Metagenome / Metatranscriptome Family F097716

Basic Information
Family ID	F097716
Family Type	Metagenome / Metatranscriptome
Number of Sequences	104
Average Sequence Length	44 residues
Representative Sequence	HAKAKGVSATWLPVPGGAHTDAWAQPAIISQIFDFFDAHKTKMK
Number of Associated Samples	86
Number of Associated Scaffolds	104

Quality Assessment
Transcriptomic Evidence	Yes
Most common taxonomic group	Bacteria
% of genes with valid RBS motifs	1.92 %
% of genes near scaffold ends (potentially truncated)	96.15 %
% of genes from short scaffolds (< 2000 bps)	94.23 %
Associated GOLD sequencing projects	84
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.36

Most Common Taxonomy
Group	Bacteria (71.154 % of family members)
NCBI Taxonomy ID	2
Taxonomy	All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (9.615 % of family members)
Environment Ontology (ENVO)	Unclassified (41.346 % of family members)
Earth Microbiome Project Ontology (EMPO)	Host-associated → Plant → Plant rhizosphere (51.923 % of family members)

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Predicted Topology & Secondary Structure
Classification:	Globular	Signal Peptide:	Yes	Secondary Structure distribution:	α-helix: 22.22% β-sheet: 0.00% Coil/Unstructured: 77.78%
Feature Viewer

Powered by Feature Viewer

Pfam ID	Name	% Frequency in 104 Family Scaffolds
PF08714	Fae	9.62
PF01968	Hydantoinase_A	7.69
PF00557	Peptidase_M24	6.73
PF02416	TatA_B_E	2.88
PF01979	Amidohydro_1	1.92
PF12802	MarR_2	1.92
PF12680	SnoaL_2	1.92
PF00174	Oxidored_molyb	1.92
PF13360	PQQ_2	1.92
PF00266	Aminotran_5	1.92
PF05988	DUF899	1.92
PF13421	Band_7_1	0.96
PF00581	Rhodanese	0.96
PF08281	Sigma70_r4_2	0.96
PF09176	Mpt_N	0.96
PF04542	Sigma70_r2	0.96
PF12796	Ank_2	0.96
PF02900	LigB	0.96
PF01322	Cytochrom_C_2	0.96
PF03372	Exo_endo_phos	0.96
PF01408	GFO_IDH_MocA	0.96
PF10503	Esterase_PHB	0.96
PF06964	Alpha-L-AF_C	0.96
PF01965	DJ-1_PfpI	0.96
PF07676	PD40	0.96
PF00529	CusB_dom_1	0.96
PF02518	HATPase_c	0.96
PF05569	Peptidase_M56	0.96
PF08241	Methyltransf_11	0.96
PF13505	OMP_b-brl	0.96
PF01139	RtcB	0.96
PF12697	Abhydrolase_6	0.96
PF07690	MFS_1	0.96
PF09587	PGA_cap	0.96

COG ID	Name	Functional Category	% Frequency in 104 Family Scaffolds
COG1795	Formaldehyde-activating enzyme (5,6,7,8-tetrahydromethanopterin hydrolyase)	Energy production and conversion [C]	9.62
COG1826	Twin-arginine protein secretion pathway components TatA and TatB	Intracellular trafficking, secretion, and vesicular transport [U]	2.88
COG2041	Molybdopterin-dependent catalytic subunit of periplasmic DMSO/TMAO and protein-methionine-sulfoxide reductases	Energy production and conversion [C]	1.92
COG3915	Uncharacterized conserved protein	Function unknown [S]	1.92
COG4312	Predicted dithiol-disulfide oxidoreductase, DUF899 family	General function prediction only [R]	1.92
COG0568	DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32)	Transcription [K]	0.96
COG1191	DNA-directed RNA polymerase specialized sigma subunit	Transcription [K]	0.96
COG1595	DNA-directed RNA polymerase specialized sigma subunit, sigma24 family	Transcription [K]	0.96
COG1690	RNA-splicing ligase RtcB, repairs tRNA damage	Translation, ribosomal structure and biogenesis [J]	0.96
COG3534	Alpha-L-arabinofuranosidase	Carbohydrate transport and metabolism [G]	0.96
COG3909	Cytochrome c556	Energy production and conversion [C]	0.96
COG4941	Predicted RNA polymerase sigma factor, contains C-terminal TPR domain	Transcription [K]	0.96

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	71.15 %
Unclassified	root	N/A	28.85 %

Name	Rank	Taxonomy	Distribution
cellular organisms	root	All Organisms → cellular organisms	71.15 %
Unclassified	root	N/A	28.85 %

Name	Rank	Taxonomy	Distribution
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	71.15 %
Unclassified	root	N/A	28.85 %

