


| Basic Information | |
|---|---|
| Family ID | F097635 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 104 |
| Average Sequence Length | 47 residues |
| Representative Sequence | MSLNLDIDSLPPEKVEAAITRLEAMKAQRAAENKLAHYRPYPK |
| Number of Associated Samples | 92 |
| Number of Associated Scaffolds | 104 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 43.27 % |
| % of genes near scaffold ends (potentially truncated) | 99.04 % |
| % of genes from short scaffolds (< 2000 bps) | 93.27 % |
| Associated GOLD sequencing projects | 90 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.45 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (53.846 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (21.154 % of family members) |
| Environment Ontology (ENVO) | Unclassified (35.577 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (47.115 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 39.44% β-sheet: 0.00% Coil/Unstructured: 60.56% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.45 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 104 Family Scaffolds |
|---|---|---|
| PF03401 | TctC | 4.81 |
| PF04392 | ABC_sub_bind | 3.85 |
| PF00589 | Phage_integrase | 1.92 |
| PF00072 | Response_reg | 0.96 |
| PF00239 | Resolvase | 0.96 |
| PF13546 | DDE_5 | 0.96 |
| PF13557 | Phenol_MetA_deg | 0.96 |
| PF13489 | Methyltransf_23 | 0.96 |
| PF13185 | GAF_2 | 0.96 |
| COG ID | Name | Functional Category | % Frequency in 104 Family Scaffolds |
|---|---|---|---|
| COG3181 | Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctC | Energy production and conversion [C] | 4.81 |
| COG2984 | ABC-type uncharacterized transport system, periplasmic component | General function prediction only [R] | 3.85 |
| COG1961 | Site-specific DNA recombinase SpoIVCA/DNA invertase PinE | Replication, recombination and repair [L] | 0.96 |
| COG2452 | Predicted site-specific integrase-resolvase | Mobilome: prophages, transposons [X] | 0.96 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 53.85 % |
| Unclassified | root | N/A | 46.15 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2209111022|2221188366 | Not Available | 518 | Open in IMG/M |
| 3300001431|F14TB_100471769 | Not Available | 505 | Open in IMG/M |
| 3300001976|JGI24752J21851_1031867 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 697 | Open in IMG/M |
| 3300002075|JGI24738J21930_10107884 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 598 | Open in IMG/M |
| 3300002077|JGI24744J21845_10036246 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 931 | Open in IMG/M |
| 3300002244|JGI24742J22300_10003697 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 2484 | Open in IMG/M |
| 3300005158|Ga0066816_1023219 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 534 | Open in IMG/M |
| 3300005168|Ga0066809_10225834 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 515 | Open in IMG/M |
| 3300005332|Ga0066388_101782772 | All Organisms → cellular organisms → Bacteria | 1093 | Open in IMG/M |
| 3300005332|Ga0066388_104222942 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 732 | Open in IMG/M |
| 3300005332|Ga0066388_105871477 | Not Available | 620 | Open in IMG/M |
| 3300005363|Ga0008090_10210274 | Not Available | 633 | Open in IMG/M |
| 3300005440|Ga0070705_100325750 | Not Available | 1111 | Open in IMG/M |
| 3300005447|Ga0066689_10802918 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 585 | Open in IMG/M |
| 3300005615|Ga0070702_100384760 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 999 | Open in IMG/M |
| 3300005713|Ga0066905_102315359 | Not Available | 502 | Open in IMG/M |
