NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F097712

Metagenome / Metatranscriptome Family F097712

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F097712
Family Type Metagenome / Metatranscriptome
Number of Sequences 104
Average Sequence Length 38 residues
Representative Sequence LTLYTTPVVYLAFDWLARRFSFHIGNPIEEPAHGD
Number of Associated Samples 89
Number of Associated Scaffolds 104

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.00 %
% of genes near scaffold ends (potentially truncated) 98.08 %
% of genes from short scaffolds (< 2000 bps) 93.27 %
Associated GOLD sequencing projects 85
AlphaFold2 3D model prediction Yes
3D model pTM-score0.34

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (96.154 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil
(25.000 % of family members)
Environment Ontology (ENVO) Unclassified
(28.846 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(45.192 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 30.16%    β-sheet: 0.00%    Coil/Unstructured: 69.84%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.34
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 104 Family Scaffolds
PF00873ACR_tran 98.08
PF02915Rubrerythrin 0.96



 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms97.12 %
UnclassifiedrootN/A2.88 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300002245|JGIcombinedJ26739_100255123All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Chondrichthyes → Elasmobranchii → Selachii → Galeomorphii → Galeoidea → Orectolobiformes → Hemiscylliidae → Chiloscyllium → Chiloscyllium punctatum1641Open in IMG/M
3300004152|Ga0062386_101166101All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae640Open in IMG/M
3300005186|Ga0066676_10186909All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1324Open in IMG/M
3300005434|Ga0070709_11134713All Organisms → cellular organisms → Bacteria626Open in IMG/M
3300005518|Ga0070699_101678382All Organisms → cellular organisms → Bacteria582Open in IMG/M
3300005529|Ga0070741_11690805All Organisms → cellular organisms → Bacteria515Open in IMG/M
3300005537|Ga0070730_10102053All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1984Open in IMG/M
3300005541|Ga0070733_10608414All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae733Open in IMG/M
3300005542|Ga0070732_10962085All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae522Open in IMG/M
3300005558|Ga0066698_10108788All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1837Open in IMG/M
3300005591|Ga0070761_10368750All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae872Open in IMG/M
3300005764|Ga0066903_103504452All Organisms → cellular organisms → Bacteria846Open in IMG/M
3300005764|Ga0066903_104224380All Organisms → cellular organisms → Bacteria768Open in IMG/M
3300006041|Ga0075023_100323581All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae643Open in IMG/M
3300006050|Ga0075028_100779639All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae581Open in IMG/M
3300006052|Ga0075029_101130029All Organisms → cellular organisms → Bacteria545Open in IMG/M
3300006176|Ga0070765_100693007All Organisms → cellular organisms → Bacteria962Open in IMG/M
3300006806|Ga0079220_10994565All Organisms → cellular organisms → Bacteria665Open in IMG/M
3300007076|Ga0075435_100447060All Organisms → cellular organisms → Bacteria1114Open in IMG/M
3300007255|Ga0099791_10526979All Organisms → cellular organisms → Bacteria575Open in IMG/M
3300009137|Ga0066709_103820799All Organisms → cellular organisms → Bacteria547Open in IMG/M
3300009143|Ga0099792_10720284All Organisms → cellular organisms → Bacteria647Open in IMG/M