Name	Rank	Taxonomy	Distribution
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	29.81 %
Unclassified	root	N/A	28.85 %
Acidobacteria	phylum	All Organisms → cellular organisms → Bacteria → Acidobacteria	12.50 %
PVC group	clade	All Organisms → cellular organisms → Bacteria → PVC group	1.92 %
Terrabacteria group	clade	All Organisms → cellular organisms → Bacteria → Terrabacteria group	1.92 %
FCB group	clade	All Organisms → cellular organisms → Bacteria → FCB group	0.96 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	28.85 %
Alphaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	21.15 %
unclassified Acidobacteria	no rank	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria	8.65 %
Acidobacteriia	class	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia	2.88 %
Actinobacteria	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	1.92 %
Planctomycetes	phylum	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes	1.92 %
Gemmatimonadetes	phylum	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes	0.96 %
delta/epsilon subdivisions	subphylum	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions	0.96 %
Gammaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	0.96 %
unclassified Proteobacteria	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria	0.96 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	28.85 %
Sphingomonadales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales	18.27 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	8.65 %
Hyphomicrobiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	2.88 %
Planctomycetia	class	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia	1.92 %
Bryobacterales	order	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales	1.92 %
Proteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium	0.96 %
unclassified Gemmatimonadetes	no rank	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes	0.96 %
Deltaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	0.96 %
Actinomycetia	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	0.96 %
Acidobacteriales	order	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales	0.96 %
Gammaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	0.96 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	28.85 %
unclassified Sphingomonadales	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → unclassified Sphingomonadales	18.27 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	8.65 %
Pirellulales	order	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales	1.92 %
Solibacteraceae	family	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae	0.96 %
Gemmatimonadetes bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	0.96 %
Bryobacteraceae	family	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae	0.96 %
Bradyrhizobiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	0.96 %
Rhizobiaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae	0.96 %
Propionibacteriales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales	0.96 %
Acidobacteriaceae	family	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae	0.96 %
Methylobacteriaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae	0.96 %
Myxococcales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales	0.96 %
Proteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium	0.96 %
Gammaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	0.96 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	28.85 %
Sphingomonadales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → unclassified Sphingomonadales → Sphingomonadales bacterium	18.27 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	8.65 %
Pirellulaceae	family	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Pirellulaceae	1.92 %
Candidatus Solibacter	genus	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter	0.96 %
Paludibaculum	genus	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Paludibaculum	0.96 %
Methylobacterium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Methylobacterium	0.96 %
Bradyrhizobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	0.96 %
Rhizobium/Agrobacterium group	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Rhizobium/Agrobacterium group	0.96 %
Nannocystineae	suborder	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Nannocystineae	0.96 %
Nocardioidaceae	family	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae	0.96 %
Gemmatimonadetes bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	0.96 %
Acidobacteriaceae	family	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae	0.96 %
Proteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium	0.96 %
Gammaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	0.96 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	28.85 %
Sphingomonadales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → unclassified Sphingomonadales → Sphingomonadales bacterium	18.27 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	8.65 %
Anatilimnocola	genus	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Pirellulaceae → Anatilimnocola	1.92 %
Candidatus Solibacter usitatus	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus	0.96 %
Paludibaculum fermentans	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Paludibaculum → Paludibaculum fermentans	0.96 %
Nocardioides	genus	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides	0.96 %
Rhizobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Rhizobium/Agrobacterium group → Rhizobium	0.96 %
Kofleriaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Nannocystineae → Kofleriaceae	0.96 %
Methylobacterium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Methylobacterium	0.96 %
Bradyrhizobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	0.96 %
Gemmatimonadetes bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	0.96 %
Acidobacteriaceae	family	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae	0.96 %
Proteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium	0.96 %
Gammaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	0.96 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	28.85 %
Sphingomonadales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → unclassified Sphingomonadales → Sphingomonadales bacterium	18.27 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	8.65 %
Anatilimnocola floriformis	species	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Pirellulaceae → Anatilimnocola → Anatilimnocola floriformis	1.92 %
unclassified Rhizobium	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Rhizobium/Agrobacterium group → Rhizobium → unclassified Rhizobium	0.96 %
Candidatus Solibacter usitatus Ellin6076	isolate	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus → Candidatus Solibacter usitatus Ellin6076	0.96 %
Haliangium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Nannocystineae → Kofleriaceae → Haliangium	0.96 %
Paludibaculum fermentans	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Paludibaculum → Paludibaculum fermentans	0.96 %
Nocardioides	genus	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides	0.96 %
Methylobacterium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Methylobacterium	0.96 %
Bradyrhizobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	0.96 %
