NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F097799

Metagenome / Metatranscriptome Family F097799

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F097799
Family Type Metagenome / Metatranscriptome
Number of Sequences 104
Average Sequence Length 42 residues
Representative Sequence MAAQIRLPGRAEPLVIPEPGWAATYPPPSSRRVYAAAHVAAV
Number of Associated Samples 90
Number of Associated Scaffolds 104

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 52.43 %
% of genes near scaffold ends (potentially truncated) 98.08 %
% of genes from short scaffolds (< 2000 bps) 87.50 %
Associated GOLD sequencing projects 84
AlphaFold2 3D model prediction Yes
3D model pTM-score0.43

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (62.500 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(33.654 % of family members)
Environment Ontology (ENVO) Unclassified
(34.615 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(50.000 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Fibrous Signal Peptide: No Secondary Structure distribution: α-helix: 20.00%    β-sheet: 8.57%    Coil/Unstructured: 71.43%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.43
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 104 Family Scaffolds
PF02894GFO_IDH_MocA_C 22.12
PF01408GFO_IDH_MocA 5.77
PF13377Peripla_BP_3 2.88
PF01627Hpt 0.96
PF06187DUF993 0.96
PF00532Peripla_BP_1 0.96
PF02728Cu_amine_oxidN3 0.96
PF12323HTH_OrfB_IS605 0.96
PF13520AA_permease_2 0.96

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 104 Family Scaffolds
COG0673Predicted dehydrogenaseGeneral function prediction only [R] 22.12
COG3733Cu2+-containing amine oxidaseSecondary metabolites biosynthesis, transport and catabolism [Q] 0.96


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms62.50 %
UnclassifiedrootN/A37.50 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300001356|JGI12269J14319_10280059All Organisms → cellular organisms → Bacteria608Open in IMG/M
3300001418|JGI20188J14859_1013941All Organisms → cellular organisms → Bacteria931Open in IMG/M
3300001593|JGI12635J15846_10092549All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales2185Open in IMG/M
3300002245|JGIcombinedJ26739_100666888All Organisms → cellular organisms → Bacteria918Open in IMG/M
3300005181|Ga0066678_10368805All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces949Open in IMG/M
3300005439|Ga0070711_100054905All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales2750Open in IMG/M
3300005439|Ga0070711_101582323All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia573Open in IMG/M
3300005537|Ga0070730_11029405All Organisms → cellular organisms → Bacteria513Open in IMG/M
3300005541|Ga0070733_10471521All Organisms → cellular organisms → Bacteria839Open in IMG/M
3300005548|Ga0070665_102430601Not Available526Open in IMG/M
3300005602|Ga0070762_11254129All Organisms → cellular organisms → Bacteria514Open in IMG/M
3300005610|Ga0070763_10081606All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales1600Open in IMG/M
3300005610|Ga0070763_10689689All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces598Open in IMG/M
3300005764|Ga0066903_100909867All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1593Open in IMG/M
3300005921|Ga0070766_10445066Not Available855Open in IMG/M
3300006175|Ga0070712_100650375All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces896Open in IMG/M
3300006176|Ga0070765_101286809All Organisms → cellular organisms → Bacteria690Open in IMG/M
3300009089|Ga0099828_10204897All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1761Open in IMG/M