3300010046|Ga0126384_10541460All Organisms → cellular organisms → Bacteria1010Open in IMG/M
3300010360|Ga0126372_10383093All Organisms → cellular organisms → Bacteria → Proteobacteria1276Open in IMG/M
3300010360|Ga0126372_11295379All Organisms → cellular organisms → Bacteria757Open in IMG/M
3300010360|Ga0126372_12236136All Organisms → cellular organisms → Bacteria596Open in IMG/M
3300010360|Ga0126372_12368998All Organisms → cellular organisms → Bacteria581Open in IMG/M
3300010362|Ga0126377_10983138All Organisms → cellular organisms → Bacteria910Open in IMG/M
3300010366|Ga0126379_13386694All Organisms → cellular organisms → Bacteria534Open in IMG/M
3300010398|Ga0126383_12948869All Organisms → cellular organisms → Bacteria556Open in IMG/M
3300010400|Ga0134122_11342265All Organisms → cellular organisms → Bacteria725Open in IMG/M
3300011269|Ga0137392_10995045All Organisms → cellular organisms → Bacteria689Open in IMG/M
3300012096|Ga0137389_10233160All Organisms → cellular organisms → Bacteria1542Open in IMG/M
3300012202|Ga0137363_10076913All Organisms → cellular organisms → Bacteria2475Open in IMG/M
3300012211|Ga0137377_10152870All Organisms → cellular organisms → Bacteria2211Open in IMG/M
3300012349|Ga0137387_10194786All Organisms → cellular organisms → Bacteria1454Open in IMG/M
3300012361|Ga0137360_10559623All Organisms → cellular organisms → Bacteria977Open in IMG/M
3300012363|Ga0137390_10090845Not Available3012Open in IMG/M
3300012363|Ga0137390_10198756All Organisms → cellular organisms → Bacteria1992Open in IMG/M
3300012917|Ga0137395_10330683All Organisms → cellular organisms → Bacteria1083Open in IMG/M
3300012922|Ga0137394_10247314All Organisms → cellular organisms → Bacteria1524Open in IMG/M
3300012922|Ga0137394_11425002All Organisms → cellular organisms → Bacteria553Open in IMG/M
3300012924|Ga0137413_11799181All Organisms → cellular organisms → Bacteria506Open in IMG/M
3300012925|Ga0137419_10114247All Organisms → cellular organisms → Bacteria1894Open in IMG/M
3300012925|Ga0137419_11513067All Organisms → cellular organisms → Bacteria569Open in IMG/M
3300012927|Ga0137416_12181434All Organisms → cellular organisms → Bacteria509Open in IMG/M
3300012929|Ga0137404_11880746All Organisms → cellular organisms → Bacteria557Open in IMG/M
3300012930|Ga0137407_11503603All Organisms → cellular organisms → Bacteria641Open in IMG/M
3300013308|Ga0157375_11045909All Organisms → cellular organisms → Bacteria954Open in IMG/M
3300015052|Ga0137411_1154568All Organisms → cellular organisms → Bacteria554Open in IMG/M
3300015241|Ga0137418_10667107All Organisms → cellular organisms → Bacteria804Open in IMG/M
3300015356|Ga0134073_10118819All Organisms → cellular organisms → Bacteria803Open in IMG/M
3300015373|Ga0132257_100057741All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae4344Open in IMG/M
3300016404|Ga0182037_10744257All Organisms → cellular organisms → Bacteria842Open in IMG/M
3300016404|Ga0182037_11359594All Organisms → cellular organisms → Bacteria627Open in IMG/M
3300017656|Ga0134112_10334866All Organisms → cellular organisms → Bacteria614Open in IMG/M
3300017930|Ga0187825_10030176All Organisms → cellular organisms → Bacteria1826Open in IMG/M
3300017955|Ga0187817_11102991All Organisms → cellular organisms → Bacteria509Open in IMG/M
3300020170|Ga0179594_10379251All Organisms → cellular organisms → Bacteria537Open in IMG/M
3300020199|Ga0179592_10507118All Organisms → cellular organisms → Bacteria516Open in IMG/M
3300020580|Ga0210403_11025457All Organisms → cellular organisms → Bacteria644Open in IMG/M
3300020580|Ga0210403_11305389All Organisms → cellular organisms → Bacteria554Open in IMG/M
3300021046|Ga0215015_10884863All Organisms → cellular organisms → Bacteria555Open in IMG/M
3300021170|Ga0210400_10937288All Organisms → cellular organisms → Bacteria706Open in IMG/M
3300021170|Ga0210400_11288153All Organisms → cellular organisms → Bacteria586Open in IMG/M
3300021178|Ga0210408_10272580All Organisms → cellular organisms → Bacteria1349Open in IMG/M
3300021180|Ga0210396_10606683All Organisms → cellular organisms → Bacteria951Open in IMG/M
3300021404|Ga0210389_11324684All Organisms → cellular organisms → Bacteria551Open in IMG/M
3300021420|Ga0210394_11737860All Organisms → cellular organisms → Bacteria521Open in IMG/M
3300021432|Ga0210384_11488694All Organisms → cellular organisms → Bacteria582Open in IMG/M
3300021858|Ga0213852_1123910All Organisms → cellular organisms → Bacteria671Open in IMG/M
3300022557|Ga0212123_10241942All Organisms → cellular organisms → Bacteria1302Open in IMG/M
3300025906|Ga0207699_10887462All Organisms → cellular organisms → Bacteria657Open in IMG/M
3300025941|Ga0207711_10616235All Organisms → cellular organisms → Bacteria1013Open in IMG/M
3300026334|Ga0209377_1199271All Organisms → cellular organisms → Bacteria671Open in IMG/M
3300026356|Ga0257150_1060467All Organisms → cellular organisms → Bacteria567Open in IMG/M
3300026496|Ga0257157_1038067All Organisms → cellular organisms → Bacteria800Open in IMG/M
3300026551|Ga0209648_10813701All Organisms → cellular organisms → Bacteria511Open in IMG/M
3300027645|Ga0209117_1011815Not Available2931Open in IMG/M
3300027645|Ga0209117_1123493All Organisms → cellular organisms → Bacteria691Open in IMG/M
3300027738|Ga0208989_10164060All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium 13_1_20CM_2_60_10744Open in IMG/M
3300027787|Ga0209074_10090427All Organisms → cellular organisms → Bacteria1017Open in IMG/M
3300027846|Ga0209180_10194189All Organisms → cellular organisms → Bacteria1171Open in IMG/M
3300027846|Ga0209180_10645453All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria581Open in IMG/M
3300027857|Ga0209166_10270343All Organisms → cellular organisms → Bacteria899Open in IMG/M
3300027903|Ga0209488_10412335All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium999Open in IMG/M
3300028047|Ga0209526_10334979All Organisms → cellular organisms → Bacteria1017Open in IMG/M
3300031090|Ga0265760_10034485All Organisms → cellular organisms → Bacteria1497Open in IMG/M
3300031231|Ga0170824_127436055All Organisms → cellular organisms → Bacteria562Open in IMG/M
3300031549|Ga0318571_10457917All Organisms → cellular organisms → Bacteria507Open in IMG/M
3300031720|Ga0307469_10929935All Organisms → cellular organisms → Bacteria807Open in IMG/M
3300031720|Ga0307469_12348886All Organisms → cellular organisms → Bacteria520Open in IMG/M
3300031720|Ga0307469_12492838All Organisms → cellular organisms → Bacteria505Open in IMG/M
3300031754|Ga0307475_11325030All Organisms → cellular organisms → Bacteria557Open in IMG/M
3300031768|Ga0318509_10195853All Organisms → cellular organisms → Bacteria1123Open in IMG/M
3300031768|Ga0318509_10429130All Organisms → cellular organisms → Bacteria739Open in IMG/M
3300031782|Ga0318552_10669999All Organisms → cellular organisms → Bacteria529Open in IMG/M
3300031795|Ga0318557_10349029All Organisms → cellular organisms → Bacteria680Open in IMG/M
3300031833|Ga0310917_11052320All Organisms → cellular organisms → Bacteria544Open in IMG/M
3300032054|Ga0318570_10174507All Organisms → cellular organisms → Bacteria967Open in IMG/M
3300032067|Ga0318524_10141892All Organisms → cellular organisms → Bacteria1211Open in IMG/M
3300032180|Ga0307471_100057118Not Available3265Open in IMG/M