Gemmatimonadetes bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	0.96 %
Acidobacteriaceae	family	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae	0.96 %
Proteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium	0.96 %
Gammaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	0.96 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	28.85 %
Sphingomonadales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → unclassified Sphingomonadales → Sphingomonadales bacterium	18.27 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	8.65 %
Anatilimnocola floriformis	species	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Pirellulaceae → Anatilimnocola → Anatilimnocola floriformis	1.92 %
Rhizobium sp. NZLR8	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Rhizobium/Agrobacterium group → Rhizobium → unclassified Rhizobium → Rhizobium sp. NZLR8	0.96 %
unclassified Haliangium	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Nannocystineae → Kofleriaceae → Haliangium → unclassified Haliangium	0.96 %
Candidatus Solibacter usitatus Ellin6076	isolate	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus → Candidatus Solibacter usitatus Ellin6076	0.96 %
Paludibaculum fermentans	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Paludibaculum → Paludibaculum fermentans	0.96 %
Nocardioides	genus	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides	0.96 %
Methylobacterium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Methylobacterium	0.96 %
Bradyrhizobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	0.96 %
Gemmatimonadetes bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	0.96 %
Acidobacteriaceae	family	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae	0.96 %
Proteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium	0.96 %
Gammaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	0.96 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	28.85 %
Sphingomonadales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → unclassified Sphingomonadales → Sphingomonadales bacterium	18.27 %
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	8.65 %
Anatilimnocola floriformis	species	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Pirellulaceae → Anatilimnocola → Anatilimnocola floriformis	1.92 %
Haliangium sp. UPWRP_2	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Nannocystineae → Kofleriaceae → Haliangium → unclassified Haliangium → Haliangium sp. UPWRP_2	0.96 %
Rhizobium sp. NZLR8	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Rhizobium/Agrobacterium group → Rhizobium → unclassified Rhizobium → Rhizobium sp. NZLR8	0.96 %
Candidatus Solibacter usitatus Ellin6076	isolate	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus → Candidatus Solibacter usitatus Ellin6076	0.96 %
Paludibaculum fermentans	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Paludibaculum → Paludibaculum fermentans	0.96 %
Nocardioides	genus	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides	0.96 %
Methylobacterium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Methylobacterium	0.96 %
Bradyrhizobium	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	0.96 %
Gemmatimonadetes bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	0.96 %
Acidobacteriaceae	family	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae	0.96 %
Proteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium	0.96 %
Gammaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	0.96 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
2088090015\|GPICI_9131986	All Organisms → cellular organisms → Bacteria → Proteobacteria	1809	Open in IMG/M
3300002568\|C688J35102_119905595	Not Available	809	Open in IMG/M
3300005334\|Ga0068869_101599444	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → unclassified Sphingomonadales → Sphingomonadales bacterium	580	Open in IMG/M
3300005337\|Ga0070682_100368775	Not Available	1076	Open in IMG/M
3300005344\|Ga0070661_101405721	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → unclassified Sphingomonadales → Sphingomonadales bacterium	587	Open in IMG/M
3300005355\|Ga0070671_101983902	All Organisms → cellular organisms → Bacteria	518	Open in IMG/M
3300005356\|Ga0070674_102058672	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → unclassified Sphingomonadales → Sphingomonadales bacterium	520	Open in IMG/M
3300005366\|Ga0070659_101103883	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → unclassified Sphingomonadales → Sphingomonadales bacterium	699	Open in IMG/M
3300005435\|Ga0070714_101838220	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → unclassified Sphingomonadales → Sphingomonadales bacterium	591	Open in IMG/M
3300005456\|Ga0070678_101846963	Not Available	570	Open in IMG/M
3300005530\|Ga0070679_100600332	All Organisms → cellular organisms → Bacteria	1044	Open in IMG/M
3300005539\|Ga0068853_100389147	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → unclassified Sphingomonadales → Sphingomonadales bacterium	1303	Open in IMG/M
3300005577\|Ga0068857_101336845	Not Available	696	Open in IMG/M
3300005764\|Ga0066903_107464751	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	564	Open in IMG/M
3300005840\|Ga0068870_11058957	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium	581	Open in IMG/M
3300005841\|Ga0068863_100719455	Not Available	993	Open in IMG/M
3300005841\|Ga0068863_102145308	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → unclassified Sphingomonadales → Sphingomonadales bacterium	569	Open in IMG/M
3300005844\|Ga0068862_101796737	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → unclassified Sphingomonadales → Sphingomonadales bacterium	622	Open in IMG/M
3300006176\|Ga0070765_100613638	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → unclassified Sphingomonadales → Sphingomonadales bacterium	1026	Open in IMG/M
3300006237\|Ga0097621_100378012	All Organisms → cellular organisms → Bacteria	1265	Open in IMG/M
3300006237\|Ga0097621_101029259	All Organisms → cellular organisms → Bacteria	771	Open in IMG/M
3300006914\|Ga0075436_100986694	All Organisms → cellular organisms → Bacteria	632	Open in IMG/M
3300007004\|Ga0079218_10885285	Not Available	874	Open in IMG/M
3300007004\|Ga0079218_12377039	Not Available	622	Open in IMG/M
3300009156\|Ga0111538_11150069	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	981	Open in IMG/M
3300009162\|Ga0075423_10155408	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → unclassified Sphingomonadales → Sphingomonadales bacterium	2401	Open in IMG/M
3300009176\|Ga0105242_10181889	All Organisms → cellular organisms → Bacteria	1855	Open in IMG/M
3300009176\|Ga0105242_11570576	Not Available	691	Open in IMG/M
3300009177\|Ga0105248_10465182	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	1426	Open in IMG/M
3300009177\|Ga0105248_12871302	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	549	Open in IMG/M
3300009553\|Ga0105249_11997147	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	653	Open in IMG/M
3300009553\|Ga0105249_12023016	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	649	Open in IMG/M
3300009792\|Ga0126374_11807940	All Organisms → cellular organisms → Bacteria	511	Open in IMG/M
3300010048\|Ga0126373_12039156	Not Available	636	Open in IMG/M