3300009089|Ga0099828_10230792All Organisms → cellular organisms → Bacteria1656Open in IMG/M
3300009792|Ga0126374_10007008All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria4138Open in IMG/M
3300010358|Ga0126370_11034760All Organisms → cellular organisms → Bacteria752Open in IMG/M
3300010360|Ga0126372_12442485Not Available573Open in IMG/M
3300010366|Ga0126379_11348205All Organisms → cellular organisms → Bacteria819Open in IMG/M
3300010376|Ga0126381_104946851Not Available511Open in IMG/M
3300012206|Ga0137380_10620432Not Available944Open in IMG/M
3300012929|Ga0137404_11095830All Organisms → cellular organisms → Bacteria730Open in IMG/M
3300014654|Ga0181525_10385322Not Available769Open in IMG/M
3300016319|Ga0182033_10488122All Organisms → cellular organisms → Bacteria1056Open in IMG/M
3300016387|Ga0182040_11951297Not Available504Open in IMG/M
3300016422|Ga0182039_11938773Not Available541Open in IMG/M
3300017822|Ga0187802_10003002All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria4857Open in IMG/M
3300017823|Ga0187818_10025810All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2516Open in IMG/M
3300017933|Ga0187801_10023553All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2113Open in IMG/M
3300017970|Ga0187783_11298467Not Available524Open in IMG/M
3300017973|Ga0187780_10345461All Organisms → cellular organisms → Bacteria1051Open in IMG/M
3300017975|Ga0187782_10725406All Organisms → cellular organisms → Bacteria767Open in IMG/M
3300018060|Ga0187765_11359481Not Available505Open in IMG/M
3300018482|Ga0066669_10061089All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2440Open in IMG/M
3300020581|Ga0210399_11576702All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia507Open in IMG/M
3300021086|Ga0179596_10347097All Organisms → cellular organisms → Bacteria745Open in IMG/M
3300021402|Ga0210385_11089701Not Available613Open in IMG/M
3300021406|Ga0210386_10026967All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria4501Open in IMG/M
3300021406|Ga0210386_10538612All Organisms → cellular organisms → Bacteria1009Open in IMG/M
3300021406|Ga0210386_11085163All Organisms → cellular organisms → Bacteria680Open in IMG/M
3300021407|Ga0210383_11555781Not Available545Open in IMG/M
3300022557|Ga0212123_10437898All Organisms → cellular organisms → Bacteria865Open in IMG/M
3300025464|Ga0208076_1027687All Organisms → cellular organisms → Bacteria987Open in IMG/M
3300025928|Ga0207700_10048043All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia3166Open in IMG/M
3300026361|Ga0257176_1089006Not Available507Open in IMG/M
3300027067|Ga0208602_1029441Not Available539Open in IMG/M
3300027110|Ga0208488_1006060All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2459Open in IMG/M
3300027725|Ga0209178_1401298Not Available521Open in IMG/M
3300027824|Ga0209040_10519129Not Available525Open in IMG/M
3300027855|Ga0209693_10030320All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2634Open in IMG/M
3300027875|Ga0209283_10298766All Organisms → cellular organisms → Bacteria1063Open in IMG/M
3300027884|Ga0209275_10451115Not Available729Open in IMG/M
3300027884|Ga0209275_10569028All Organisms → cellular organisms → Bacteria649Open in IMG/M
3300028563|Ga0265319_1046943All Organisms → cellular organisms → Bacteria1438Open in IMG/M
3300028808|Ga0302228_10066655All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1714Open in IMG/M
3300028877|Ga0302235_10304191Not Available689Open in IMG/M
3300030007|Ga0311338_11207893All Organisms → cellular organisms → Bacteria717Open in IMG/M
3300030399|Ga0311353_11734823Not Available501Open in IMG/M
