Basic Information | |
---|---|
Family ID | F097712 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 104 |
Average Sequence Length | 38 residues |
Representative Sequence | LTLYTTPVVYLAFDWLARRFSFHIGNPIEEPAHGD |
Number of Associated Samples | 89 |
Number of Associated Scaffolds | 104 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 0.00 % |
% of genes near scaffold ends (potentially truncated) | 98.08 % |
% of genes from short scaffolds (< 2000 bps) | 93.27 % |
Associated GOLD sequencing projects | 85 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.34 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (96.154 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (25.000 % of family members) |
Environment Ontology (ENVO) | Unclassified (28.846 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (45.192 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 30.16% β-sheet: 0.00% Coil/Unstructured: 69.84% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.34 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 104 Family Scaffolds |
---|---|---|
PF00873 | ACR_tran | 98.08 |
PF02915 | Rubrerythrin | 0.96 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 97.12 % |
Unclassified | root | N/A | 2.88 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300002245|JGIcombinedJ26739_100255123 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Chondrichthyes → Elasmobranchii → Selachii → Galeomorphii → Galeoidea → Orectolobiformes → Hemiscylliidae → Chiloscyllium → Chiloscyllium punctatum | 1641 | Open in IMG/M |
3300004152|Ga0062386_101166101 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 640 | Open in IMG/M |
3300005186|Ga0066676_10186909 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1324 | Open in IMG/M |
3300005434|Ga0070709_11134713 | All Organisms → cellular organisms → Bacteria | 626 | Open in IMG/M |
3300005518|Ga0070699_101678382 | All Organisms → cellular organisms → Bacteria | 582 | Open in IMG/M |
3300005529|Ga0070741_11690805 | All Organisms → cellular organisms → Bacteria | 515 | Open in IMG/M |
3300005537|Ga0070730_10102053 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1984 | Open in IMG/M |
3300005541|Ga0070733_10608414 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 733 | Open in IMG/M |
3300005542|Ga0070732_10962085 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 522 | Open in IMG/M |
3300005558|Ga0066698_10108788 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1837 | Open in IMG/M |
3300005591|Ga0070761_10368750 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 872 | Open in IMG/M |
3300005764|Ga0066903_103504452 | All Organisms → cellular organisms → Bacteria | 846 | Open in IMG/M |
3300005764|Ga0066903_104224380 | All Organisms → cellular organisms → Bacteria | 768 | Open in IMG/M |
3300006041|Ga0075023_100323581 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 643 | Open in IMG/M |
3300006050|Ga0075028_100779639 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 581 | Open in IMG/M |
3300006052|Ga0075029_101130029 | All Organisms → cellular organisms → Bacteria | 545 | Open in IMG/M |
3300006176|Ga0070765_100693007 | All Organisms → cellular organisms → Bacteria | 962 | Open in IMG/M |
3300006806|Ga0079220_10994565 | All Organisms → cellular organisms → Bacteria | 665 | Open in IMG/M |
3300007076|Ga0075435_100447060 | All Organisms → cellular organisms → Bacteria | 1114 | Open in IMG/M |