3300010360\|Ga0126372_11385602	All Organisms → cellular organisms → Bacteria	735	Open in IMG/M
3300010396\|Ga0134126_10475087	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	1444	Open in IMG/M
3300010398\|Ga0126383_13669139	All Organisms → cellular organisms → Bacteria	501	Open in IMG/M
3300010399\|Ga0134127_11547602	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Pirellulaceae → Anatilimnocola → Anatilimnocola floriformis	736	Open in IMG/M
3300010399\|Ga0134127_12998590	All Organisms → cellular organisms → Bacteria → Proteobacteria	550	Open in IMG/M
3300010400\|Ga0134122_13160314	Not Available	516	Open in IMG/M
3300010403\|Ga0134123_11790463	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	667	Open in IMG/M
3300010880\|Ga0126350_11670779	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → unclassified Sphingomonadales → Sphingomonadales bacterium	696	Open in IMG/M
3300012212\|Ga0150985_103468208	Not Available	615	Open in IMG/M
3300012212\|Ga0150985_115838317	Not Available	522	Open in IMG/M
3300012898\|Ga0157293_10045217	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Nannocystineae → Kofleriaceae → Haliangium → unclassified Haliangium → Haliangium sp. UPWRP_2	956	Open in IMG/M
3300012907\|Ga0157283_10128683	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Methylobacterium	718	Open in IMG/M
3300012971\|Ga0126369_11634713	All Organisms → cellular organisms → Bacteria	734	Open in IMG/M
3300012975\|Ga0134110_10236497	Not Available	775	Open in IMG/M
3300013296\|Ga0157374_10648479	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → unclassified Sphingomonadales → Sphingomonadales bacterium	1068	Open in IMG/M
3300013308\|Ga0157375_12988681	Not Available	565	Open in IMG/M
3300014325\|Ga0163163_11813813	Not Available	670	Open in IMG/M
3300015200\|Ga0173480_11272038	Not Available	501	Open in IMG/M
3300015371\|Ga0132258_10892104	All Organisms → cellular organisms → Bacteria	2245	Open in IMG/M
3300015371\|Ga0132258_12447259	All Organisms → cellular organisms → Bacteria → Proteobacteria	1307	Open in IMG/M
3300015373\|Ga0132257_100483796	All Organisms → cellular organisms → Bacteria	1516	Open in IMG/M
3300015373\|Ga0132257_103508744	All Organisms → cellular organisms → Bacteria	571	Open in IMG/M
3300015373\|Ga0132257_103938458	Not Available	540	Open in IMG/M
3300016357\|Ga0182032_11873667	All Organisms → cellular organisms → Bacteria → Acidobacteria	525	Open in IMG/M
3300017792\|Ga0163161_11290791	Not Available	634	Open in IMG/M
3300017792\|Ga0163161_11386156	Not Available	614	Open in IMG/M
3300018476\|Ga0190274_11433733	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Pirellulaceae → Anatilimnocola → Anatilimnocola floriformis	780	Open in IMG/M
3300018476\|Ga0190274_13793454	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Paludibaculum → Paludibaculum fermentans	511	Open in IMG/M
3300019362\|Ga0173479_10054293	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → unclassified Sphingomonadales → Sphingomonadales bacterium	1328	Open in IMG/M
3300020000\|Ga0193692_1012690	All Organisms → cellular organisms → Bacteria	2057	Open in IMG/M
3300021170\|Ga0210400_10531584	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae	970	Open in IMG/M
3300021433\|Ga0210391_10773267	All Organisms → cellular organisms → Bacteria → Proteobacteria	751	Open in IMG/M
3300021475\|Ga0210392_10672544	Not Available	770	Open in IMG/M
3300022886\|Ga0247746_1193893	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → unclassified Sphingomonadales → Sphingomonadales bacterium	531	Open in IMG/M
3300025321\|Ga0207656_10748314	Not Available	501	Open in IMG/M
3300025907\|Ga0207645_10004899	All Organisms → cellular organisms → Bacteria	9818	Open in IMG/M
3300025923\|Ga0207681_10016388	All Organisms → cellular organisms → Bacteria → Proteobacteria	4636	Open in IMG/M
3300025923\|Ga0207681_10412825	All Organisms → cellular organisms → Bacteria	1092	Open in IMG/M
3300025923\|Ga0207681_10495327	Not Available	1000	Open in IMG/M
3300025926\|Ga0207659_11232618	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → unclassified Sphingomonadales → Sphingomonadales bacterium	643	Open in IMG/M
3300025931\|Ga0207644_10657677	All Organisms → cellular organisms → Bacteria	872	Open in IMG/M
3300025937\|Ga0207669_10326840	Not Available	1176	Open in IMG/M
3300025937\|Ga0207669_11869370	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → unclassified Sphingomonadales → Sphingomonadales bacterium	513	Open in IMG/M
3300025945\|Ga0207679_10176247	Not Available	1765	Open in IMG/M
3300025945\|Ga0207679_12057905	All Organisms → cellular organisms → Bacteria	519	Open in IMG/M
3300025960\|Ga0207651_11271574	Not Available	661	Open in IMG/M
3300026075\|Ga0207708_11656386	All Organisms → cellular organisms → Bacteria	562	Open in IMG/M
3300027717\|Ga0209998_10078835	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	796	Open in IMG/M
3300027853\|Ga0209274_10579493	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Rhizobium/Agrobacterium group → Rhizobium → unclassified Rhizobium → Rhizobium sp. NZLR8	581	Open in IMG/M
3300027874\|Ga0209465_10662001	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → unclassified Sphingomonadales → Sphingomonadales bacterium	514	Open in IMG/M
3300027910\|Ga0209583_10257021	All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium	773	Open in IMG/M
3300031184\|Ga0307499_10230284	All Organisms → cellular organisms → Bacteria	583	Open in IMG/M
3300031366\|Ga0307506_10440245	Not Available	542	Open in IMG/M
3300031708\|Ga0310686_117142440	Not Available	755	Open in IMG/M
3300031720\|Ga0307469_11590954	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	628	Open in IMG/M
3300031854\|Ga0310904_11080567	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	574	Open in IMG/M
3300031890\|Ga0306925_11747104	All Organisms → cellular organisms → Bacteria	598	Open in IMG/M
3300031912\|Ga0306921_11961048	All Organisms → cellular organisms → Bacteria	625	Open in IMG/M
3300032002\|Ga0307416_103685020	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → unclassified Sphingomonadales → Sphingomonadales bacterium	513	Open in IMG/M
3300032005\|Ga0307411_11168087	Not Available	697	Open in IMG/M
3300032009\|Ga0318563_10258016	All Organisms → cellular organisms → Bacteria	942	Open in IMG/M
3300032013\|Ga0310906_10436915	Not Available	873	Open in IMG/M
3300032074\|Ga0308173_11526413	Not Available	628	Open in IMG/M
3300032074\|Ga0308173_11716770	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → unclassified Sphingomonadales → Sphingomonadales bacterium	591	Open in IMG/M
3300032075\|Ga0310890_10513616	All Organisms → cellular organisms → Bacteria → Proteobacteria	913	Open in IMG/M
3300032205\|Ga0307472_100422800	All Organisms → cellular organisms → Bacteria	1123	Open in IMG/M
3300032211\|Ga0310896_10003727	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus → Candidatus Solibacter usitatus Ellin6076	4300	Open in IMG/M
3300033433\|Ga0326726_11853647	All Organisms → cellular organisms → Bacteria	587	Open in IMG/M
3300034160\|Ga0370510_0115541	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides	817	Open in IMG/M
3300034663\|Ga0314784_176310	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	500	Open in IMG/M