3300030524|Ga0311357_10369068All Organisms → cellular organisms → Bacteria1361Open in IMG/M
3300030578|Ga0210275_10372452All Organisms → cellular organisms → Bacteria517Open in IMG/M
3300030618|Ga0311354_10392993All Organisms → cellular organisms → Bacteria1402Open in IMG/M
3300031543|Ga0318516_10662773All Organisms → cellular organisms → Bacteria594Open in IMG/M
3300031544|Ga0318534_10136679All Organisms → cellular organisms → Bacteria1412Open in IMG/M
3300031544|Ga0318534_10325249All Organisms → cellular organisms → Bacteria886Open in IMG/M
3300031544|Ga0318534_10632702Not Available607Open in IMG/M
3300031546|Ga0318538_10262264All Organisms → cellular organisms → Bacteria929Open in IMG/M
3300031546|Ga0318538_10727114Not Available538Open in IMG/M
3300031715|Ga0307476_10657482All Organisms → cellular organisms → Bacteria777Open in IMG/M
3300031736|Ga0318501_10754718Not Available538Open in IMG/M
3300031744|Ga0306918_11178572Not Available592Open in IMG/M
3300031764|Ga0318535_10443641Not Available578Open in IMG/M
3300031769|Ga0318526_10126907All Organisms → cellular organisms → Bacteria1031Open in IMG/M
3300031771|Ga0318546_10478773All Organisms → cellular organisms → Bacteria873Open in IMG/M
3300031781|Ga0318547_10587865Not Available690Open in IMG/M
3300031796|Ga0318576_10580170Not Available528Open in IMG/M
3300031823|Ga0307478_10223007All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1524Open in IMG/M
3300031835|Ga0318517_10213138Not Available871Open in IMG/M
3300031846|Ga0318512_10512880Not Available608Open in IMG/M
3300031879|Ga0306919_10657801All Organisms → cellular organisms → Bacteria808Open in IMG/M
3300031890|Ga0306925_11815622Not Available583Open in IMG/M
3300031893|Ga0318536_10077482All Organisms → cellular organisms → Bacteria1644Open in IMG/M
3300031945|Ga0310913_10151875All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces1601Open in IMG/M
3300031946|Ga0310910_10441700All Organisms → cellular organisms → Bacteria1032Open in IMG/M
3300031947|Ga0310909_10201878All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1653Open in IMG/M
3300031947|Ga0310909_11686603Not Available501Open in IMG/M
3300031954|Ga0306926_10619914All Organisms → cellular organisms → Bacteria1319Open in IMG/M
3300031954|Ga0306926_12425648Not Available577Open in IMG/M
3300031962|Ga0307479_10858033All Organisms → cellular organisms → Bacteria882Open in IMG/M
3300031962|Ga0307479_11926524Not Available541Open in IMG/M
3300031981|Ga0318531_10473832Not Available567Open in IMG/M
3300032043|Ga0318556_10564865Not Available594Open in IMG/M
3300032044|Ga0318558_10423371All Organisms → cellular organisms → Bacteria663Open in IMG/M
3300032044|Ga0318558_10572220Not Available564Open in IMG/M
3300032044|Ga0318558_10593463Not Available553Open in IMG/M
3300032054|Ga0318570_10582490All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia510Open in IMG/M
3300032076|Ga0306924_11298125Not Available782Open in IMG/M
3300032893|Ga0335069_12263834Not Available567Open in IMG/M
3300032896|Ga0335075_10664200All Organisms → cellular organisms → Bacteria1012Open in IMG/M
3300033290|Ga0318519_10036413All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2368Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil33.65%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil8.65%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil7.69%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil5.77%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa5.77%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil4.81%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil3.85%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland3.85%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil3.85%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere3.85%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment2.88%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil1.92%