3300007255|Ga0099791_10526979 | All Organisms → cellular organisms → Bacteria | 575 | Open in IMG/M |
3300009137|Ga0066709_103820799 | All Organisms → cellular organisms → Bacteria | 547 | Open in IMG/M |
3300009143|Ga0099792_10720284 | All Organisms → cellular organisms → Bacteria | 647 | Open in IMG/M |
3300010046|Ga0126384_10541460 | All Organisms → cellular organisms → Bacteria | 1010 | Open in IMG/M |
3300010360|Ga0126372_10383093 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1276 | Open in IMG/M |
3300010360|Ga0126372_11295379 | All Organisms → cellular organisms → Bacteria | 757 | Open in IMG/M |
3300010360|Ga0126372_12236136 | All Organisms → cellular organisms → Bacteria | 596 | Open in IMG/M |
3300010360|Ga0126372_12368998 | All Organisms → cellular organisms → Bacteria | 581 | Open in IMG/M |
3300010362|Ga0126377_10983138 | All Organisms → cellular organisms → Bacteria | 910 | Open in IMG/M |
3300010366|Ga0126379_13386694 | All Organisms → cellular organisms → Bacteria | 534 | Open in IMG/M |
3300010398|Ga0126383_12948869 | All Organisms → cellular organisms → Bacteria | 556 | Open in IMG/M |
3300010400|Ga0134122_11342265 | All Organisms → cellular organisms → Bacteria | 725 | Open in IMG/M |
3300011269|Ga0137392_10995045 | All Organisms → cellular organisms → Bacteria | 689 | Open in IMG/M |
3300012096|Ga0137389_10233160 | All Organisms → cellular organisms → Bacteria | 1542 | Open in IMG/M |
3300012202|Ga0137363_10076913 | All Organisms → cellular organisms → Bacteria | 2475 | Open in IMG/M |
3300012211|Ga0137377_10152870 | All Organisms → cellular organisms → Bacteria | 2211 | Open in IMG/M |
3300012349|Ga0137387_10194786 | All Organisms → cellular organisms → Bacteria | 1454 | Open in IMG/M |
3300012361|Ga0137360_10559623 | All Organisms → cellular organisms → Bacteria | 977 | Open in IMG/M |
3300012363|Ga0137390_10090845 | Not Available | 3012 | Open in IMG/M |
3300012363|Ga0137390_10198756 | All Organisms → cellular organisms → Bacteria | 1992 | Open in IMG/M |
3300012917|Ga0137395_10330683 | All Organisms → cellular organisms → Bacteria | 1083 | Open in IMG/M |
3300012922|Ga0137394_10247314 | All Organisms → cellular organisms → Bacteria | 1524 | Open in IMG/M |
3300012922|Ga0137394_11425002 | All Organisms → cellular organisms → Bacteria | 553 | Open in IMG/M |
3300012924|Ga0137413_11799181 | All Organisms → cellular organisms → Bacteria | 506 | Open in IMG/M |
3300012925|Ga0137419_10114247 | All Organisms → cellular organisms → Bacteria | 1894 | Open in IMG/M |
3300012925|Ga0137419_11513067 | All Organisms → cellular organisms → Bacteria | 569 | Open in IMG/M |
3300012927|Ga0137416_12181434 | All Organisms → cellular organisms → Bacteria | 509 | Open in IMG/M |
3300012929|Ga0137404_11880746 | All Organisms → cellular organisms → Bacteria | 557 | Open in IMG/M |
3300012930|Ga0137407_11503603 | All Organisms → cellular organisms → Bacteria | 641 | Open in IMG/M |
3300013308|Ga0157375_11045909 | All Organisms → cellular organisms → Bacteria | 954 | Open in IMG/M |
3300015052|Ga0137411_1154568 | All Organisms → cellular organisms → Bacteria | 554 | Open in IMG/M |
3300015241|Ga0137418_10667107 | All Organisms → cellular organisms → Bacteria | 804 | Open in IMG/M |
3300015356|Ga0134073_10118819 | All Organisms → cellular organisms → Bacteria | 803 | Open in IMG/M |