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Environmental	Environmental	51.92%
Host-Associated	Host-Associated	48.08%

Habitat	Taxonomy	Distribution
Terrestrial	Environmental → Terrestrial	50.96%
Plants	Host-Associated → Plants	48.08%
Aquatic	Environmental → Aquatic	0.96%

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil	50.00%
Rhizosphere	Host-Associated → Plants → Rhizosphere	26.92%
Rhizoplane	Host-Associated → Plants → Rhizoplane	18.27%
Roots	Host-Associated → Plants → Roots	2.88%
Sediment	Environmental → Aquatic → Sediment	0.96%
Peat	Environmental → Terrestrial → Peat	0.96%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified	40.38%
Soil	Host-Associated → Plants → Rhizosphere → Soil	14.42%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	12.50%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	10.58%
Loam	Environmental → Terrestrial → Soil → Loam	8.65%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified	6.73%
Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere	2.88%
Unclassified	Environmental → Aquatic → Sediment → Unclassified	0.96%
Wetlands	Environmental → Terrestrial → Soil → Wetlands	0.96%
Unclassified	Environmental → Terrestrial → Peat → Unclassified	0.96%
Soil	Host-Associated → Plants → Rhizoplane → Soil	0.96%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified → Unclassified	21.15%
Unclassified	Host-Associated → Plants → Rhizosphere → Soil → Unclassified	14.42%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	12.50%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	10.58%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil	8.65%
Agricultural	Environmental → Terrestrial → Soil → Unclassified → Agricultural	6.73%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified	6.73%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil	3.85%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil	3.85%
Agricultural Land	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land	2.88%
Soil	Host-Associated → Plants → Roots → Rhizosphere → Soil	2.88%
Unclassified	Environmental → Aquatic → Sediment → Unclassified → Unclassified	0.96%
Grasslands	Environmental → Terrestrial → Soil → Unclassified → Grasslands	0.96%
Unclassified	Environmental → Terrestrial → Soil → Wetlands → Unclassified	0.96%
Grasslands	Environmental → Terrestrial → Soil → Loam → Grasslands	0.96%
Unclassified	Environmental → Terrestrial → Peat → Unclassified → Unclassified	0.96%
Unclassified	Host-Associated → Plants → Rhizoplane → Soil → Unclassified	0.96%