Arctic Peat SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil1.92%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil1.92%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil0.96%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog0.96%
Iron-Sulfur Acid SpringEnvironmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring0.96%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil0.96%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil0.96%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil0.96%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil0.96%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil0.96%
RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere0.96%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere0.96%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300001356Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007EnvironmentalOpen in IMG/M
3300001418Arctic peat soil from Barrow, Alaska - NGEE Surface sample 53-2 shallow-072012EnvironmentalOpen in IMG/M
3300001593Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2EnvironmentalOpen in IMG/M
3300002245Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027)EnvironmentalOpen in IMG/M
3300005181Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127EnvironmentalOpen in IMG/M
3300005439Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaGEnvironmentalOpen in IMG/M
3300005537Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1EnvironmentalOpen in IMG/M
3300005541Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1EnvironmentalOpen in IMG/M
3300005548Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaGHost-AssociatedOpen in IMG/M
3300005602Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2EnvironmentalOpen in IMG/M
3300005610Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3EnvironmentalOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300005921Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6EnvironmentalOpen in IMG/M
3300006175Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaGEnvironmentalOpen in IMG/M
3300006176Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5EnvironmentalOpen in IMG/M
3300009089Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaGEnvironmentalOpen in IMG/M
3300009792Tropical forest soil microbial communities from Panama - MetaG Plot_12EnvironmentalOpen in IMG/M
3300010358Tropical forest soil microbial communities from Panama - MetaG Plot_3EnvironmentalOpen in IMG/M
3300010360Tropical forest soil microbial communities from Panama - MetaG Plot_6EnvironmentalOpen in IMG/M
3300010366Tropical forest soil microbial communities from Panama - MetaG Plot_24EnvironmentalOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300012206Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaGEnvironmentalOpen in IMG/M
3300012929Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300014654Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_10_metaGEnvironmentalOpen in IMG/M
3300016319Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00HEnvironmentalOpen in IMG/M
3300016387Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176EnvironmentalOpen in IMG/M
3300016422Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111EnvironmentalOpen in IMG/M
3300017822Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_2EnvironmentalOpen in IMG/M
3300017823Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3EnvironmentalOpen in IMG/M
3300017933Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_1EnvironmentalOpen in IMG/M
3300017970Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300017973Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MGEnvironmentalOpen in IMG/M
3300017975Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300018060Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MGEnvironmentalOpen in IMG/M
3300018482Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118EnvironmentalOpen in IMG/M
3300020581Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-MEnvironmentalOpen in IMG/M
3300021086Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_1_08_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300021402Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-OEnvironmentalOpen in IMG/M
3300021406Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-OEnvironmentalOpen in IMG/M
3300021407Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-OEnvironmentalOpen in IMG/M
3300022557Paint Pots_combined assemblyEnvironmentalOpen in IMG/M
3300025464Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-3 shallow-072012 (SPAdes)EnvironmentalOpen in IMG/M
3300025928Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026361Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-03-BEnvironmentalOpen in IMG/M
3300027067Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF007 (SPAdes)EnvironmentalOpen in IMG/M
3300027110Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF001 (SPAdes)EnvironmentalOpen in IMG/M
3300027725Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 (SPAdes)EnvironmentalOpen in IMG/M
3300027824Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM3 (SPAdes)EnvironmentalOpen in IMG/M
3300027855Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 (SPAdes)EnvironmentalOpen in IMG/M
3300027875Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027884Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes)EnvironmentalOpen in IMG/M
3300028563Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaGHost-AssociatedOpen in IMG/M
3300028808Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N1_2EnvironmentalOpen in IMG/M
3300028877Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N3_3EnvironmentalOpen in IMG/M
3300030007I_Palsa_E1 coassemblyEnvironmentalOpen in IMG/M
3300030399II_Palsa_E2 coassemblyEnvironmentalOpen in IMG/M
3300030524II_Palsa_N3 coassemblyEnvironmentalOpen in IMG/M
3300030578Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO105-VCO054SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030618II_Palsa_E3 coassemblyEnvironmentalOpen in IMG/M
3300031543Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20EnvironmentalOpen in IMG/M
3300031544Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26EnvironmentalOpen in IMG/M
3300031546Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23EnvironmentalOpen in IMG/M
3300031715Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05EnvironmentalOpen in IMG/M
3300031736Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21EnvironmentalOpen in IMG/M
3300031744Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2)EnvironmentalOpen in IMG/M
3300031764Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f27EnvironmentalOpen in IMG/M
3300031769Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f24EnvironmentalOpen in IMG/M
3300031771Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19EnvironmentalOpen in IMG/M