3300015373|Ga0132257_100057741 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 4344 | Open in IMG/M |
3300016404|Ga0182037_10744257 | All Organisms → cellular organisms → Bacteria | 842 | Open in IMG/M |
3300016404|Ga0182037_11359594 | All Organisms → cellular organisms → Bacteria | 627 | Open in IMG/M |
3300017656|Ga0134112_10334866 | All Organisms → cellular organisms → Bacteria | 614 | Open in IMG/M |
3300017930|Ga0187825_10030176 | All Organisms → cellular organisms → Bacteria | 1826 | Open in IMG/M |
3300017955|Ga0187817_11102991 | All Organisms → cellular organisms → Bacteria | 509 | Open in IMG/M |
3300020170|Ga0179594_10379251 | All Organisms → cellular organisms → Bacteria | 537 | Open in IMG/M |
3300020199|Ga0179592_10507118 | All Organisms → cellular organisms → Bacteria | 516 | Open in IMG/M |
3300020580|Ga0210403_11025457 | All Organisms → cellular organisms → Bacteria | 644 | Open in IMG/M |
3300020580|Ga0210403_11305389 | All Organisms → cellular organisms → Bacteria | 554 | Open in IMG/M |
3300021046|Ga0215015_10884863 | All Organisms → cellular organisms → Bacteria | 555 | Open in IMG/M |
3300021170|Ga0210400_10937288 | All Organisms → cellular organisms → Bacteria | 706 | Open in IMG/M |
3300021170|Ga0210400_11288153 | All Organisms → cellular organisms → Bacteria | 586 | Open in IMG/M |
3300021178|Ga0210408_10272580 | All Organisms → cellular organisms → Bacteria | 1349 | Open in IMG/M |
3300021180|Ga0210396_10606683 | All Organisms → cellular organisms → Bacteria | 951 | Open in IMG/M |
3300021404|Ga0210389_11324684 | All Organisms → cellular organisms → Bacteria | 551 | Open in IMG/M |
3300021420|Ga0210394_11737860 | All Organisms → cellular organisms → Bacteria | 521 | Open in IMG/M |
3300021432|Ga0210384_11488694 | All Organisms → cellular organisms → Bacteria | 582 | Open in IMG/M |
3300021858|Ga0213852_1123910 | All Organisms → cellular organisms → Bacteria | 671 | Open in IMG/M |
3300022557|Ga0212123_10241942 | All Organisms → cellular organisms → Bacteria | 1302 | Open in IMG/M |
3300025906|Ga0207699_10887462 | All Organisms → cellular organisms → Bacteria | 657 | Open in IMG/M |
3300025941|Ga0207711_10616235 | All Organisms → cellular organisms → Bacteria | 1013 | Open in IMG/M |
3300026334|Ga0209377_1199271 | All Organisms → cellular organisms → Bacteria | 671 | Open in IMG/M |
3300026356|Ga0257150_1060467 | All Organisms → cellular organisms → Bacteria | 567 | Open in IMG/M |
3300026496|Ga0257157_1038067 | All Organisms → cellular organisms → Bacteria | 800 | Open in IMG/M |
3300026551|Ga0209648_10813701 | All Organisms → cellular organisms → Bacteria | 511 | Open in IMG/M |
3300027645|Ga0209117_1011815 | Not Available | 2931 | Open in IMG/M |
3300027645|Ga0209117_1123493 | All Organisms → cellular organisms → Bacteria | 691 | Open in IMG/M |
3300027738|Ga0208989_10164060 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_2_60_10 | 744 | Open in IMG/M |
3300027787|Ga0209074_10090427 | All Organisms → cellular organisms → Bacteria | 1017 | Open in IMG/M |
3300027846|Ga0209180_10194189 | All Organisms → cellular organisms → Bacteria | 1171 | Open in IMG/M |
3300027846|Ga0209180_10645453 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 581 | Open in IMG/M |
3300027857|Ga0209166_10270343 | All Organisms → cellular organisms → Bacteria | 899 | Open in IMG/M |
3300027903|Ga0209488_10412335 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 999 | Open in IMG/M |