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	9.62%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil	6.73%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere	5.77%
Terrestrial Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil	4.81%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil	4.81%
Arabidopsis Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere	4.81%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere	4.81%
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	3.85%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere	3.85%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere	3.85%
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	2.88%
Corn Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere	2.88%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	2.88%
Populus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere	2.88%
Agricultural Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil	1.92%
Hardwood Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil	1.92%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil	1.92%
Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil	1.92%
Corn Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere	1.92%
Avena Fatua Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere	1.92%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere	1.92%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	1.92%
Miscanthus Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere	1.92%
Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere	1.92%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	1.92%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	1.92%
Watersheds	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds	0.96%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil	0.96%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil	0.96%
Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil	0.96%
Untreated Peat Soil	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil	0.96%
Soil	Environmental → Terrestrial → Soil → Loam → Grasslands → Soil	0.96%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere	0.96%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil	0.96%
Peat Soil	Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil	0.96%
Arabidopsis Thaliana Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere	0.96%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere	0.96%
Switchgrass Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere	0.96%
Boreal Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil	0.96%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
2088090015	Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil	Environmental	Open in IMG/M
3300002568	Grasslands soil microbial communities from Hopland, California, USA - 2	Environmental	Open in IMG/M
3300005334	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2	Host-Associated	Open in IMG/M
3300005337	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG	Environmental	Open in IMG/M
3300005344	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG	Host-Associated	Open in IMG/M
3300005355	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG	Host-Associated	Open in IMG/M
3300005356	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG	Host-Associated	Open in IMG/M
3300005366	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG	Host-Associated	Open in IMG/M
3300005435	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG	Environmental	Open in IMG/M
3300005456	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG	Host-Associated	Open in IMG/M
3300005530	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG	Environmental	Open in IMG/M
3300005539	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2	Host-Associated	Open in IMG/M
3300005577	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2	Host-Associated	Open in IMG/M
3300005764	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)	Environmental	Open in IMG/M
3300005840	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2	Host-Associated	Open in IMG/M
3300005841	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2	Host-Associated	Open in IMG/M
3300005844	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2	Host-Associated	Open in IMG/M
3300006176	Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5	Environmental	Open in IMG/M
3300006237	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2)	Host-Associated	Open in IMG/M
3300006914	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5	Host-Associated	Open in IMG/M
3300007004	Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost	Environmental	Open in IMG/M
3300009156	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)	Host-Associated	Open in IMG/M
3300009162	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2	Host-Associated	Open in IMG/M
3300009176	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG	Host-Associated	Open in IMG/M
3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Host-Associated	Open in IMG/M
3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Host-Associated	Open in IMG/M
3300009792	Tropical forest soil microbial communities from Panama - MetaG Plot_12	Environmental	Open in IMG/M
3300010048	Tropical forest soil microbial communities from Panama - MetaG Plot_11	Environmental	Open in IMG/M
3300010360	Tropical forest soil microbial communities from Panama - MetaG Plot_6	Environmental	Open in IMG/M
3300010396	Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2	Environmental	Open in IMG/M
3300010398	Tropical forest soil microbial communities from Panama - MetaG Plot_35	Environmental	Open in IMG/M
3300010399	Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3	Environmental	Open in IMG/M
3300010400	Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2	Environmental	Open in IMG/M
3300010403	Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3	Environmental	Open in IMG/M
3300010880	Boreal forest soil eukaryotic communities from Alaska, USA - C5-1 Metatranscriptome (Eukaryote Community Metatranscriptome)	Environmental	Open in IMG/M
3300012212	Combined assembly of Hopland grassland soil	Host-Associated	Open in IMG/M
3300012898	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S194-509B-1	Environmental	Open in IMG/M
3300012907	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S044-104R-1	Environmental	Open in IMG/M
3300012971	Tropical forest soil microbial communities from Panama - MetaG Plot_1	Environmental	Open in IMG/M
3300012975	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_11112015	Environmental	Open in IMG/M
3300013296	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG	Host-Associated	Open in IMG/M
3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Host-Associated	Open in IMG/M
3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Host-Associated	Open in IMG/M
3300015200	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S209-509C-1 (version 2)	Environmental	Open in IMG/M
3300015371	Combined assembly of cpr5 and col0 rhizosphere and soil	Host-Associated	Open in IMG/M
3300015373	Combined assembly of cpr5 rhizosphere	Host-Associated	Open in IMG/M
3300016357	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000	Environmental	Open in IMG/M
3300017792	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG	Host-Associated	Open in IMG/M
3300018476	Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T	Environmental	Open in IMG/M
3300019362	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S104-311B-1 (version 2)	Environmental	Open in IMG/M
3300020000	Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3a1	Environmental	Open in IMG/M
3300021170	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M	Environmental	Open in IMG/M
3300021433	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O	Environmental	Open in IMG/M
3300021475	Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O	Environmental	Open in IMG/M
3300022886	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S079-202R-5	Environmental	Open in IMG/M
3300025321	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes)	Host-Associated	Open in IMG/M
3300025907	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025923	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025926	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025937	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025945	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025960	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300026075	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes)	Environmental	Open in IMG/M
3300027717	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes)	Host-Associated	Open in IMG/M
3300027853	Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 (SPAdes)	Environmental	Open in IMG/M
3300027874	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes)	Environmental	Open in IMG/M
3300027910	Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 (SPAdes)	Environmental	Open in IMG/M
3300031184	Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 13_S	Environmental	Open in IMG/M
3300031366	Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 25_S	Environmental	Open in IMG/M
3300031708	FICUS49499 Metagenome Czech Republic combined assembly	Environmental	Open in IMG/M
3300031720	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515	Environmental	Open in IMG/M
3300031854	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D1	Environmental	Open in IMG/M
3300031890	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2)	Environmental	Open in IMG/M
3300031912	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2)	Environmental	Open in IMG/M
3300032002	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3	Host-Associated	Open in IMG/M
3300032005	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1	Host-Associated	Open in IMG/M
3300032009	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f19	Environmental	Open in IMG/M
3300032013	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D3	Environmental	Open in IMG/M
3300032074	Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R1	Environmental	Open in IMG/M
3300032075	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3	Environmental	Open in IMG/M
3300032205	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05	Environmental	Open in IMG/M
3300032211	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D1	Environmental	Open in IMG/M
3300033433	Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MN	Environmental	Open in IMG/M
3300034160	Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_03S_18	Environmental	Open in IMG/M
3300034663	Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20R1 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.36
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.36
Powered by PDBe Molstar