3300031781Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20EnvironmentalOpen in IMG/M
3300031796Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f24EnvironmentalOpen in IMG/M
3300031823Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05EnvironmentalOpen in IMG/M
3300031835Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f21EnvironmentalOpen in IMG/M
3300031846Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f19EnvironmentalOpen in IMG/M
3300031879Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2)EnvironmentalOpen in IMG/M
3300031890Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2)EnvironmentalOpen in IMG/M
3300031893Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f28EnvironmentalOpen in IMG/M
3300031897Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16EnvironmentalOpen in IMG/M
3300031945Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082EnvironmentalOpen in IMG/M
3300031946Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172EnvironmentalOpen in IMG/M
3300031947Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000HEnvironmentalOpen in IMG/M
3300031954Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2)EnvironmentalOpen in IMG/M
3300031962Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515EnvironmentalOpen in IMG/M
3300031981Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f25EnvironmentalOpen in IMG/M
3300032043Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f24EnvironmentalOpen in IMG/M
3300032044Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f20EnvironmentalOpen in IMG/M
3300032054Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f23EnvironmentalOpen in IMG/M
3300032076Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2)EnvironmentalOpen in IMG/M
3300032893Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1EnvironmentalOpen in IMG/M
3300032896Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.4EnvironmentalOpen in IMG/M
3300033290Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI12269J14319_1028005913300001356Peatlands SoilVQIRLPGRDGLFDIPSAGWAERYPPPTSRRVYAAAH
JGI20188J14859_101394113300001418Arctic Peat SoilMGTLVRLPGRAQPVAIPDPPWAAGYPPPASRRVFAAAH
JGI12635J15846_1009254933300001593Forest SoilMTERISLPGRAEPLEIDPPGWAAGYPPPVSRRAYAA
JGIcombinedJ26739_10066688813300002245Forest SoilMTARIRLPGRPDPLLIPAPSWAGCYSRPASRRVYAAAH
Ga0066678_1036880513300005181SoilMTALIRLPGRARPLVVPDPGWAAGYPAPVSRRVFAAAHVAAHRAAGGREA
Ga0070711_10005490533300005439Corn, Switchgrass And Miscanthus RhizosphereVTARIRLPGRPGPLDIPDPPWARSHPAPTSRRVFAAAHVAAFPDGSI
Ga0070711_10158232323300005439Corn, Switchgrass And Miscanthus RhizosphereMAAQIRLPGRAEPLVIPEPGWAATYPPPSSRRVYAAAHVAAV
Ga0070730_1102940513300005537Surface SoilVPAQIRLPGRDRPLVIPEPGWAGRYPPPRCRRVFAAAHVA
Ga0070733_1047152113300005541Surface SoilVTARISLPGRAEPLEVTGPAWAASYPPPASRRVYAAAHVASVDG
Ga0070665_10243060123300005548Switchgrass RhizosphereVTARIRLPGRPGPLDIPDPPWARSHPAPTSRRVFAAAH
Ga0070762_1125412923300005602SoilVSGTAQIRLPGHKEPLTVSAPGWAASYPPPASRRVY
Ga0070763_1008160633300005610SoilVAAQVQLPGRDEPLVIPEPGWAASYPPPVSRRVFAAAHVAAR
Ga0070763_1068968923300005610SoilVPSNGPAQILLPGRAPEAGPLVIPEPGWAAGYPPPTRRKVFAAAHVAASPSP
Ga0066903_10090986743300005764Tropical Forest SoilMTVHIRLPGRAEPLAIPEPGWARRYLPPVSRRVYAAAHVAARPAADGKR
Ga0070766_1044506613300005921SoilMSELTAQLWLPGRSEPLIVPEPGWTACYPPPVSRRVYAAAHVA
Ga0070712_10065037513300006175Corn, Switchgrass And Miscanthus RhizosphereVVTARIRLPGRASPLAVPEPGWAAGYPPPRSRRVFAAAHVAAAPGPGG
Ga0070765_10128680923300006176SoilMSAQILLPGRAEPLDVPDPGWAAGYPAPTRRSVYAAAHVA