3300028047|Ga0209526_10334979 | All Organisms → cellular organisms → Bacteria | 1017 | Open in IMG/M |
3300031090|Ga0265760_10034485 | All Organisms → cellular organisms → Bacteria | 1497 | Open in IMG/M |
3300031231|Ga0170824_127436055 | All Organisms → cellular organisms → Bacteria | 562 | Open in IMG/M |
3300031549|Ga0318571_10457917 | All Organisms → cellular organisms → Bacteria | 507 | Open in IMG/M |
3300031720|Ga0307469_10929935 | All Organisms → cellular organisms → Bacteria | 807 | Open in IMG/M |
3300031720|Ga0307469_12348886 | All Organisms → cellular organisms → Bacteria | 520 | Open in IMG/M |
3300031720|Ga0307469_12492838 | All Organisms → cellular organisms → Bacteria | 505 | Open in IMG/M |
3300031754|Ga0307475_11325030 | All Organisms → cellular organisms → Bacteria | 557 | Open in IMG/M |
3300031768|Ga0318509_10195853 | All Organisms → cellular organisms → Bacteria | 1123 | Open in IMG/M |
3300031768|Ga0318509_10429130 | All Organisms → cellular organisms → Bacteria | 739 | Open in IMG/M |
3300031782|Ga0318552_10669999 | All Organisms → cellular organisms → Bacteria | 529 | Open in IMG/M |
3300031795|Ga0318557_10349029 | All Organisms → cellular organisms → Bacteria | 680 | Open in IMG/M |
3300031833|Ga0310917_11052320 | All Organisms → cellular organisms → Bacteria | 544 | Open in IMG/M |
3300032054|Ga0318570_10174507 | All Organisms → cellular organisms → Bacteria | 967 | Open in IMG/M |
3300032067|Ga0318524_10141892 | All Organisms → cellular organisms → Bacteria | 1211 | Open in IMG/M |
3300032180|Ga0307471_100057118 | Not Available | 3265 | Open in IMG/M |
3300032893|Ga0335069_10110451 | All Organisms → cellular organisms → Bacteria | 3458 | Open in IMG/M |
3300034124|Ga0370483_0128020 | All Organisms → cellular organisms → Bacteria | 846 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 25.00% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 18.27% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 7.69% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 4.81% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 4.81% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 4.81% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 2.88% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.88% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.88% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 1.92% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.92% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.92% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.92% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.92% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.92% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.92% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.92% |
Watersheds | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds | 0.96% |
Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.96% |
Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.96% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.96% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.96% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.96% |
Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 0.96% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.96% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.96% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.96% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.96% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