3300032893|Ga0335069_10110451All Organisms → cellular organisms → Bacteria3458Open in IMG/M
3300034124|Ga0370483_0128020All Organisms → cellular organisms → Bacteria846Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil25.00%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil18.27%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil7.69%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil4.81%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil4.81%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil4.81%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds2.88%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil2.88%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere2.88%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment1.92%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil1.92%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil1.92%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil1.92%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil1.92%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil1.92%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil1.92%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil1.92%
WatershedsEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds0.96%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil0.96%
Iron-Sulfur Acid SpringEnvironmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring0.96%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil0.96%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil0.96%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil0.96%
Untreated Peat SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil0.96%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.96%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere0.96%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.96%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.96%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300002245Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027)EnvironmentalOpen in IMG/M
3300004152Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3EnvironmentalOpen in IMG/M
3300005186Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125EnvironmentalOpen in IMG/M
3300005434Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaGEnvironmentalOpen in IMG/M
3300005518Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaGEnvironmentalOpen in IMG/M
3300005529Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1EnvironmentalOpen in IMG/M
3300005537Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1EnvironmentalOpen in IMG/M
3300005541Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1EnvironmentalOpen in IMG/M
3300005542Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1EnvironmentalOpen in IMG/M
3300005558Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147EnvironmentalOpen in IMG/M
3300005591Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1EnvironmentalOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300006041Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014EnvironmentalOpen in IMG/M
3300006050Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014EnvironmentalOpen in IMG/M
3300006052Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013EnvironmentalOpen in IMG/M
3300006176Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5EnvironmentalOpen in IMG/M
3300006806Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100EnvironmentalOpen in IMG/M
3300007076Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4Host-AssociatedOpen in IMG/M
3300007255Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1EnvironmentalOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300009143Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2EnvironmentalOpen in IMG/M
3300010046Tropical forest soil microbial communities from Panama - MetaG Plot_36EnvironmentalOpen in IMG/M
3300010360Tropical forest soil microbial communities from Panama - MetaG Plot_6EnvironmentalOpen in IMG/M
3300010362Tropical forest soil microbial communities from Panama - MetaG Plot_22EnvironmentalOpen in IMG/M
3300010366Tropical forest soil microbial communities from Panama - MetaG Plot_24EnvironmentalOpen in IMG/M
3300010398Tropical forest soil microbial communities from Panama - MetaG Plot_35EnvironmentalOpen in IMG/M
3300010400Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2EnvironmentalOpen in IMG/M
3300011269Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaGEnvironmentalOpen in IMG/M
3300012096Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaGEnvironmentalOpen in IMG/M
3300012202Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaGEnvironmentalOpen in IMG/M
3300012211Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaGEnvironmentalOpen in IMG/M
3300012349Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaGEnvironmentalOpen in IMG/M
3300012361Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaGEnvironmentalOpen in IMG/M
3300012363Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaGEnvironmentalOpen in IMG/M
3300012917Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaGEnvironmentalOpen in IMG/M
3300012922Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaGEnvironmentalOpen in IMG/M
3300012924Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012925Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012927Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012929Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012930Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300013308Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaGHost-AssociatedOpen in IMG/M
3300015052Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (PacBio error correction)EnvironmentalOpen in IMG/M
3300015241Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300015356Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300016404Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082EnvironmentalOpen in IMG/M
3300017656Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_11112015EnvironmentalOpen in IMG/M
3300017930Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_5EnvironmentalOpen in IMG/M
3300017955Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2EnvironmentalOpen in IMG/M
3300020170Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_1_08_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300020199Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300020580Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-MEnvironmentalOpen in IMG/M
3300021046Soil microbial communities from Shale Hills CZO, Pennsylvania, United States - 90cm depthEnvironmentalOpen in IMG/M
3300021170Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-MEnvironmentalOpen in IMG/M
3300021178Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-MEnvironmentalOpen in IMG/M
3300021180Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-OEnvironmentalOpen in IMG/M
3300021404Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-OEnvironmentalOpen in IMG/M
3300021420Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-MEnvironmentalOpen in IMG/M
3300021432Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-MEnvironmentalOpen in IMG/M
3300021858Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300022557Paint Pots_combined assemblyEnvironmentalOpen in IMG/M
3300025906Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025941Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026334Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 (SPAdes)EnvironmentalOpen in IMG/M
3300026356Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-13-AEnvironmentalOpen in IMG/M
3300026496Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-69-AEnvironmentalOpen in IMG/M
3300026551Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes)EnvironmentalOpen in IMG/M
3300027645Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 (SPAdes)EnvironmentalOpen in IMG/M
3300027738Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300027787Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter (SPAdes)EnvironmentalOpen in IMG/M
3300027846Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027857Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027903Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes)EnvironmentalOpen in IMG/M
3300028047Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300031090Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031231Coassembly Site 11 (all samples) - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031549Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f24EnvironmentalOpen in IMG/M
3300031720Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515EnvironmentalOpen in IMG/M
3300031754Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515EnvironmentalOpen in IMG/M
3300031768Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22EnvironmentalOpen in IMG/M
3300031782Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f20EnvironmentalOpen in IMG/M
3300031795Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f19EnvironmentalOpen in IMG/M
3300031833Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178EnvironmentalOpen in IMG/M
3300032054Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f23EnvironmentalOpen in IMG/M
3300032067Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f22EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300032893Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1EnvironmentalOpen in IMG/M
3300034124Peat soil microbial communities from wetlands in Alaska, United States - Goldstream_06D_14EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGIcombinedJ26739_10025512323300002245Forest SoilLSQLLTLYTTPVVYLAFDWLANRLHLGITNPVDEPATGD*
Ga0062386_10116610113300004152Bog Forest SoilLILSQVLTLYTTPVVYLAFDWLATRLHLGISNAADEPAPGD*
Ga0066676_1018690913300005186SoilLSQLLTLYTTPVVYLAFDWLARRFAFHIGNPIEEPAHGD*
Ga0070709_1113471313300005434Corn, Switchgrass And Miscanthus RhizosphereSQILTLYTTPVVYLAFDWLSRHVPLGFGNPIDEPAAEHSGD*
Ga0070699_10167838223300005518Corn, Switchgrass And Miscanthus RhizosphereLSQILTLYTTPVVYLAFDWLSRHVPLGFGNPIDEPAAEHSGD*
Ga0070741_1169080513300005529Surface SoilLLTLYTTPVVYLAFDRLAQRFARFRIGNPIDEPAGAD*
Ga0070730_1010205313300005537Surface SoilILTLYTTPVVYLAFDWLSRRFAFHLGNPIDEAAAQDYGD*
Ga0070733_1060841423300005541Surface SoilSQLLTLYTTPVVYLAFDWLSHRFEVQIGNPIEEPAHGD*
Ga0070732_1096208523300005542Surface SoilSQLLTLYTTPVVYLAFDWLARRFAVHIGNPVEEPAHGD*
Ga0066698_1010878813300005558SoilLILSQLLTLYTTPVIYLAFDWLARRFAFHVGNPIEEPATGD*
Ga0070761_1036875023300005591SoilSQLLTLYTTPVVYLAFDWLARRFAFNIGNSIEEPAHGD*
Ga0066903_10350445213300005764Tropical Forest SoilLILSQLLTLYTTPVVYLAFDWLANRLNLGISNPVDEPVQGD*
Ga0066903_10422438023300005764Tropical Forest SoilIVSQLLTLYTTPVVYLAFDWLGRHLNLGVANPAEEPLAGD*
Ga0075023_10032358123300006041WatershedsILSQLLTLYTTPVVYLAFDWLAHRFSFHIGNPTEEPATGD*
Ga0075028_10077963913300006050WatershedsLILSQLLTLYTTPVVYLAFDWLAHRFSFRVGNPIEEPAHGTAPGD*
Ga0075029_10113002923300006052WatershedsTLYTTPVVYLAFDWLASRLHLGISNPIDEPSPGD*
Ga0070765_10069300723300006176SoilLSQLLTLYTTPVVYLAFDWLAHRFEARIGGPVEEPAHGD*
Ga0079220_1099456523300006806Agricultural SoilVLTLYTTPVVYLAFDWLARRFAVHFGNPVEQPAHGD*
Ga0075435_10044706013300007076Populus RhizosphereLTLYTTPVVYLAFDWLANRLHLGITNTADEAALGD*
Ga0099791_1052697923300007255Vadose Zone SoilLLTLYTTPVVYLAFDWLGRRFAFQIGNPIEEPAHGD*
Ga0066709_10382079923300009137Grasslands SoilLLTLYTTPVVYLAFDWLGRRFAFHVGNPIEAPAHGD*
Ga0099792_1072028423300009143Vadose Zone SoilTLYTTPVVYLAFDWLGRRFAFHVGNPIEEPAPGD*
Ga0126384_1054146023300010046Tropical Forest SoilQLLTLYTTPVVYLAFDRLARRFSRYRIGNPIEGSATAD*
Ga0126372_1038309313300010360Tropical Forest SoilLTLYTTPVVYLAFERLGRRFERFRIGNRIEEPAVAE*
Ga0126372_1129537923300010360Tropical Forest SoilTLYTTPVVYLAFDWLGRRFQFHVGNPIEEPAHGD*
Ga0126372_1223613613300010360Tropical Forest SoilQILTLYTTPVVYLAFDWLARRFAFRVGNPIEEPAHGD*
Ga0126372_1236899813300010360Tropical Forest SoilQLLTLYTTPVVYLAFDRLARRFSRYRIGNPIEGAATAD*
Ga0126377_1098313823300010362Tropical Forest SoilILTLYTTPVVYLAFDWLARRFAFRVGNPIEEPAHGD*
Ga0126379_1338669413300010366Tropical Forest SoilLLTLYTTPVVYLAFDWLGRRFQFHVGNPIEEPAHGD*
Ga0126383_1294886923300010398Tropical Forest SoilLTLYTTPVVYLAFDWLASRLNLGISNPMDEPAHGD*
Ga0134122_1134226523300010400Terrestrial SoilLTLYTTPVVYLAFDWLSRRFAFNIGNPVDDAALHQPGD*
Ga0137392_1099504523300011269Vadose Zone SoilILSQLLTLYTTPVVYLAFDWLARRFQIQIGNPIEEPAPGD*
Ga0137389_1023316023300012096Vadose Zone SoilLILSQLLTLYTTPVVYLAFDWLANRLHLGISNPLDEPATGD*
Ga0137363_1007691313300012202Vadose Zone SoilQLLTLYTTPVVYLAFDWLGRRFAFHVGNPIEEPAAGD*
Ga0137377_1015287013300012211Vadose Zone SoilTTPVVYLAFDWLAHRFSFHVGNPIEEPAHGSVPGD*
Ga0137387_1019478623300012349Vadose Zone SoilLLTLYTTPVVYLAFDWLGRRFAFHVGNPIEEPAHGD*
Ga0137360_1055962313300012361Vadose Zone SoilLYTTPVVYLAFDWLSRRFSLGFGNPIDDPAVEHYGD*
Ga0137390_1009084513300012363Vadose Zone SoilTLYTTPVVYLAFDWLGRRFAFRIGNPVEEPAHGD*
Ga0137390_1019875623300012363Vadose Zone SoilLLTLYTTPVVYLAFDWLGRRFAFHVGNPIEEPATGD*
Ga0137395_1033068323300012917Vadose Zone SoilLYTTPVVYLAFDWVAHRFQFHVGNPIEDPAGAAGN*
Ga0137394_1024731423300012922Vadose Zone SoilQILTLYTTPVVYLAFDWLSRHLPLGFGNPMDEPAVEHSGD*
Ga0137394_1142500223300012922Vadose Zone SoilLTLYTTPVVYLAFDWLANRLHLGITNSIDEPATGD*
Ga0137413_1179918123300012924Vadose Zone SoilVLTLYTTPVVYLAFDWLSRRFSLGFGNPIDDPAVEHYGD*
Ga0137419_1011424723300012925Vadose Zone SoilLTLYTTPVVYLAFDWLGRRFAFHVGNPIEAPAHGD*
Ga0137419_1151306723300012925Vadose Zone SoilLILSQILTLYTTPVVYLAFDWIAHRFQFHIGNPIEDAPGAAGD*
Ga0137416_1218143413300012927Vadose Zone SoilQILTLYTTPVVYLAFDWLARRFAFHIGNPVEEPAHGD*
Ga0137404_1188074613300012929Vadose Zone SoilQLLTLYTTPVIYLAFDWLAHRFSWHIGNPIEEPARGD*
Ga0137407_1150360323300012930Vadose Zone SoilLYTTPVVYLAFDWLAHRFSFHVGNPAEEPAHESAPGD*
Ga0157375_1104590923300013308Miscanthus RhizosphereQILTLYTTPVVYLAFDWLSRRFSFRLGNPIDEAALHQPGD*
Ga0137411_115456813300015052Vadose Zone SoilLTLYTTPVVYLAFDWIAHRFQFHIGNPVEDPAPGD*
Ga0137418_1066710713300015241Vadose Zone SoilILSQLLTLYTTPVVYLAFDWLGRRFAFHVGNPIEAPAHGD*
Ga0134073_1011881913300015356Grasslands SoilSQLLTLYTTPVVYLAFDWLSRRFEFHIGNPIEEPSPGD*
Ga0132257_10005774113300015373Arabidopsis RhizosphereLSQILTLYTPPVVYLAFDWLSRRFSFHIGNPMDEAALHQPGD*
Ga0182037_1074425713300016404SoilQLLTLYTTPVVYLAFDWLGRHLNLGFTNSAEEPAAGD
Ga0182037_1135959413300016404SoilLYTTPVVYLAFDWLSRHINFGFTNPIDDPAVEHGD
Ga0134112_1033486613300017656Grasslands SoilLTLYTTPVVYLAFDWLARRFSFHIGNPIEEPAHGD
Ga0187825_1003017613300017930Freshwater SedimentQLLTLYTTPVVYLAFDRLASRFARYRIGNPIEGSATAD
Ga0187817_1110299113300017955Freshwater SedimentLSQLLTLYTTPVVYLAFDWLAHRFAVHIGNPIEEPAHGD
Ga0179594_1037925113300020170Vadose Zone SoilLLTLYTTPVVYLAFDRLGKRFSRFRVGNPIEETVVVE
Ga0179592_1050711823300020199Vadose Zone SoilSQLLTLYTTPVVYLAFDWLANRLHLGISNPIDEPATGD
Ga0210403_1102545723300020580SoilLTLYTTPVVYLAFDWLANRLHLGIANPVDEPATGD
Ga0210403_1130538913300020580SoilILSQLLTLYTTPVVYLAFDWLAHRFSFHVGNPVDEPAHESAPGD
Ga0215015_1088486323300021046SoilLTLYTTPVVYLAFDWLGRRFQIHIGSSVEEPAHGD
Ga0210400_1093728813300021170SoilLYTTPVVYLAFDWLAHRFSFHVGNPIEEPVPGTAPGD
Ga0210400_1128815313300021170SoilQVLTLYTTPVVYLAFDWLANRLHLGITNTADEAALGD
Ga0210408_1027258023300021178SoilLSQLLTLYTTPVVYLAFDWLASRLHLGIANPIDEPATGD
Ga0210396_1060668323300021180SoilSQLLTLYTTPVVYLAFDWLARRFAFQIGNSIEEPAHGD
Ga0210389_1132468413300021404SoilILSQLLTLYTTPVVYLAFDWLSHRFTFNFGNSVPTEEISHGD
Ga0210394_1173786023300021420SoilQLLSLYATPVVYLAFDWLASRLHLGITNPIDEPATGD
Ga0210384_1148869413300021432SoilYTTPVVYLAFDWLAHRFSFHVGNPIEEPAPGTAPGD
Ga0213852_112391023300021858WatershedsLTLYTTPVVYLAFDWLGRRFSFRVGNPIEEPAPESLSGD
Ga0212123_1024194223300022557Iron-Sulfur Acid SpringLSQLLTLYTTPVVYLAFDWLARRFTFRFGNSFSDEELAHGD
Ga0207699_1088746223300025906Corn, Switchgrass And Miscanthus RhizosphereTLYTTPVVYLAFDWLSRHVPLGFGNPIDEPAAEHSGD
Ga0207711_1061623523300025941Switchgrass RhizosphereLYTTPVVYLAFDWLSRRFAFNIGNPVDDAALHQPGD
Ga0209377_119927123300026334SoilLTLYTTPVVYLAFDWLGRRFAFNIGNPIEEPAPGD
Ga0257150_106046713300026356SoilLSQLLTLYTTPVVYLAFDWLANRLHLGITNPVDEPATGD
Ga0257157_103806713300026496SoilLTLYTTPVVYLAFDWLAHRFAFRVGNPIEEPAHGTAPGD
Ga0209648_1081370113300026551Grasslands SoilQLLTLYTTPVVYLAFDWLGRRFAFHVGNPIEEPAPGD
Ga0209117_101181523300027645Forest SoilWLTLYTTPVVYLAFDWLARRFSFHFGNPVEEPAPGTASGD
Ga0209117_112349313300027645Forest SoilSQVLTLYTTPVVYLAFDWLSRRFSLGFANPIDDPAVEHYGD
Ga0208989_1016406013300027738Forest SoilILSQLLTLYTTPVVYLAFDWLGRRFAFHIGNPIEEPAHGD
Ga0209074_1009042723300027787Agricultural SoilQLLTLYTTPVVYLAFDRLARKLQRFRVGNRIDETATQSV
Ga0209180_1019418913300027846Vadose Zone SoilSQLLTLYTTPVVYLAFDWLGRRFAFHVGNPIEEPATGD
Ga0209180_1064545323300027846Vadose Zone SoilTLYTTPVVYLAFDWIAHRFQFHIGNPIEDPAGAAGD
Ga0209166_1027034313300027857Surface SoilILTLYTTPVVYLAFDWLSRRFAFHLGNPIDEAAAQDYGD
Ga0209488_1041233533300027903Vadose Zone SoilLSQLLTLYTTPVVYLAFDWLARRFAFHVGNPIEEPAQGAIPGD
Ga0209526_1033497913300028047Forest SoilTLYTTPVVYLAFDWLAHRFSFHVGNPIEEPAHGSAPGD
Ga0265760_1003448523300031090SoilLSQLLTLYTTPVVYLAFDWLAHRFAFQIGNSFEEPAHGD
Ga0170824_12743605513300031231Forest SoilLSQILTLYTTPVVYLAFDWVARRFQFHIGNPIEDAAGATGD
Ga0318571_1045791713300031549SoilILSQILTLYTTPVVYLAFDWLSRRFTFTLGNPIEEAARQHYGD
Ga0307469_1092993523300031720Hardwood Forest SoilSQLLTLYTTPVVYLAFERLGRRFERFRVGNRIEEPAVAE
Ga0307469_1234888613300031720Hardwood Forest SoilLSQLLTLYTTPVIYLAFDWLAHRFSWHIGNPIEEPAPGD
Ga0307469_1249283823300031720Hardwood Forest SoilSQLLTLYTTPVIYLAFDWLAHRFSWHIGNPIEEPARGD
Ga0307475_1132503013300031754Hardwood Forest SoilILSQLLTLYTTPVVYLAFDWLAHRFSFHVGNPIEEPAPGTAPGD
Ga0318509_1019585323300031768SoilLILSQILTLYTTPVVYLAFDWLSRRFAFQIGNPTDEAALHQPGD
Ga0318509_1042913023300031768SoilSQLLTLYTTPVVYLAFDWLGRHLNLGISNPAEEPAAGD
Ga0318552_1066999923300031782SoilLYTTPVVYLAFDWLSRRFAFQIGNPTDEAALHQPGD
Ga0318557_1034902923300031795SoilIFSQLLTLYTTPVVYLAFDWLARRFQIHIGNPIEEPAPGD
Ga0310917_1105232023300031833SoilLLTLYTTPVVYLAFDWLANRLHLGVTNVEEPATGD
Ga0318570_1017450713300032054SoilLSQLLTLYTTPVVYLAFDWLSRKLRLGITNTLEEPATGD
Ga0318524_1014189223300032067SoilLLTLYTTPVVYLAFDWLGRHLNLGVANPAEEPLAGD
Ga0307471_10005711813300032180Hardwood Forest SoilLTLYTTPVVYLAFDWIARRFGFQANTDLAAEAPAHGD
Ga0335069_1011045113300032893SoilLILSQLLTLYTTPVVYLAFDWLASRLHLGITNPVDEPAHGD
Ga0370483_0128020_735_8453300034124Untreated Peat SoilTLYTTPVVYLAFDWLARRFTFRLGNSFSDEELAHGD


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.