| 3300005718|Ga0068866_10025358 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2786 | Open in IMG/M |
| 3300005764|Ga0066903_102716861 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 960 | Open in IMG/M |
| 3300005840|Ga0068870_10691477 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 703 | Open in IMG/M |
| 3300006050|Ga0075028_100063301 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium nanningense | 1810 | Open in IMG/M |
| 3300006051|Ga0075364_10554577 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 785 | Open in IMG/M |
| 3300006196|Ga0075422_10185722 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 848 | Open in IMG/M |
| 3300006844|Ga0075428_101820124 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 634 | Open in IMG/M |
| 3300006904|Ga0075424_101515428 | Not Available | 711 | Open in IMG/M |
| 3300009011|Ga0105251_10356676 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 668 | Open in IMG/M |
| 3300009100|Ga0075418_10563256 | Not Available | 1225 | Open in IMG/M |
| 3300010043|Ga0126380_11347030 | Not Available | 624 | Open in IMG/M |
| 3300010046|Ga0126384_11095797 | Not Available | 730 | Open in IMG/M |
| 3300010046|Ga0126384_12418740 | Not Available | 509 | Open in IMG/M |
| 3300010047|Ga0126382_10342325 | Not Available | 1142 | Open in IMG/M |
| 3300010359|Ga0126376_13184981 | Not Available | 508 | Open in IMG/M |
| 3300010361|Ga0126378_10536189 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 1285 | Open in IMG/M |
| 3300010362|Ga0126377_12898929 | Not Available | 553 | Open in IMG/M |
| 3300010376|Ga0126381_101673808 | Not Available | 919 | Open in IMG/M |
| 3300010398|Ga0126383_10721060 | Not Available | 1076 | Open in IMG/M |
| 3300010398|Ga0126383_11161489 | Not Available | 862 | Open in IMG/M |
| 3300011119|Ga0105246_12269219 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 530 | Open in IMG/M |
| 3300012207|Ga0137381_11549176 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 554 | Open in IMG/M |
| 3300012897|Ga0157285_10344408 | Not Available | 521 | Open in IMG/M |
| 3300012903|Ga0157289_10285566 | Not Available | 577 | Open in IMG/M |
| 3300012911|Ga0157301_10245860 | Not Available | 627 | Open in IMG/M |
| 3300012986|Ga0164304_11503153 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 557 | Open in IMG/M |
| 3300012989|Ga0164305_11363544 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 623 | Open in IMG/M |
| 3300013306|Ga0163162_10808307 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1055 | Open in IMG/M |
| 3300015372|Ga0132256_102908618 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 576 | Open in IMG/M |
| 3300015372|Ga0132256_103009583 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 567 | Open in IMG/M |
| 3300016341|Ga0182035_11483309 | Not Available | 610 | Open in IMG/M |
| 3300016371|Ga0182034_10167631 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1668 | Open in IMG/M |
| 3300016371|Ga0182034_11201999 | Not Available | 659 | Open in IMG/M |
| 3300016387|Ga0182040_11223483 | Not Available | 632 | Open in IMG/M |
| 3300016404|Ga0182037_11242006 | Not Available | 655 | Open in IMG/M |
| 3300016422|Ga0182039_10604270 | Not Available | 959 | Open in IMG/M |
| 3300016445|Ga0182038_10988560 | Not Available | 745 | Open in IMG/M |
| 3300017792|Ga0163161_10730710 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 827 | Open in IMG/M |
| 3300018073|Ga0184624_10150285 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 1023 | Open in IMG/M |
| 3300018468|Ga0066662_10220668 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 1520 | Open in IMG/M |
| 3300019361|Ga0173482_10536109 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 575 | Open in IMG/M |