3300004152 | Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3 | Environmental | Open in IMG/M |
3300005186 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 | Environmental | Open in IMG/M |
3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
3300005529 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1 | Environmental | Open in IMG/M |
3300005537 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 | Environmental | Open in IMG/M |
3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
3300005558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 | Environmental | Open in IMG/M |
3300005591 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 | Environmental | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300006041 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 | Environmental | Open in IMG/M |
3300006050 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014 | Environmental | Open in IMG/M |
3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
3300015052 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300015356 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
3300017656 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_11112015 | Environmental | Open in IMG/M |
3300017930 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_5 | Environmental | Open in IMG/M |
3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
3300020170 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300020199 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
3300021046 | Soil microbial communities from Shale Hills CZO, Pennsylvania, United States - 90cm depth | Environmental | Open in IMG/M |
3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
3300021858 | Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2015 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300022557 | Paint Pots_combined assembly | Environmental | Open in IMG/M |
3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026334 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 (SPAdes) | Environmental | Open in IMG/M |
3300026356 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-13-A | Environmental | Open in IMG/M |
3300026496 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-69-A | Environmental | Open in IMG/M |
3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
3300027645 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 (SPAdes) | Environmental | Open in IMG/M |
3300027738 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M1 (SPAdes) | Environmental | Open in IMG/M |
3300027787 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter (SPAdes) | Environmental | Open in IMG/M |
3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027857 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031549 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f24 | Environmental | Open in IMG/M |
3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
3300031768 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22 | Environmental | Open in IMG/M |
3300031782 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f20 | Environmental | Open in IMG/M |
3300031795 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f19 | Environmental | Open in IMG/M |
3300031833 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178 | Environmental | Open in IMG/M |