Ga0099828_1020489733300009089Vadose Zone SoilVPAQIRLPGRDRPLVIPEPGWAGRYPPPRRRRVFAAAHVAAAPDGRVDW
Ga0099828_1023079233300009089Vadose Zone SoilMTARIRLPGRPDPLLIPAPSWAGCYSRPASRRVYAAAHVAA
Ga0126374_1000700843300009792Tropical Forest SoilMAAQIRLPGRAEPLVIPEPGWTATYPPPSSRRVYAAAHVAAAPVAARRGDIEID*
Ga0126370_1103476013300010358Tropical Forest SoilMTAQIRLPGRAEPLVIPAPGWAASHSPLTARRAYAAAHVAASPVAGR
Ga0126372_1244248513300010360Tropical Forest SoilMNTEIRLPGRAEPLLITEPGWARGYPPPVSRRVYAAAH
Ga0126379_1134820513300010366Tropical Forest SoilMTVTAQIRLPGRREPLRIADPGWDSREARGYPPPASRSVYAAAHV
Ga0126381_10494685113300010376Tropical Forest SoilMAAQIRLPGRAEPLVVPEPGWAATYPPPSSRRVYAAAHVAAVPA
Ga0137380_1062043223300012206Vadose Zone SoilVPAEIRLPGRDRPLVIPEPGWADHYPPPRRRRVFAAAHVAAAPDGCVDWE
Ga0137404_1109583013300012929Vadose Zone SoilMAARIMLPGRAEPLEITPPGWAPGYPPPVSRRVYAAAHVA
Ga0181525_1038532213300014654BogVAAQVWLPGRDEPLLIPEPGWAASYPPPASRRVFAAAHVAARPASGQPGAGRR
Ga0182033_1048812223300016319SoilVSALIRLPGRAAPLAVPEPGWAAGYPAPRSRRVFAAAHVAAAPGPDGRPV
Ga0182040_1195129713300016387SoilLAAQIRLPGRDRPSVIPEPGWAASYPPPRCRRVFAAAHVAASPDGAID
Ga0182039_1193877313300016422SoilMTAQIRLPGRAGPLTVPDPGWAEGYPAPVSRRVFAAAHVAAR
Ga0187802_1000300213300017822Freshwater SedimentVAVQIRLPGRDGLLEIPSPGWACCYPPPASRRVYAAAHIAARP
Ga0187818_1002581013300017823Freshwater SedimentVAVRIRLPGRDGLLEIPSPGWACCYPPPASRRVYAAAHVAAR
Ga0187801_1002355313300017933Freshwater SedimentVAVRIRLPGRDGLLEIPSPGWACCYPPPASRRVYAAAHVAA
Ga0187783_1129846713300017970Tropical PeatlandVAAQIRLPGRAAPLDIPEPGWAASYPPPTSRRVYAAAHV
Ga0187780_1034546113300017973Tropical PeatlandVNKQVQIALPGRPAPLVIPEPGWAAGYPPPVRRKVFAA
Ga0187782_1072540613300017975Tropical PeatlandMTAQIRLPGRPGPLLIADPGWARGYPPPVSRSAYAAA
Ga0187765_1135948123300018060Tropical PeatlandMTAQIRLPGRREPLLIPDPGWGSDGARGYPPPVSRSAY
Ga0066669_1006108913300018482Grasslands SoilMTALIRLPGRARPLVVPDPGWAAGYPAPVSRRVFAAAHV
Ga0210399_1157670223300020581SoilMTPRISLPGRAEPLEVAAPSWAPGYPPPASRRVYAAAHVASVDGGD
Ga0179596_1034709723300021086Vadose Zone SoilMTARIRLPGRPDPLLIPAPSWAGCYSRPASRRVYAAAHVAASPDG
Ga0210385_1108970113300021402SoilMKGDGATIRLPGRPEPLLVAEPPWERRYPPPVSRSVYAAAHVAATPD
Ga0210386_1002696753300021406SoilMAARIMLPGRAEPLEISSPGWAPGYRPPVSRRVYAAAHVA
Ga0210386_1053861213300021406SoilMAAGARILLPGRSEALTVTSPSWATSYPSPSSRRVYAAAHVAARSGG
Ga0210386_1108516323300021406SoilMGILVSLPGRAQPVAIPDPPWAAGYPPPASRSVFAA
Ga0210383_1155578123300021407SoilVPSNGTARIQLPGRVPGSGPLVIPKPGWAAGYPPPARRKVFAAAHV
Ga0212123_1043789823300022557Iron-Sulfur Acid SpringMLPGRAEPLDIPPPGWAPGYPPPASRRVYAAAHVASQ
Ga0208076_102768723300025464Arctic Peat SoilMGARVSLPGRTQPVDIPDPPWAAGYPPPSSRRVYAAAHVAA
Ga0207700_1004804333300025928Corn, Switchgrass And Miscanthus RhizosphereMAAQIRLPGRAEPLVIPEPGWALSYPPPRSRRVYAAAHVAAAPVTAA
Ga0257176_108900613300026361SoilVSAAIRLPGRREPLLIADPGWDRGYPPPVSRSVYAAAHVAARPSG
Ga0208602_102944123300027067Forest SoilMTASIALPDRAAPLEITPPAWAAGYPPPVSRRVYAAAH
Ga0208488_100606013300027110Forest SoilVQIRLPGRAEPVVVPEPGWAGCYPPPVSRRVYAAAH
Ga0209178_140129813300027725Agricultural SoilVSARITLPGRAAPLDITAPTWAASYPPPASRRVYAAAH
Ga0209040_1051912913300027824Bog Forest SoilMSAQIVLPGRAEPLDVLEPGWAAGYPPPARRSVYAAAHVAANHDGS
Ga0209693_1003032013300027855SoilVSRQIQLPGRDEPLVIPEPGWAASYPPPVSRRVFAAAHVAARPGAARPG
Ga0209283_1029876623300027875Vadose Zone SoilMTARIRLPGRPDPLLIPAPSWAGCYSRPASRRVYA
Ga0209275_1045111523300027884SoilVSRQIQLPGRDEPLVIPEPGWAASYPPPVSRQVFAAAHVAARPASG
Ga0209275_1056902813300027884SoilMSAGISLPGRAAPLEIAPPGWAAAYPPPASRRVYAAAHVASVDS
Ga0265319_104694313300028563RhizosphereMTARISLPGRAEPLEVAAAAWAASYPPPTSRRAYAAAHVASVD
Ga0302228_1006665513300028808PalsaVAAQVLLPGRDEPLVIPEPGWETSYPPPVSRRVFAAAHVAARPGP
Ga0302235_1030419113300028877PalsaMSEVAAQVWLPGRDEPLVIPEPGWAASYPPPVSRRVFAAAH
Ga0311338_1120789323300030007PalsaVTAQIRLPGRAEPLLVADPAWAASYPPPASRRAYAA
Ga0311353_1173482323300030399PalsaMIRQIQLPGRDKPLVIPEPGWAASYPPPVSRRVFAAAHVAARPA
Ga0311357_1036906823300030524PalsaMTARIALPGRAEPLEITRPAWAGAYPPPASRRVYAAAH
Ga0210275_1037245213300030578SoilMTASIRLPGRPGLLEVPEPSWPAGHPAPRSRRVYAAPHVAA
Ga0311354_1039299323300030618PalsaVSARIALPGRAEPLEIAPPGWAAGYPPPASRRVYAA
Ga0318516_1066277313300031543SoilVTAQIRLPGRAEPLEIPEPGWASSYPPPSSRRVFAAAHVAAVS
Ga0318534_1013667923300031544SoilVPALIRLPGRDGPLVIPSPRWAAGYPAPARRKVFAAAHV
Ga0318534_1032524923300031544SoilVTVQIRLPGRPGPLAIPAPGWAPAYPPPASRRVFAAAHV
Ga0318534_1063270213300031544SoilMTAQIRLPGRAGPLTIPDPGWAERYPAPVSRRVFAAAHV
Ga0318538_1026226423300031546SoilMTAQIRLPGRREPLLIADPGWGSRGARGYPPPVSRSVYAAAH
Ga0318538_1072711413300031546SoilMTAQIRLPGRREPLLIADPGWARGYPPPVSRSVYAAAHVAAY
Ga0307476_1065748213300031715Hardwood Forest SoilVTAQIRLPGRVLGPLVIPEPGWAAGYPPPARRKVFAAAHVAASPSPAAGGGGD
Ga0318501_1075471813300031736SoilMQIQLPGRPTPLVVPAHGWAPAYPPPASRRVFAAAHVAA
Ga0306918_1117857223300031744SoilVSALIRLPGRAAPLAVPEPGWAAGYPAPRSRRVFAAAHVAAAPGPD
Ga0318535_1044364123300031764SoilVPALIRLPGRDGPLVIPSPRWAAGYPAPARRKVFAAAHVAAK
Ga0318526_1012690723300031769SoilMSEVAVQIRLPGRAEPLVIPEPGWAVSYPPPASRRVYAAAHVAAAPGAGAGA
Ga0318546_1047877313300031771SoilVTAQIRLPGRAEPLEIPEPGWASSYLPPSSRRVFAAGQPD
Ga0318547_1058786523300031781SoilMAAQIRLPGRAEPLEIPEPGWASSYPPPSSRRVFAAAHVAAVS
Ga0318576_1058017013300031796SoilMTAEIRLPGRREPLLIADPGWDSRGARGYPPPVSRSVYA
Ga0307478_1022300733300031823Hardwood Forest SoilMSAAVSLPGRQAPFEITRPAWAAGYPPPVSRRVFAAAHV
Ga0318517_1021313823300031835SoilMPEMTVQIRLPGRPGPLAVPAPGWAPAYPSPSSRRV
Ga0318512_1051288013300031846SoilMTAQIRLPGRREPLLIADPGWGSRGARGYPPPVTRSVYAAAHVAAYT
Ga0306919_1065780113300031879SoilMAAQIRLPGRAEPLVIPEPEWAATYPPPSSRRVYAAAHVAAAPVVTH
Ga0306925_1181562223300031890SoilVAAQIRLPGRAEPLVVPEPGWAASYPPPLSRRVYAAAHVAAAPVAAHRAAA
Ga0318536_1007748213300031893SoilMAAQIRLPGRAEPLVIPEPGWAATYPPPSSRRVYAAAHVAAGVGIGID
Ga0318520_1020876623300031897SoilVQIQLPGRAGPLVIPAPPWAPGYRPPTSRRVWAAAHVAAVGG
Ga0310913_1015187533300031945SoilMTVQIRLPGRPGPLAVPAPGWAPAYPPPASRRVFAAA
Ga0310910_1044170013300031946SoilMTAQIRMPGRAGPLTVPDPGWAEGYPAPVSRRVFAAAHVAAR
Ga0310909_1020187833300031947SoilVSALIRLPGRAAPLAVPEPGWAAGYPAPRSRRVFAAAHVAAAPG
Ga0310909_1168660323300031947SoilMTAQIRLPGRREPLLIADPGWGSRGARGYPPPVTRSVYA
Ga0306926_1061991423300031954SoilLTAQIWLPGRDARSGPLVILEPGWAACYRPPACRRVYAAAHVAASPGSDGEVID
Ga0306926_1242564823300031954SoilVTAQVWLPGRTEPFVIPEPDWAARYPPPAFRRVYAAAH
Ga0307479_1085803313300031962Hardwood Forest SoilMAVQIRLPGRAELLEIPSPDWALRYPPPTSRRVYAAAHVAARPGPVGEVI
Ga0307479_1192652423300031962Hardwood Forest SoilVAAQMRLPGRAEPLEINDPGWAASYPPPASRRVFAAAHVAATPDV
Ga0318531_1047383213300031981SoilVSALIRLPGRAAPLAVPEPGWAAGYPAPRSRRVFAAA
Ga0318556_1056486523300032043SoilVTAQVWLPGRTEPFVIPEPDWAARYPPPAFRRVYAAAHVAASPGRD
Ga0318558_1042337113300032044SoilMTAQIRLPGRREPLLIADPGWGSRGARGYPPPVTRSVYAAAHVAARPG
Ga0318558_1057222023300032044SoilVQIRLPGRPGPLAVPAPGWAPAYPPPASRRVFAAA
Ga0318558_1059346323300032044SoilMTAQIRLPGRREPLLIADPGWGSHGARGYPPPVSRSAYAAAHV
Ga0318570_1058249023300032054SoilMPEMTVQIRLPGRPGPLAVPAPGWAPAYPSPASRRVFAAAHVAAVG
Ga0306924_1129812513300032076SoilMPKVAAAIQLPGRAGPLVISPPPWAPGYPPPASRRVWAAA
Ga0335069_1226383413300032893SoilMTATIVLPGRAEPLEITAPGWAAGYPQPVSRRVYAAAHV
Ga0335075_1066420023300032896SoilVAATIRLPGRDQPLVIPAPGWARSYPPPSLRRVYAAAHVAALDADTVDWD
Ga0318519_1003641313300033290SoilMTVQIRLPGRPGPLAVPAPGWAPAYPSPASRRVFAAAHVAAVGG


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.