| 3300021560|Ga0126371_13185196 | Not Available | 555 | Open in IMG/M |
| 3300025898|Ga0207692_11091878 | Not Available | 528 | Open in IMG/M |
| 3300025923|Ga0207681_11512650 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 563 | Open in IMG/M |
| 3300025926|Ga0207659_11104425 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 682 | Open in IMG/M |
| 3300025936|Ga0207670_10101194 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2059 | Open in IMG/M |
| 3300025949|Ga0207667_11512674 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 642 | Open in IMG/M |
| 3300025981|Ga0207640_10532308 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 984 | Open in IMG/M |
| 3300025981|Ga0207640_10986345 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 740 | Open in IMG/M |
| 3300026023|Ga0207677_10417303 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 1142 | Open in IMG/M |
| 3300026088|Ga0207641_11653279 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 642 | Open in IMG/M |
| 3300026116|Ga0207674_10940923 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 832 | Open in IMG/M |
| 3300026538|Ga0209056_10460108 | Not Available | 708 | Open in IMG/M |
| 3300027866|Ga0209813_10190149 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 755 | Open in IMG/M |
| 3300027874|Ga0209465_10553142 | Not Available | 572 | Open in IMG/M |
| 3300028793|Ga0307299_10093391 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 1123 | Open in IMG/M |
| 3300028819|Ga0307296_10361487 | Not Available | 793 | Open in IMG/M |
| 3300028876|Ga0307286_10220567 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Methylorubrum → Methylorubrum populi | 691 | Open in IMG/M |
| 3300031545|Ga0318541_10187492 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1143 | Open in IMG/M |
| 3300031561|Ga0318528_10019921 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 3190 | Open in IMG/M |
| 3300031561|Ga0318528_10692350 | Not Available | 545 | Open in IMG/M |
| 3300031573|Ga0310915_10416330 | Not Available | 954 | Open in IMG/M |
| 3300031640|Ga0318555_10080980 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 1690 | Open in IMG/M |
| 3300031681|Ga0318572_10826594 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 550 | Open in IMG/M |
| 3300031719|Ga0306917_10013049 | All Organisms → cellular organisms → Bacteria | 4861 | Open in IMG/M |
| 3300031723|Ga0318493_10864014 | Not Available | 511 | Open in IMG/M |
| 3300031724|Ga0318500_10003454 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 4784 | Open in IMG/M |
| 3300031744|Ga0306918_10128899 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1843 | Open in IMG/M |
| 3300031763|Ga0318537_10382242 | Not Available | 519 | Open in IMG/M |
| 3300031778|Ga0318498_10390241 | Not Available | 619 | Open in IMG/M |
| 3300031793|Ga0318548_10176336 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1046 | Open in IMG/M |
| 3300031821|Ga0318567_10804528 | Not Available | 532 | Open in IMG/M |
| 3300031879|Ga0306919_10247884 | Not Available | 1339 | Open in IMG/M |
| 3300031879|Ga0306919_10670064 | Not Available | 799 | Open in IMG/M |
| 3300031879|Ga0306919_10849530 | Not Available | 700 | Open in IMG/M |
| 3300031890|Ga0306925_10328432 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1643 | Open in IMG/M |
| 3300031942|Ga0310916_11300343 | Not Available | 598 | Open in IMG/M |
| 3300031954|Ga0306926_10071214 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 4208 | Open in IMG/M |
| 3300031954|Ga0306926_11163242 | Not Available | 908 | Open in IMG/M |