3300032054 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f23 | Environmental | Open in IMG/M |
3300032067 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f22 | Environmental | Open in IMG/M |
3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
3300032893 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1 | Environmental | Open in IMG/M |
3300034124 | Peat soil microbial communities from wetlands in Alaska, United States - Goldstream_06D_14 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
JGIcombinedJ26739_1002551232 | 3300002245 | Forest Soil | LSQLLTLYTTPVVYLAFDWLANRLHLGITNPVDEPATGD* |
Ga0062386_1011661011 | 3300004152 | Bog Forest Soil | LILSQVLTLYTTPVVYLAFDWLATRLHLGISNAADEPAPGD* |
Ga0066676_101869091 | 3300005186 | Soil | LSQLLTLYTTPVVYLAFDWLARRFAFHIGNPIEEPAHGD* |
Ga0070709_111347131 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | SQILTLYTTPVVYLAFDWLSRHVPLGFGNPIDEPAAEHSGD* |
Ga0070699_1016783822 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | LSQILTLYTTPVVYLAFDWLSRHVPLGFGNPIDEPAAEHSGD* |
Ga0070741_116908051 | 3300005529 | Surface Soil | LLTLYTTPVVYLAFDRLAQRFARFRIGNPIDEPAGAD* |
Ga0070730_101020531 | 3300005537 | Surface Soil | ILTLYTTPVVYLAFDWLSRRFAFHLGNPIDEAAAQDYGD* |
Ga0070733_106084142 | 3300005541 | Surface Soil | SQLLTLYTTPVVYLAFDWLSHRFEVQIGNPIEEPAHGD* |
Ga0070732_109620852 | 3300005542 | Surface Soil | SQLLTLYTTPVVYLAFDWLARRFAVHIGNPVEEPAHGD* |
Ga0066698_101087881 | 3300005558 | Soil | LILSQLLTLYTTPVIYLAFDWLARRFAFHVGNPIEEPATGD* |
Ga0070761_103687502 | 3300005591 | Soil | SQLLTLYTTPVVYLAFDWLARRFAFNIGNSIEEPAHGD* |
Ga0066903_1035044521 | 3300005764 | Tropical Forest Soil | LILSQLLTLYTTPVVYLAFDWLANRLNLGISNPVDEPVQGD* |
Ga0066903_1042243802 | 3300005764 | Tropical Forest Soil | IVSQLLTLYTTPVVYLAFDWLGRHLNLGVANPAEEPLAGD* |
Ga0075023_1003235812 | 3300006041 | Watersheds | ILSQLLTLYTTPVVYLAFDWLAHRFSFHIGNPTEEPATGD* |
Ga0075028_1007796391 | 3300006050 | Watersheds | LILSQLLTLYTTPVVYLAFDWLAHRFSFRVGNPIEEPAHGTAPGD* |
Ga0075029_1011300292 | 3300006052 | Watersheds | TLYTTPVVYLAFDWLASRLHLGISNPIDEPSPGD* |
Ga0070765_1006930072 | 3300006176 | Soil | LSQLLTLYTTPVVYLAFDWLAHRFEARIGGPVEEPAHGD* |
Ga0079220_109945652 | 3300006806 | Agricultural Soil | VLTLYTTPVVYLAFDWLARRFAVHFGNPVEQPAHGD* |
Ga0075435_1004470601 | 3300007076 | Populus Rhizosphere | LTLYTTPVVYLAFDWLANRLHLGITNTADEAALGD* |
Ga0099791_105269792 | 3300007255 | Vadose Zone Soil | LLTLYTTPVVYLAFDWLGRRFAFQIGNPIEEPAHGD* |
Ga0066709_1038207992 | 3300009137 | Grasslands Soil | LLTLYTTPVVYLAFDWLGRRFAFHVGNPIEAPAHGD* |
Ga0099792_107202842 | 3300009143 | Vadose Zone Soil | TLYTTPVVYLAFDWLGRRFAFHVGNPIEEPAPGD* |
Ga0126384_105414602 | 3300010046 | Tropical Forest Soil | QLLTLYTTPVVYLAFDRLARRFSRYRIGNPIEGSATAD* |
Ga0126372_103830931 | 3300010360 | Tropical Forest Soil | LTLYTTPVVYLAFERLGRRFERFRIGNRIEEPAVAE* |
Ga0126372_112953792 | 3300010360 | Tropical Forest Soil | TLYTTPVVYLAFDWLGRRFQFHVGNPIEEPAHGD* |
Ga0126372_122361361 | 3300010360 | Tropical Forest Soil | QILTLYTTPVVYLAFDWLARRFAFRVGNPIEEPAHGD* |
Ga0126372_123689981 | 3300010360 | Tropical Forest Soil | QLLTLYTTPVVYLAFDRLARRFSRYRIGNPIEGAATAD* |
Ga0126377_109831382 | 3300010362 | Tropical Forest Soil | ILTLYTTPVVYLAFDWLARRFAFRVGNPIEEPAHGD* |
Ga0126379_133866941 | 3300010366 | Tropical Forest Soil | LLTLYTTPVVYLAFDWLGRRFQFHVGNPIEEPAHGD* |
Ga0126383_129488692 | 3300010398 | Tropical Forest Soil | LTLYTTPVVYLAFDWLASRLNLGISNPMDEPAHGD* |
Ga0134122_113422652 | 3300010400 | Terrestrial Soil | LTLYTTPVVYLAFDWLSRRFAFNIGNPVDDAALHQPGD* |
Ga0137392_109950452 | 3300011269 | Vadose Zone Soil | ILSQLLTLYTTPVVYLAFDWLARRFQIQIGNPIEEPAPGD* |
Ga0137389_102331602 | 3300012096 | Vadose Zone Soil | LILSQLLTLYTTPVVYLAFDWLANRLHLGISNPLDEPATGD* |
Ga0137363_100769131 | 3300012202 | Vadose Zone Soil | QLLTLYTTPVVYLAFDWLGRRFAFHVGNPIEEPAAGD* |
Ga0137377_101528701 | 3300012211 | Vadose Zone Soil | TTPVVYLAFDWLAHRFSFHVGNPIEEPAHGSVPGD* |
Ga0137387_101947862 | 3300012349 | Vadose Zone Soil | LLTLYTTPVVYLAFDWLGRRFAFHVGNPIEEPAHGD* |
Ga0137360_105596231 | 3300012361 | Vadose Zone Soil | LYTTPVVYLAFDWLSRRFSLGFGNPIDDPAVEHYGD* |
Ga0137390_100908451 | 3300012363 | Vadose Zone Soil | TLYTTPVVYLAFDWLGRRFAFRIGNPVEEPAHGD* |
Ga0137390_101987562 | 3300012363 | Vadose Zone Soil | LLTLYTTPVVYLAFDWLGRRFAFHVGNPIEEPATGD* |
Ga0137395_103306832 | 3300012917 | Vadose Zone Soil | LYTTPVVYLAFDWVAHRFQFHVGNPIEDPAGAAGN* |
Ga0137394_102473142 | 3300012922 | Vadose Zone Soil | QILTLYTTPVVYLAFDWLSRHLPLGFGNPMDEPAVEHSGD* |
Ga0137394_114250022 | 3300012922 | Vadose Zone Soil | LTLYTTPVVYLAFDWLANRLHLGITNSIDEPATGD* |
Ga0137413_117991812 | 3300012924 | Vadose Zone Soil | VLTLYTTPVVYLAFDWLSRRFSLGFGNPIDDPAVEHYGD* |
Ga0137419_101142472 | 3300012925 | Vadose Zone Soil | LTLYTTPVVYLAFDWLGRRFAFHVGNPIEAPAHGD* |
Ga0137419_115130672 | 3300012925 | Vadose Zone Soil | LILSQILTLYTTPVVYLAFDWIAHRFQFHIGNPIEDAPGAAGD* |
Ga0137416_121814341 | 3300012927 | Vadose Zone Soil | QILTLYTTPVVYLAFDWLARRFAFHIGNPVEEPAHGD* |
Ga0137404_118807461 | 3300012929 | Vadose Zone Soil | QLLTLYTTPVIYLAFDWLAHRFSWHIGNPIEEPARGD* |
Ga0137407_115036032 | 3300012930 | Vadose Zone Soil | LYTTPVVYLAFDWLAHRFSFHVGNPAEEPAHESAPGD* |
Ga0157375_110459092 | 3300013308 | Miscanthus Rhizosphere | QILTLYTTPVVYLAFDWLSRRFSFRLGNPIDEAALHQPGD* |
Ga0137411_11545681 | 3300015052 | Vadose Zone Soil | LTLYTTPVVYLAFDWIAHRFQFHIGNPVEDPAPGD* |
Ga0137418_106671071 | 3300015241 | Vadose Zone Soil | ILSQLLTLYTTPVVYLAFDWLGRRFAFHVGNPIEAPAHGD* |
Ga0134073_101188191 | 3300015356 | Grasslands Soil | SQLLTLYTTPVVYLAFDWLSRRFEFHIGNPIEEPSPGD* |
Ga0132257_1000577411 | 3300015373 | Arabidopsis Rhizosphere | LSQILTLYTPPVVYLAFDWLSRRFSFHIGNPMDEAALHQPGD* |
Ga0182037_107442571 | 3300016404 | Soil | QLLTLYTTPVVYLAFDWLGRHLNLGFTNSAEEPAAGD |
Ga0182037_113595941 | 3300016404 | Soil | LYTTPVVYLAFDWLSRHINFGFTNPIDDPAVEHGD |
Ga0134112_103348661 | 3300017656 | Grasslands Soil | LTLYTTPVVYLAFDWLARRFSFHIGNPIEEPAHGD |
Ga0187825_100301761 | 3300017930 | Freshwater Sediment | QLLTLYTTPVVYLAFDRLASRFARYRIGNPIEGSATAD |
Ga0187817_111029911 | 3300017955 | Freshwater Sediment | LSQLLTLYTTPVVYLAFDWLAHRFAVHIGNPIEEPAHGD |
Ga0179594_103792511 | 3300020170 | Vadose Zone Soil | LLTLYTTPVVYLAFDRLGKRFSRFRVGNPIEETVVVE |
Ga0179592_105071182 | 3300020199 | Vadose Zone Soil | SQLLTLYTTPVVYLAFDWLANRLHLGISNPIDEPATGD |
Ga0210403_110254572 | 3300020580 | Soil | LTLYTTPVVYLAFDWLANRLHLGIANPVDEPATGD |
Ga0210403_113053891 | 3300020580 | Soil | ILSQLLTLYTTPVVYLAFDWLAHRFSFHVGNPVDEPAHESAPGD |
Ga0215015_108848632 | 3300021046 | Soil | LTLYTTPVVYLAFDWLGRRFQIHIGSSVEEPAHGD |
Ga0210400_109372881 | 3300021170 | Soil | LYTTPVVYLAFDWLAHRFSFHVGNPIEEPVPGTAPGD |
Ga0210400_112881531 | 3300021170 | Soil | QVLTLYTTPVVYLAFDWLANRLHLGITNTADEAALGD |
Ga0210408_102725802 | 3300021178 | Soil | LSQLLTLYTTPVVYLAFDWLASRLHLGIANPIDEPATGD |
Ga0210396_106066832 | 3300021180 | Soil | SQLLTLYTTPVVYLAFDWLARRFAFQIGNSIEEPAHGD |
