIAISRKLLTRAWHLLSQLEPADASTPPRRP
Ga0187818_1045942413300017823Freshwater SedimentKRRGKKIATIAIARKLVTRAWHLLSEMEPGEASAPLRRP
Ga0187807_115625713300017926Freshwater SedimentNIAKRRGKKIATIAIARKLLTRAYHLLADMQATGTTTPLRRP
Ga0187814_1000238013300017932Freshwater SedimentGKKIATIAISRKLLTRAWHLLSEMQAAEAGMPPRRP
Ga0187814_1024774623300017932Freshwater SedimentYSSIAKRRGKKIATIAIARKLLTRACHLLAGMPATGTTTPPRRP
Ga0187814_1026349013300017932Freshwater SedimentKRRGKKIATIAIARKLLTRAWHLLAEMETAEASTPLRRP
Ga0187804_1025933813300018006Freshwater SedimentRRGKKIATIAIARKLLTRAWHLLAEMETAEASTPLRRP
Ga0187871_1003195343300018042PeatlandRGKKIATIAIARKLLTRAYHLLADMQATGTTTPLQQP
Ga0187769_1022758733300018086Tropical PeatlandAIAKRRGKKIATIAVARKLLTRAWHLLSDMQATGPATPPRP
Ga0066667_1169113313300018433Grasslands SoilRGKKIATIAISRKLLTRAYHLLADMQATDTTTPLRRP
Ga0066667_1169563613300018433Grasslands SoilIAKRRGKKIATIAIARKLLTRAWHLLHDLQAAGASAPPPRP
Ga0210399_1004724973300020581SoilKKIAAIAIARKLLTRAWHLLADMQATDTTTPLLRP
Ga0210383_1137709123300021407SoilHRQRRGQKIATIAIARKLLTRAWHLLSEMQAADASAAPRRP
Ga0210390_1134555913300021474SoilKRRGKKIATIAVSRKLLTRAWHLLSEMQAADASAPPRQP
Ga0210402_1071970023300021478SoilGNKIATIAISRKLLTRAWHLLAEMQATSANDPPRP
Ga0126371_1200053023300021560Tropical Forest SoilRAAIAKRRGKKIATIAIAGELMTRAWHLLAEPADASTLSRRP
Ga0179591_119362713300024347Vadose Zone SoilGKKIATIAISRKLLTRSWHLLADMQATSTNEPPRRP
Ga0207671_1129076213300025914Corn RhizosphereRRGKKIATIAVARKLLTRAWHLLNEMQATDTNAPLRRP
Ga0207693_1048954713300025915Corn, Switchgrass And Miscanthus RhizosphereHIAKRRGTKIATIAISRKLLTRAWHLLSEMQAADASTPSRRP
Ga0207693_1064697513300025915Corn, Switchgrass And Miscanthus RhizosphereRGKKIATIAIARKLLTRAYHLLAEMQAAEETTPPRRM
Ga0207693_1108934723300025915Corn, Switchgrass And Miscanthus RhizosphereYAAISKRRGKKIATIAIARKLLTRAWHLLDQMQPAEAGTPPRRP
Ga0207663_1099300913300025916Corn, Switchgrass And Miscanthus RhizosphereRRGRKIATIAIARKLLTRAWHLLASMQADGTATPPQRP
Ga0207660_1125411613300025917Corn RhizosphereSGIAKRRGKKIATIAISRKLLTRAWHLLSEMQAAGADEPPRRS
Ga0207700_1079836133300025928Corn, Switchgrass And Miscanthus RhizosphereRRGKKIATIAIARKLLTRGWHLLNDMQAADAATPLRRP
Ga0207661_1090196613300025944Corn RhizosphereAAIAKRRGKKIATIAVARKLLTRAWHLLNEMQATDTNAPLRRP
Ga0207679_1144462723300025945Corn RhizosphereRRGKKIATIAIARKLLTRAWHLLDQMQPAEAGTPPRRP
Ga0207651_1201862213300025960Switchgrass RhizosphereKRRGKKIATIAISRKLLARAWHLLSEMQAAGADEPPRRS
Ga0207675_10156757613300026118Switchgrass RhizosphereIAKRRGKKIATIAVARKLLTRAWHLLNEMQATDTNAPLRRP
Ga0209693_1041748713300027855SoilRGKKIATIAIARKLLTRAWHLLSEMQAADASAAPRRP
Ga0209526_1082859413300028047Forest SoilIAKRRGKKIATIAISRKLLTRAYHLLADMQATGTTTPLRRP
Ga0307279_1007252113300028709SoilYSAIAKRRGKKIATIAISRKLLTRAWHLLADMQATSTNEPPRRP
Ga0302182_1037264223300030054PalsaRGKKIATIAISRKLLTRAWHLLAGMQATTGTATPPQRRP
Ga0316363_1031352513300030659Peatlands SoilIAKRRGKKIATIAIARKLLTRAWHLLADMQATDASAPLRRP
Ga0265760_1024707113300031090SoilRRGKKIATIAISRKLLTRAWHLLSEIQAADASTPPRRP
Ga0306917_1106070313300031719SoilGQPGERRRLARRRGKKIATIAIARKLVTRAWHLLSEMEPPEASTPLRRP
Ga0307477_1112700523300031753Hardwood Forest SoilKKIATIAIARKLLTRAWHLLSEMETAEASAPPRRP
Ga0318550_1007543113300031797SoilKKIATIAISRKLLTRAWHLLSQLEPAEASTPPRRP
Ga0318550_1024666723300031797SoilYAAIAKRRGKKIATIAVARKLLTRAWHLLDQMQAADAGAPPRP
Ga0306926_1024316713300031954SoilAKRRGKKIATIAIARKLLTRAWHLLNEMQAAGASTPPRRP
Ga0306920_10126034113300032261SoilAAIANRRGKKIATIAIARKLVTRAWHLLSEMQAADVGAPSRRP


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.