| 3300031981|Ga0318531_10332528 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 687 | Open in IMG/M |
| 3300032041|Ga0318549_10505886 | Not Available | 543 | Open in IMG/M |
| 3300032044|Ga0318558_10606720 | Not Available | 547 | Open in IMG/M |
| 3300032059|Ga0318533_10442839 | Not Available | 950 | Open in IMG/M |
| 3300032065|Ga0318513_10449570 | Not Available | 630 | Open in IMG/M |
| 3300032067|Ga0318524_10791656 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7 | 501 | Open in IMG/M |
| 3300032068|Ga0318553_10273823 | Not Available | 882 | Open in IMG/M |
| 3300032068|Ga0318553_10416901 | Not Available | 703 | Open in IMG/M |
| 3300033290|Ga0318519_10166579 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 35 | 1241 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 21.15% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 14.42% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 10.58% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 8.65% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 5.77% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 4.81% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 3.85% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.88% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 2.88% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 2.88% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.92% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.92% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.92% |
| Populus Endosphere | Host-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere | 1.92% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 1.92% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.96% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.96% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 0.96% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil | 0.96% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.96% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.96% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.96% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.96% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.96% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.96% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.96% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.96% |
| Tropical Rainforest Soil | Environmental → Terrestrial → Soil → Unclassified → Tropical Rainforest → Tropical Rainforest Soil | 0.96% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2209111022 | Grass soil microbial communities from Rothamsted Park, UK - Chitin enrichment | Environmental | Open in IMG/M |
| 3300001431 | Amended soil microbial communities from Kansas Great Prairies, USA - BrdU F1.4TB clc assemly | Environmental | Open in IMG/M |
| 3300001976 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 | Host-Associated | Open in IMG/M |
| 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Host-Associated | Open in IMG/M |
| 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Host-Associated | Open in IMG/M |
| 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Host-Associated | Open in IMG/M |
| 3300005158 | Soil and rhizosphere microbial communities from Laval, Canada - mgHAA | Environmental | Open in IMG/M |
| 3300005168 | Soil and rhizosphere microbial communities from Laval, Canada - mgLPC | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005363 | Tropical rainforest soil microbial communities from the Amazon Forest, Brazil, analyzing deforestation - Metatranscriptome F II A100 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
| 3300005447 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 | Environmental | Open in IMG/M |
| 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Environmental | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Host-Associated | Open in IMG/M |
| 3300006050 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014 | Environmental | Open in IMG/M |
| 3300006051 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Host-Associated | Open in IMG/M |
| 3300006196 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 | Host-Associated | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Host-Associated | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Host-Associated | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012897 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S074-202C-1 | Environmental | Open in IMG/M |
| 3300012903 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S134-311R-1 | Environmental | Open in IMG/M |
| 3300012911 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S088-202R-2 | Environmental | Open in IMG/M |
| 3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
| 3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Host-Associated | Open in IMG/M |
| 3300018073 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_b1 | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300019361 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2) | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026538 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes) | Environmental | Open in IMG/M |
| 3300027866 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027874 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300028793 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_159 | Environmental | Open in IMG/M |
| 3300028819 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_153 | Environmental | Open in IMG/M |
| 3300028876 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_140 | Environmental | Open in IMG/M |
| 3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
| 3300031561 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26 | Environmental | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031640 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23 | Environmental | Open in IMG/M |
| 3300031681 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20 | Environmental | Open in IMG/M |
| 3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
| 3300031723 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23 | Environmental | Open in IMG/M |
| 3300031724 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20 | Environmental | Open in IMG/M |
| 3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
| 3300031763 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f29 | Environmental | Open in IMG/M |
| 3300031778 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f24 | Environmental | Open in IMG/M |
| 3300031793 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f21 | Environmental | Open in IMG/M |
| 3300031821 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f20 | Environmental | Open in IMG/M |
| 3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300031981 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f25 | Environmental | Open in IMG/M |
| 3300032041 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f22 | Environmental | Open in IMG/M |
| 3300032044 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f20 | Environmental | Open in IMG/M |
| 3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
| 3300032065 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f20 | Environmental | Open in IMG/M |
| 3300032067 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f22 | Environmental | Open in IMG/M |
| 3300032068 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f21 | Environmental | Open in IMG/M |
| 3300033290 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| 2222001428 | 2209111022 | Grass Soil | MGLAMSLNLDIDSLPPEQVEAAITRLEAMKAQRAAENKLAH |
| F14TB_1004717691 | 3300001431 | Soil | MSLNIDIDSLPPDKVEAAITRLEAVKAQRVAENKLAHYRPYPKQ |
| JGI24752J21851_10318673 | 3300001976 | Corn, Switchgrass And Miscanthus Rhizosphere | MSLNLDIDSLPPEQVEAAITRLEMMKAQRAAKNKLAHYR |
| JGI24738J21930_101078841 | 3300002075 | Corn Rhizosphere | MGLAMSLNLDIDSLPPEQVEAAITRLEMMKAQRAAKISLHTI |
| JGI24744J21845_100362464 | 3300002077 | Corn, Switchgrass And Miscanthus Rhizosphere | MGLAMSLNLDIDSLPPEQVEAAITRLEMMKAQRAAKNKLAHYRPYPKQVA |
| JGI24742J22300_100036971 | 3300002244 | Corn, Switchgrass And Miscanthus Rhizosphere | MGLAMSLNLDIDSLPPEQVEAAITRLEMMKAQRAAKNKLAHYRPYPKQVAFHAAGAR |
| Ga0066816_10232192 | 3300005158 | Soil | MGLAMSLNLDIDSLPPEKVEAAITRLEAMKAQRAAENKLAHYRPYPKQVAFH |
| Ga0066809_102258342 | 3300005168 | Soil | MGLAMSLNLDIDSLPPEQVEAAITRLEAMKAQRATENKLAHYRPYPKQVAFHAAGVRC |
| Ga0066388_1017827721 | 3300005332 | Tropical Forest Soil | MSLNLDIDSLPPEKVEAAITRLEAMKAQRAAENKLAHYRPYPK |
| Ga0066388_1042229423 | 3300005332 | Tropical Forest Soil | MGLAMSLSLDIDSLPPEKVEAAITRLEAVKAQRAAENKLSHYRPYPK |
| Ga0066388_1058714771 | 3300005332 | Tropical Forest Soil | MSLALDIDSLPLEQAEAAVARLEALKAQRAAENKLAHYCPYPKQAAF |
| Ga0008090_102102741 | 3300005363 | Tropical Rainforest Soil | MNLNLDIDSLPPEQAEAALIRLEAIKAQRAVENALAHYVPY |
| Ga0070705_1003257504 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | MNLNLDIDSLPPEQVEAALTRLEAIKAQRAVENALAHYVP |
| Ga0066689_108029182 | 3300005447 | Soil | MSLNIDIDSLPPDKVEAAITRLEAVKAQRAAENKLTHYRPYPKQAAFHEA |
| Ga0070702_1003847601 | 3300005615 | Corn, Switchgrass And Miscanthus Rhizosphere | MGLAMSLNLDIDSLPPEQVEAAITRLEMMKAQRAAKNKLAHYRPYPKQVAFHAAG |
| Ga0066905_1023153592 | 3300005713 | Tropical Forest Soil | MSLSELDIDSLPPEQAETALTRLEAIRAQRAVENALAHYVPYPRQM |
| Ga0068866_100253587 | 3300005718 | Miscanthus Rhizosphere | MGLAMSLNLDIDSLPPEQVEAAITRLEMMKAQRAAKNKLAHYRPYPKQVAFHAAGARCRE |
| Ga0066903_1027168611 | 3300005764 | Tropical Forest Soil | LDIDSLPPEKVEAAITRLEAVKAQRAAENKLSHYRPYPKQQLPCC* |
| Ga0068870_106914772 | 3300005840 | Miscanthus Rhizosphere | MSLSLDIDSLPPDKVEAAISRLETMKAQRAAENKLAHYRPYPKQVAFHAAGARCRE |
| Ga0075028_1000633013 | 3300006050 | Watersheds | MGLPMSLNLDIDSLPPEKVEAAITRLEAMKAQRAAENKLAYYR |
| Ga0075364_105545773 | 3300006051 | Populus Endosphere | MGLAMSLNLDIDGLPAEKVEAAITRLEAMKAQRAAENKLAHYRPYPKQ |
| Ga0075422_101857221 | 3300006196 | Populus Rhizosphere | MSLNLDIDSLPPEKVEAAISRLETMKAQRAAENKLAHYRPYPKQ |
| Ga0075428_1018201243 | 3300006844 | Populus Rhizosphere | MGLAMSLNLDIDSLPPEKVEAAITRLEAMKAQRAAENKLAHYRPYPKQAAFHEAGA |
| Ga0075424_1015154283 | 3300006904 | Populus Rhizosphere | MSLNIDIDSLPPDKVEAAITRLEAVKAQRVAENKLAHYRPYPKQA |
| Ga0105251_103566761 | 3300009011 | Switchgrass Rhizosphere | MSLNLDIDSLPPDKVEAAITRLEAMKAQRAAENKLAHYRPYPKQVA |
| Ga0075418_105632561 | 3300009100 | Populus Rhizosphere | MTLNLDIDSLPPEQAEVALTRLEAIRAQRAVENALAHYLPYPRQKQFHNAGATHR |
| Ga0126380_113470302 | 3300010043 | Tropical Forest Soil | MTLIDIENLPPEQAEAALARLAEIKAQRAVENALAHYVP |
| Ga0126384_110957973 | 3300010046 | Tropical Forest Soil | MSLNLDIDSLPPEQAEAALTRLEAIKAQRTVENALAHYEPYPRQLQFHDAGATHTSAHC |
| Ga0126384_124187402 | 3300010046 | Tropical Forest Soil | MSLNLDIDIDSLPPEQAETALTRLEAIKAQRAVENALAHYVPYPRQEQ |
| Ga0126382_103423254 | 3300010047 | Tropical Forest Soil | MTLNLDIDSLPPEQAEAALTRLEAIKAQRAVENALAHYVPYPRQMQFHNAGA |
| Ga0126376_131849812 | 3300010359 | Tropical Forest Soil | MNLNLDIDSLPPEQAEAVLTRLEAIKAQRAVENVLAHYVPYPRQEQFHNAGATHR |