Ga0210389_113246841 | 3300021404 | Soil | ILSQLLTLYTTPVVYLAFDWLSHRFTFNFGNSVPTEEISHGD |
Ga0210394_117378602 | 3300021420 | Soil | QLLSLYATPVVYLAFDWLASRLHLGITNPIDEPATGD |
Ga0210384_114886941 | 3300021432 | Soil | YTTPVVYLAFDWLAHRFSFHVGNPIEEPAPGTAPGD |
Ga0213852_11239102 | 3300021858 | Watersheds | LTLYTTPVVYLAFDWLGRRFSFRVGNPIEEPAPESLSGD |
Ga0212123_102419422 | 3300022557 | Iron-Sulfur Acid Spring | LSQLLTLYTTPVVYLAFDWLARRFTFRFGNSFSDEELAHGD |
Ga0207699_108874622 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | TLYTTPVVYLAFDWLSRHVPLGFGNPIDEPAAEHSGD |
Ga0207711_106162352 | 3300025941 | Switchgrass Rhizosphere | LYTTPVVYLAFDWLSRRFAFNIGNPVDDAALHQPGD |
Ga0209377_11992712 | 3300026334 | Soil | LTLYTTPVVYLAFDWLGRRFAFNIGNPIEEPAPGD |
Ga0257150_10604671 | 3300026356 | Soil | LSQLLTLYTTPVVYLAFDWLANRLHLGITNPVDEPATGD |
Ga0257157_10380671 | 3300026496 | Soil | LTLYTTPVVYLAFDWLAHRFAFRVGNPIEEPAHGTAPGD |
Ga0209648_108137011 | 3300026551 | Grasslands Soil | QLLTLYTTPVVYLAFDWLGRRFAFHVGNPIEEPAPGD |
Ga0209117_10118152 | 3300027645 | Forest Soil | WLTLYTTPVVYLAFDWLARRFSFHFGNPVEEPAPGTASGD |
Ga0209117_11234931 | 3300027645 | Forest Soil | SQVLTLYTTPVVYLAFDWLSRRFSLGFANPIDDPAVEHYGD |
Ga0208989_101640601 | 3300027738 | Forest Soil | ILSQLLTLYTTPVVYLAFDWLGRRFAFHIGNPIEEPAHGD |
Ga0209074_100904272 | 3300027787 | Agricultural Soil | QLLTLYTTPVVYLAFDRLARKLQRFRVGNRIDETATQSV |
Ga0209180_101941891 | 3300027846 | Vadose Zone Soil | SQLLTLYTTPVVYLAFDWLGRRFAFHVGNPIEEPATGD |
Ga0209180_106454532 | 3300027846 | Vadose Zone Soil | TLYTTPVVYLAFDWIAHRFQFHIGNPIEDPAGAAGD |
Ga0209166_102703431 | 3300027857 | Surface Soil | ILTLYTTPVVYLAFDWLSRRFAFHLGNPIDEAAAQDYGD |
Ga0209488_104123353 | 3300027903 | Vadose Zone Soil | LSQLLTLYTTPVVYLAFDWLARRFAFHVGNPIEEPAQGAIPGD |
Ga0209526_103349791 | 3300028047 | Forest Soil | TLYTTPVVYLAFDWLAHRFSFHVGNPIEEPAHGSAPGD |
Ga0265760_100344852 | 3300031090 | Soil | LSQLLTLYTTPVVYLAFDWLAHRFAFQIGNSFEEPAHGD |
Ga0170824_1274360551 | 3300031231 | Forest Soil | LSQILTLYTTPVVYLAFDWVARRFQFHIGNPIEDAAGATGD |
Ga0318571_104579171 | 3300031549 | Soil | ILSQILTLYTTPVVYLAFDWLSRRFTFTLGNPIEEAARQHYGD |
Ga0307469_109299352 | 3300031720 | Hardwood Forest Soil | SQLLTLYTTPVVYLAFERLGRRFERFRVGNRIEEPAVAE |
Ga0307469_123488861 | 3300031720 | Hardwood Forest Soil | LSQLLTLYTTPVIYLAFDWLAHRFSWHIGNPIEEPAPGD |
Ga0307469_124928382 | 3300031720 | Hardwood Forest Soil | SQLLTLYTTPVIYLAFDWLAHRFSWHIGNPIEEPARGD |
Ga0307475_113250301 | 3300031754 | Hardwood Forest Soil | ILSQLLTLYTTPVVYLAFDWLAHRFSFHVGNPIEEPAPGTAPGD |
Ga0318509_101958532 | 3300031768 | Soil | LILSQILTLYTTPVVYLAFDWLSRRFAFQIGNPTDEAALHQPGD |
Ga0318509_104291302 | 3300031768 | Soil | SQLLTLYTTPVVYLAFDWLGRHLNLGISNPAEEPAAGD |
Ga0318552_106699992 | 3300031782 | Soil | LYTTPVVYLAFDWLSRRFAFQIGNPTDEAALHQPGD |
Ga0318557_103490292 | 3300031795 | Soil | IFSQLLTLYTTPVVYLAFDWLARRFQIHIGNPIEEPAPGD |
Ga0310917_110523202 | 3300031833 | Soil | LLTLYTTPVVYLAFDWLANRLHLGVTNVEEPATGD |
Ga0318570_101745071 | 3300032054 | Soil | LSQLLTLYTTPVVYLAFDWLSRKLRLGITNTLEEPATGD |
Ga0318524_101418922 | 3300032067 | Soil | LLTLYTTPVVYLAFDWLGRHLNLGVANPAEEPLAGD |
Ga0307471_1000571181 | 3300032180 | Hardwood Forest Soil | LTLYTTPVVYLAFDWIARRFGFQANTDLAAEAPAHGD |
Ga0335069_101104511 | 3300032893 | Soil | LILSQLLTLYTTPVVYLAFDWLASRLHLGITNPVDEPAHGD |
Ga0370483_0128020_735_845 | 3300034124 | Untreated Peat Soil | TLYTTPVVYLAFDWLARRFTFRLGNSFSDEELAHGD |
⦗Top⦘ |