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome / Metatranscriptome Family F097716

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Gene Neighborhood

Neighboring Pfam domains

Neighboring Clusters of Orthologous Genes (COGs)

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
GPICI_03059410	2088090015	Soil	VNAMWLPVPGGAHTDAWAQPAIIGQIFDFFDAHKTKMK
C688J35102_1199055951	3300002568	Soil	VDHAKAKGVTVTWLPVIGGQHVDAWAQPEILKQTFDFFDKYKAKQK*
Ga0068869_1015994441	3300005334	Miscanthus Rhizosphere	KAKGIDATWLPVPGGAHTDAWAQQEILNKTFDFFDAHKTKLK*
Ga0070682_1003687752	3300005337	Corn Rhizosphere	AKAKGLNVTWLPVVGGQHVDAWAQPEILKQTFDFFDKYKTKQK*
Ga0070661_1014057211	3300005344	Corn Rhizosphere	HAKAKGVNATWLPVVGGMHTDAWAQPEIISQIFDFFDKYRKK*
Ga0070671_1019839021	3300005355	Switchgrass Rhizosphere	ASKTMVDHAKAKGVDATWLPVPGGMHTDAWAQPEIVTKIFDFFDAHARR*
Ga0070674_1020586722	3300005356	Miscanthus Rhizosphere	DHAKAKGIDATWLPVPGGAHTDAWAQQEILNKTFDFFDAHKTKLK*
Ga0070659_1011038831	3300005366	Corn Rhizosphere	KAKGVAATWLPVTGGMHTDAWAQPEVIKQIFDFFDAHKKKG*
Ga0070714_1018382201	3300005435	Agricultural Soil	DASKTMVDHAKAQGVDATWLPVIGGAHVDAWAQPEVIKQIFDFFDANKKKG*
Ga0070678_1018469632	3300005456	Miscanthus Rhizosphere	VDRAKAKGITITFLPVQGGMHTDAWAQPEIIKQIFDFFDAHKTKTK*
Ga0070679_1006003321	3300005530	Corn Rhizosphere	HAKAKGVAATWLPVTGGMHTDAWAQPEVIKQIFDFFDAHKKKG*
Ga0068853_1003891471	3300005539	Corn Rhizosphere	MVDHAKAKGVDATWLPVIGGTHIDAWAQPEILEQTFDFFDAHKKKG*
Ga0068857_1013368452	3300005577	Corn Rhizosphere	SKAMVDHAKAKGVDATWLPVVGGAHTDAWAQPDVIKQIFDFFDAHKKS*
Ga0066903_1074647512	3300005764	Tropical Forest Soil	HAKAKGVDATWLPVPGGAHTDAWAQQEILNKTFDFFDAHKTKAK*
Ga0068870_110589571	3300005840	Miscanthus Rhizosphere	KAMIDRAKAKGVNATFLGVAGGQHTDAWAQPEVIKQIFDFFDANKTKLK*
Ga0068863_1007194551	3300005841	Switchgrass Rhizosphere	VTWLPVIGGAHVDAWAQPEIIKQTFDFFDKNATKKK*
Ga0068863_1021453081	3300005841	Switchgrass Rhizosphere	VEHAKAKGVDATWLPVEGGMHTDAWAQPAVIEKIFDFFDAHKKHL*
Ga0068862_1017967372	3300005844	Switchgrass Rhizosphere	QHAKAKGVNATWLPVPGGAHTDAWAQPAIIGQIFDFFDAHRTKTR*
Ga0070765_1006136381	3300006176	Soil	MVDHARAKGIDATWLPVAGGMHTDAWAQPEIIKQIFDFFDRHPTKAK*
Ga0097621_1003780124	3300006237	Miscanthus Rhizosphere	MIDRAKAKGVNATFLGVAGGQHTDAWAQPEVIKQIFDFFDANKTKLK*
Ga0097621_1010292591	3300006237	Miscanthus Rhizosphere	FLGVQGGQHTDAWAQPDIIKQVFDFFDAHKTKVK*
Ga0075436_1009866941	3300006914	Populus Rhizosphere	SKVMVDHAKAKGVDATWLPVIGGKHVDAWAQPEIINQIFDFFDAHKTKAQ*
Ga0079218_108852851	3300007004	Agricultural Soil	TMVDHAKASGVDATWLPVIGGAHTDAWAQPEILKQTFDFFDKHRTKQK*
Ga0079218_123770391	3300007004	Agricultural Soil	TMVDHAKASGVDATWLPVIGGAHTDAWAQPEILKQTFDFFDAHKTKQK*
Ga0111538_111500693	3300009156	Populus Rhizosphere	WLPVPGGAHTDAWAQPAIISQIFDFFDAHKTKVK*
Ga0075423_101554081	3300009162	Populus Rhizosphere	AKAKGVNVTWLPVPGGAHTDAWAQPAIIGQIFDFFDAHKTKSR*
Ga0105242_101818894	3300009176	Miscanthus Rhizosphere	DHAKAKGIDATWLPVPGGAHTDAWAQQDILNKTFDFFDAHKAKLK*
Ga0105242_115705761	3300009176	Miscanthus Rhizosphere	KVMVDHAKAKGVNATWLPVIGGMHTDAWAQPEILKQTFDFFDKYKTKQK*
Ga0105248_104651822	3300009177	Switchgrass Rhizosphere	GVDATWLPVAGGMHTDAWAQPEIVTKIFDFFDAHKTKAK*
Ga0105248_128713021	3300009177	Switchgrass Rhizosphere	TMVDHAKAKGVDATWLPVAGGMHTDAWAQPEIVAKIFAFFDSHPRK*
Ga0105249_119971472	3300009553	Switchgrass Rhizosphere	VDHAQAKGVNATWLPVPGGLHTDAWAQPEIIAKIFDFFDSHPRK*
Ga0105249_120230161	3300009553	Switchgrass Rhizosphere	AKAKGVDATWLPVAGGAHTDAWAQPEILNQIFDFFDAHKAKAR*
Ga0126374_118079401	3300009792	Tropical Forest Soil	ASKVMVDHAVAKGVDATWLPVPGGKHVDAWAQPEIISQVFDFFDKHVGKAK*
Ga0126373_120391561	3300010048	Tropical Forest Soil	ASKAMVDHAKAKGVDATWLPVIGGTHIDAWAQPEVIRQIFDFFDAHRKK*
Ga0126372_113856021	3300010360	Tropical Forest Soil	KTMVDHAKASGVDATWLPVPGGKHVDAWAQPETLAQIFDFFDRHVGKAK*
Ga0134126_104750873	3300010396	Terrestrial Soil	FDASKAMVDHAKAQGVDATWLPVVGGAHVDAWAQPEVIKQIFDFFDAHKK*
Ga0126383_136691392	3300010398	Tropical Forest Soil	RAKGVDATWLPVPGGKHVDAWAQPEIISQVFDFFDRHAGKAK*
Ga0134127_115476023	3300010399	Terrestrial Soil	AKGVNATWLPVAGGMHTDAWAQPEVISQIFDFFDKYKKK*
Ga0134127_129985902	3300010399	Terrestrial Soil	WLPVIGGAHVDAWAQPDILKQTFDFFDKNPTKKK*
Ga0134122_131603141	3300010400	Terrestrial Soil	HAKEKGVDATWLPVGGGMHTDAWAQPEIIKQIFDFFDAHRTKAK*
Ga0134123_117904633	3300010403	Terrestrial Soil	VDATWLPVAGGAHTDAWAQPEILNQIFDFFDAHKAKAR*
Ga0126350_116707791	3300010880	Boreal Forest Soil	RLMVDHAKAKGIDATWLPVAGGMHTDAWAQPEIIKQIFDFYESHKARKN*
Ga0150985_1034682082	3300012212	Avena Fatua Rhizosphere	GSKVMVDHAKAKGVNATWLPVIGGAHTDAWAQPEILKQTFDFFDKYKTKQK*
Ga0150985_1158383172	3300012212	Avena Fatua Rhizosphere	HAKAKGINVTWLPVIGGQHVDAWAQPEILEQTFDFFDKYKAKQK*
Ga0157293_100452172	3300012898	Soil	SKAMVDHATAKGLNVTWLPVIGGAHVDAWAQPEILKQTFDFFDKNATKKK*
Ga0157283_101286831	3300012907	Soil	HAKAKGVSATWLPVPGGAHTDAWAQPAIISQIFDFFDAHKTKMK*
Ga0126369_116347131	3300012971	Tropical Forest Soil	TWLPVPGGKHVDAWAQPEILGQIFDFFDRHVGKAK*
Ga0134110_102364971	3300012975	Grasslands Soil	DASKTMVDHAKAKGIDATWLPVAGGMHTDAWAQPEIIKQIFDFFDAHKTRKKS*
Ga0157374_106484792	3300013296	Miscanthus Rhizosphere	MVDHAKAKGIDATWLPVPGGAHTDAWAQQDILNKTFDFFDAHKTKLK*