| Ga0126378_105361891 | 3300010361 | Tropical Forest Soil | MSLNLDIDSLPPEQVEAAITRLEAVKAQRAAENKLSHYRPYPKQVAFH |
| Ga0126377_128989292 | 3300010362 | Tropical Forest Soil | LSLDIDSLPPEKVKAAIARLEAEKTRRIVENKLAH |
| Ga0126381_1016738082 | 3300010376 | Tropical Forest Soil | MTLIDIESLPPEQVEAALTRLEAIKAQRAAENALAHYVPYPR |
| Ga0126383_107210603 | 3300010398 | Tropical Forest Soil | MNLNLDIDSLPPEQVEAALTRLEAIKVQRAVENALAHYVPYPRQEQFHNAGATHRE |
| Ga0126383_111614891 | 3300010398 | Tropical Forest Soil | LSLDVDSLPPDKVAAAIERLEAEKHRRVVENALAHYAPYAKQAAFHEAG |
| Ga0105246_122692192 | 3300011119 | Miscanthus Rhizosphere | MSLNLDIDTLPPEKVEAAISRLEAMKAQCAAENKLAH |
| Ga0137381_115491761 | 3300012207 | Vadose Zone Soil | MSLNLDIDSLPLEQAEAAVARLEALKAQRAAENKLA |
| Ga0157285_103444081 | 3300012897 | Soil | MSLNLDIDSLPPEKVEALVTRLETMKAQRAAENKLAHYRPYPKQAAF |
| Ga0157289_102855662 | 3300012903 | Soil | MSLNLDIDSLPPEKVEAAITRLEAMKAQRAAENKLAHYRPYPKQIAFHAAGVRC |
| Ga0157301_102458602 | 3300012911 | Soil | MSLNLDIDSLPPEQVEAAITRLEAMKAQRATENKLAHYRPYPK |
| Ga0164304_115031531 | 3300012986 | Soil | MGLPMSLNLDIDSLPPEKVEAAISRLEAMKAQRAAENKFAHYRPYPKQVAFHAAGARCRE |
| Ga0164305_113635442 | 3300012989 | Soil | MSLNLDIDSLPPEKVEAAITRLEMMKAQRAAENKLAH* |
| Ga0163162_108083073 | 3300013306 | Switchgrass Rhizosphere | MGLPMSLNLDIDSLPPEKVEAAISRLEAVKAQRAAENKLA |
| Ga0132256_1029086182 | 3300015372 | Arabidopsis Rhizosphere | MSLNLDIDSLPPEKVEAAITRLEAIKAQRAVENALAHYVPYPRQKQFHNAGATHRERLL |
| Ga0132256_1030095832 | 3300015372 | Arabidopsis Rhizosphere | MSLNLDIDSLPPEKVEAAISRLEAMKAQRAAENKLAHYYPYPKQIAFHATGVRCRERLLI |
| Ga0182035_114833093 | 3300016341 | Soil | MSLNLDIDSLPPEQAEAALTRLEAIKARRAVENALAHYVPYPRQEQFHNAGATHRERL |
| Ga0182034_101676313 | 3300016371 | Soil | MGLAMSVNLDIDSLPPDKVEAAITRLEAVKAQRAAENKLAHYRPYPK |
| Ga0182034_112019991 | 3300016371 | Soil | MKPNLDIDSLPPEQAEVALTRLEAIKAQRAVENALAHY |
| Ga0182040_112234833 | 3300016387 | Soil | MNLDIDSLPPEQAEVALTRLEAIKAKRAVENALAHYVPYPRQ |
| Ga0182037_112420062 | 3300016404 | Soil | MNLNLDIDSLPPEQAEAALTRLEAIKARRAVENALAHYVPY |
| Ga0182039_106042703 | 3300016422 | Soil | MNLNLDIDSLPPEQVEAALTRLEAIKVQRAVENALAHYVPYPRQEQFHNA |
| Ga0182038_109885602 | 3300016445 | Soil | MSLNLDIDSLPPEKVEAAITRLEAVKAQRAAENKLSH |
| Ga0163161_107307102 | 3300017792 | Switchgrass Rhizosphere | MLMGLAMSLNLDIDSLPPEKVEAAISRLEAMKAQRAAENRLAYYRP |
| Ga0184624_101502851 | 3300018073 | Groundwater Sediment | MLMGLAMSLNLDIDSLPPEQVEAAITRLEAMKAQRAAENKLAHFTPFPRQLEFFAAGAKYRERPISNVRFDGG |
| Ga0066662_102206681 | 3300018468 | Grasslands Soil | MSLALDIDSLPLERAEAAITRLEALKAQRAAENRL |
| Ga0173482_105361093 | 3300019361 | Soil | MGLAMSLNLDIDSLPPEKVEAAITRLEAMKAQRAA |
| Ga0126371_131851962 | 3300021560 | Tropical Forest Soil | MNLNLDIDSLPPEQAETALTRLEAIKAQRAVENAL |
| Ga0207692_110918781 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | MGLAMSLNLDIDSLPPEQVEAAITRLEAMKAQRAAENKLAHYRPYPKQAAFHE |
| Ga0207681_115126501 | 3300025923 | Switchgrass Rhizosphere | MGLAMSLNLDIDSLPPEQVEAAITRLEMMKAQRAAKNKLA |
| Ga0207659_111044252 | 3300025926 | Miscanthus Rhizosphere | MGLAMSLNLDIDSLPPEQVEAAITRLEMMKAQRAAK |
| Ga0207670_101011941 | 3300025936 | Switchgrass Rhizosphere | MGLAMSLNLDIDSLPPEKVEAAITRLEVMKAQRAAENKLAHYRPYPKQVAFHAAGARCRE |
| Ga0207667_115126742 | 3300025949 | Corn Rhizosphere | MSLNLDIDSLPPEKVEAAITRLEAMKAQRAAENKLTHYRPY |
| Ga0207640_105323081 | 3300025981 | Corn Rhizosphere | MGLAMSLNLDIDSLPPEQVEAAITRLEAMKAQRAAEN |
| Ga0207640_109863451 | 3300025981 | Corn Rhizosphere | MSLNLDIDSLPPEQVEAAITRLEMMKAQRAAKNKLAHYRPYPKQVAFHAA |
| Ga0207677_104173034 | 3300026023 | Miscanthus Rhizosphere | MSLNLDIDSLPPEKVEAAISRLEAMKAQRAAENKFAHYRPY |
| Ga0207641_116532791 | 3300026088 | Switchgrass Rhizosphere | MGLAMSLNLDIDSLPPEQVEAAITRLEMMKAQRAAKNKLAHYRPYPK |
| Ga0207674_109409233 | 3300026116 | Corn Rhizosphere | MGLAMSLNLDIDSLPPEQVEAAITRLEMMKAQRAAKNKLAHYRPY |
| Ga0209056_104601083 | 3300026538 | Soil | MGLAMSLNLDIDSLPPDKVEAAITRLEAVKAQRAAENKLAHYRPYPKQAAFHEAGAKH |
| Ga0209813_101901492 | 3300027866 | Populus Endosphere | MLMGLAMSLNLDIDSLPPEKVEAAITRLEAMKAQRAAENKLTHYRPYP |
| Ga0209465_105531421 | 3300027874 | Tropical Forest Soil | MTLNLDIDSLPPEQAEVALTRLEAIRAQRAVENALAHYVPYPRQKPFHNAGATHRERLLI |
| Ga0307299_100933911 | 3300028793 | Soil | MNLDIDSLPPEKVEAAITRLEAMKAQRAAENKLAHYRPYPKQ |
| Ga0307296_103614871 | 3300028819 | Soil | MSLNLDIESLPPEKVEAAITRLEAMKAQRAAENKLAYYRPYPKQVAFHAAGV |
| Ga0307286_102205671 | 3300028876 | Soil | MGLAMSLNLDIDSLPPEQVEAAITRLEMMKAQRAAENKLAHYRPYPKQVAFHAAGARCRE |
| Ga0318541_101874923 | 3300031545 | Soil | MGLAMSLNLDIDSLPPEKVEAAITRLEAVKTQRAAENKLAHYRPYPKQAAFHEA |
| Ga0318528_100199216 | 3300031561 | Soil | MSLNLDIDSLPPEQVEAAITRLEAVKAQRAAENKLSHYRPYPKQAAFHEAG |
| Ga0318528_106923501 | 3300031561 | Soil | MNLNLDIDSLPPEQAEVALTRLEAIKAQRAVENALAHYV |
| Ga0310915_104163302 | 3300031573 | Soil | MGLAMSLNLDIDSLPPEKVEAAITRLEAVKAQRAAENKLSHYRPYPKQVAFHDAGAK |
| Ga0318555_100809801 | 3300031640 | Soil | MSLNLDIDSLPPEQVEAAITRLEAVKAQRAAENKL |
| Ga0318572_108265941 | 3300031681 | Soil | MGLAMSLNLDIDSLPPEQVEAAITRLEAVKAQRAAENKLAHYRPYPKQAAFHEAGAKHR |
| Ga0306917_100130491 | 3300031719 | Soil | MGLAMSLNLDIDSLPPEKVEAAITRLEAVKAQRAAENKLSHY |
| Ga0318493_108640142 | 3300031723 | Soil | MNLNLDIDSLPPEQVEAALTRLEAIKVQRAVENALAHYV |
| Ga0318500_100034541 | 3300031724 | Soil | MGLVMSLNLDIDSLPPEKVEAAITRLEAVKAQRAAENKL |
| Ga0306918_101288991 | 3300031744 | Soil | MNLNLDIDSLPPEQVEAALTRLEAIKVQRAVENALAHYVPYPRQEQFHNAGATHRERLL |
| Ga0318537_103822422 | 3300031763 | Soil | MNLDIDSLPPEQAEVALTRLEAIKAKRAVENALAHYVPYPRQEQFHNAGATHRE |
| Ga0318498_103902411 | 3300031778 | Soil | MNLNLDIDSLPPEQVEAALTRLEAIKVQRAVENALAHYVPYPRQEQFH |
| Ga0318548_101763363 | 3300031793 | Soil | MGLAMSLNLDIDSLPPEKVEAAITRLEAVKTQRAAENK |
| Ga0318567_108045282 | 3300031821 | Soil | MNLNLDIDSLPPEQAEAALTRLEAIKAQRAVENALAHYVPYPRQE |
| Ga0306919_102478841 | 3300031879 | Soil | MTLNLDIDSLPPEQAEAALARLEAIKTQRAVENALAHYVPYPRQEQ |
| Ga0306919_106700641 | 3300031879 | Soil | MNLNPNLKIDSLPPEQAEAALTRLEAIKAQRAVENALANYAPYPRQEQFHN |
| Ga0306919_108495301 | 3300031879 | Soil | MNLDIDSLPPEQAEVALTRLEAIKAKRAVENALAHYVPYPRQQQFHNAGATHRERLL |
| Ga0306925_103284321 | 3300031890 | Soil | MSLNLDIDSLPPEQVEAAITRLEAVKAQRAAENKLAHYRPYPKQAAFHEAG |
| Ga0310916_113003431 | 3300031942 | Soil | MNLNPNLKIDSLPPEQAEAALTRLEEIKAQRAVENALAHYVPYPRQEQFHNAGA |
| Ga0306926_100712145 | 3300031954 | Soil | MGLVMSLNLDIDSLPPEQVEAAITRLEAVKAQRAAENK |
| Ga0306926_111632421 | 3300031954 | Soil | MGLAMSLNLDIDSLPPEKVEAAITRLEAVKAQRAAENKLSHYR |
| Ga0318531_103325281 | 3300031981 | Soil | MGLVMSLNLDIDSLPPEKVEAAITRLEAVKAQRAAENKLAHYRPYPKQAAFHEAG |
| Ga0318549_105058861 | 3300032041 | Soil | MNLNLDIDSLPPEQAEAALTRLEAIKAQRAVENALAHYVPYPRQEQFH |
| Ga0318558_106067201 | 3300032044 | Soil | MNLNLNIDSLPPEQAEVALTRLEAIKAQRAVENALAHYVPYPRQQQF |
| Ga0318533_104428392 | 3300032059 | Soil | MGLAMSLNLDIDSLPPEKVEAAITRLEAVKAQRAAENKLSHYRPYPKQ |
| Ga0318513_104495701 | 3300032065 | Soil | MNLNLDIDSLPPEQAEAALTRLEAIKAQRAVENKLVHYR |
| Ga0318524_107916561 | 3300032067 | Soil | MGLVMSLNLDIDSLPPEQVEAAITRLEAVKAQRAAENKLAHYRPY |
| Ga0318553_102738231 | 3300032068 | Soil | MNLNLDIDSLPPEQAEAALTRLEAIKAQRAVENKLV |
| Ga0318553_104169011 | 3300032068 | Soil | MNLDIDSLPPEQAEVALTRLEAIKAKRAVENALAHYVPYPRQEQFHNAGAT |
| Ga0318519_101665793 | 3300033290 | Soil | MGLAMSLNLDIESLPPEQVEAAITRLEAVKAQRAAENKLAHYRPYPKQAAFHEA |
| ⦗Top⦘ |