Ga0157375_129886811	3300013308	Miscanthus Rhizosphere	NATFVGVAGGQHTDAWAQPEIIKQIFDFFDANKTKLK*
Ga0163163_118138131	3300014325	Switchgrass Rhizosphere	KAKGVNATWLPVIGGMHTDAWAQPEILKQTFDFYDRYKTRQK*
Ga0173480_112720382	3300015200	Soil	NVTWLPVIGGAHVDAWAQPEIIKQTFDFFDKNATKKK*
Ga0132258_108921041	3300015371	Arabidopsis Rhizosphere	TMVDHAQAKGVNATWLPVPGGLHTDAWAQPEIIAKIFDFFDAHPRK*
Ga0132258_124472591	3300015371	Arabidopsis Rhizosphere	HAKAKGVDATWLPVAGGQHTDAWAQPEIIKQEFAFFDAHVRKAGGAPPK*
Ga0132257_1004837963	3300015373	Arabidopsis Rhizosphere	HAQAKGVNATWLPVPGGLHTDAWAQPEIIAKIFDFFDSHPRK*
Ga0132257_1035087442	3300015373	Arabidopsis Rhizosphere	MDGTWLPVPGGMHTDAWAQPEIIKQIFDFFDAHSRKKSS*
Ga0132257_1039384581	3300015373	Arabidopsis Rhizosphere	TWLPVPGGAHTDAWAQQEILNKTFDFFDAHKTKLK*
Ga0182032_118736672	3300016357	Soil	DATWLPVIGGKHVDAWAQPEVLNQIFGFFDAHKSKAQ
Ga0163161_112907911	3300017792	Switchgrass Rhizosphere	ARGVNATFLGVQGGIHTDAWAQPEIIKQIFDFFDAHKTKAK
Ga0163161_113861562	3300017792	Switchgrass Rhizosphere	NATWLPVVGGMHTDAWAQPEIISQIFDFFDKYRKK
Ga0190274_114337332	3300018476	Soil	FDASKTMVDHAKAKGVNATWLPVAGGMHTDAWAQPEIISQIFDFFDKYKKK
Ga0190274_137934542	3300018476	Soil	DASKAMVDHALAKGVDATWLPVAGGLHTDAWAQPEIIAKIFDFFDTHARK
Ga0173479_100542931	3300019362	Soil	MVDHAKAKGIDATWLPVPGGAHTDAWAQQEILNKTFDFFDAHKTKLK
Ga0193692_10126901	3300020000	Soil	TFMGVTGGQHTDAWAQPEIIKQIFDFFDANKTKLKQ
Ga0210400_105315841	3300021170	Soil	KGVDATWLPVAGGMHVDAWAQPDVIRQIFDFFDAHRKKG
Ga0210391_107732671	3300021433	Soil	AMVDHAKVKGVNATWLPVAGGMHTDAWAQPEVIEEIFNFFDAHRKKH
Ga0210392_106725441	3300021475	Soil	VDATWLPVVGGAHTDAWAQPEVIEQIFNFFDAHRKKG
Ga0247746_11938932	3300022886	Soil	SKTMVDHAKAKGIDATWLPVPGGAHTDAWAQQEILNKTFDFFDAHKTKLK
Ga0207656_107483142	3300025321	Corn Rhizosphere	KGLNVTWLPVIGGQHVDAWAQPEILKQTFDFFDKYKTKQK
Ga0207645_100048991	3300025907	Miscanthus Rhizosphere	ASKTMVDHAQAKGVDATWLPVAGGLHTDAWAQPEVIAKIFDFFDTHARK
Ga0207681_100163888	3300025923	Switchgrass Rhizosphere	GVNAIWLPVPGGLHTDAWAQPEIIAKIFDFFDSHPRK
Ga0207681_104128251	3300025923	Switchgrass Rhizosphere	AKGVDATWLPVAGGLHTDAWAQPEIIAKIFDFFDSHPRK
Ga0207681_104953271	3300025923	Switchgrass Rhizosphere	KGIDATWLPVPGGAHTDAWAQQEILNKTFDFFDAHKTKLK
Ga0207659_112326182	3300025926	Miscanthus Rhizosphere	ARAKGVDATWLPVEGGLHTDAWAQPAVLSRIFDFFDAHKKHL
Ga0207644_106576772	3300025931	Switchgrass Rhizosphere	AKAKGVDATWLPVAGGLHTDAWAQPEIIAKIFDFFDAHPRK
Ga0207669_103268401	3300025937	Miscanthus Rhizosphere	MVDHATAKGLNVTWLPVIGGAHVDAWAQPDILKQTFDFFDKNATKKK
Ga0207669_118693702	3300025937	Miscanthus Rhizosphere	DHAKAKGIDATWLPVPGGAHTDAWAQQEILNKTFDFFDAHKTKLK
Ga0207679_101762471	3300025945	Corn Rhizosphere	AWLPVAGGLHTDAWAQPEIITQIFDFFDKHTAKAK
Ga0207679_120579052	3300025945	Corn Rhizosphere	VDHAKAKGVNATWLPVVGGMHTDAWAQPEIVTQIFDFFDKYKKK
Ga0207651_112715742	3300025960	Switchgrass Rhizosphere	DHAKAKGINATWLPVVGGMHIDAWAQPEILKQTFDFFDKYKTKQK
Ga0207708_116563862	3300026075	Corn, Switchgrass And Miscanthus Rhizosphere	MDYAAGKAMIDRAKARGVNATFLGVQGGIHTDAWAQPEIIKQIFDFFDAHKTKAK
Ga0209998_100788352	3300027717	Arabidopsis Thaliana Rhizosphere	ASETMVAHAKAKGVDATWLPVPGGAHTDAWAQPAIISRIFDFFDAHRTKLK
Ga0209274_105794932	3300027853	Soil	KAKGVNATWLPVAGGAHTDAWAQPEVIEKIFDFFDAHRKRS
Ga0209465_106620011	3300027874	Tropical Forest Soil	VDQAKAKGVDATWLPVPGGAHTDAWAQQEILNKTFDFFDAHKTKAK
Ga0209583_102570213	3300027910	Watersheds	VMVDHAKARGVDATWSPVPGGKHVDAWAQPEIIAKIFDFFDAHKTKAK
Ga0307499_102302842	3300031184	Soil	ATWLPVAGGKHTDAWAQPEIVAQIFDFFDKHTTKVK
Ga0307506_104402451	3300031366	Soil	IDRAKTKGVNATFVGVAGGQHTDAWAQPEIIKQIFDFFDANKTKRK
Ga0310686_1171424401	3300031708	Soil	HARAKGIDATWLPVAGGMHTDAWAQPEIITQIFDFFDRHKTKAK
Ga0307469_115909542	3300031720	Hardwood Forest Soil	MVDHARAKGVDATWLPVIGGKHVDAWAQPEIINQIFDFFDAHKTKAQ
Ga0310904_110805671	3300031854	Soil	FSASETMVQHAKAKGVSATWLPVPGGAHTDAWAQPAVINQIFDFFDAHKTKAK
Ga0306925_117471042	3300031890	Soil	KARGVDATWLPVPGGKHVDAWAQPEVISQVFDFFDRHVGKAK
Ga0306921_119610482	3300031912	Soil	MVDHARAKGVDATWLPVPGGKHVDAWAQPDIISQVFDFFDKHAGKAK
Ga0307416_1036850201	3300032002	Rhizosphere	AHANAKGVNATWLPVPGGAHTDAWAQPAVISQIFDFFDAHRTKLK
Ga0307411_111680871	3300032005	Rhizosphere	KVMVDHARAKGVNVAWLPVVGGAHTDAWAHPEILKQTFDFYDKYQTKLK
Ga0318563_102580162	3300032009	Soil	SKTMVDHAKARGVDATWLPVPGGKHVDAWAQPEILGQIFDFFDRHVGKAK
Ga0310906_104369152	3300032013	Soil	AKAKGVSATWLPVPGGAHTDAWAQPAVINQIFDFFDAHKTKAK
Ga0308173_115264131	3300032074	Soil	GLNVTWLPVIGGQHVDAWAQPEILKQTFDFFDKYKTKQK
Ga0308173_117167701	3300032074	Soil	HAKAKGVDATWLPVAGGMHTDAWAQPEVIKQIFDFFDAHRKRS
Ga0310890_105136161	3300032075	Soil	VMVDHATAKGLNVTWLPVIGGAHVDAWAQPDILKQTFDFFDKNATKKK
Ga0307472_1004228002	3300032205	Hardwood Forest Soil	KGVDATWLPVPGGKHVDAWAQPEIISQIFDFFDAHKTKAR
Ga0310896_100037275	3300032211	Soil	SETMVQHAKAKGVSATWLPVPGGAHTDAWAQPAIISQIFDFFDAHKTKTK
Ga0326726_118536472	3300033433	Peat Soil	DATWLPVPGGKHVDAWAQPEIIAKVFDFFDAHKTKAK
Ga0370510_0115541_10_144	3300034160	Untreated Peat Soil	MVDHAKAKGVDATWLPVAGGAHTDAWAQPAVIAQIFDFFDAHRR
Ga0314784_176310_360_500	3300034663	Soil	VQHAKAKGVSATWLPVPGGAHTDAWAQPAIISQIFDFFDAHKTKTK

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign