Metagenome Family F097584

Basic Information
Family ID	F097584
Family Type	Metagenome
Number of Sequences	104
Average Sequence Length	39 residues
Representative Sequence	KDGRIRFAGPDRVRIERAAPTLSDRVGLVREFLGKLT
Number of Associated Samples	100
Number of Associated Scaffolds	104

Quality Assessment
Transcriptomic Evidence	No
Most common taxonomic group	Bacteria
% of genes with valid RBS motifs	0.00 %
% of genes near scaffold ends (potentially truncated)	97.12 %
% of genes from short scaffolds (< 2000 bps)	91.35 %
Associated GOLD sequencing projects	97
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.47

Most Common Taxonomy
Group	Bacteria (86.538 % of family members)
NCBI Taxonomy ID	2
Taxonomy	All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem	Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen (11.539 % of family members)
Environment Ontology (ENVO)	Unclassified (35.577 % of family members)
Earth Microbiome Project Ontology (EMPO)	Host-associated → Plant → Plant rhizosphere (40.385 % of family members)

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Predicted Topology & Secondary Structure
Classification:	Globular	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 36.92% β-sheet: 0.00% Coil/Unstructured: 63.08%
Feature Viewer

Powered by Feature Viewer

Pfam ID	Name	% Frequency in 104 Family Scaffolds
PF00753	Lactamase_B	52.88
PF13712	Glyco_tranf_2_5	4.81
PF00990	GGDEF	4.81
PF01914	MarC	2.88
PF00549	Ligase_CoA	1.92
PF00378	ECH_1	1.92
PF08448	PAS_4	1.92
PF03401	TctC	0.96
PF06480	FtsH_ext	0.96
PF03461	TRCF	0.96
PF01019	G_glu_transpept	0.96
PF01322	Cytochrom_C_2	0.96
PF04264	YceI	0.96
PF00211	Guanylate_cyc	0.96
PF03255	ACCA	0.96
PF00406	ADK	0.96
PF02897	Peptidase_S9_N	0.96
PF05649	Peptidase_M13_N	0.96
PF10502	Peptidase_S26	0.96
PF03466	LysR_substrate	0.96

COG ID	Name	Functional Category	% Frequency in 104 Family Scaffolds
COG2095	Small neutral amino acid transporter SnatA, MarC family	Amino acid transport and metabolism [E]	2.88
COG0045	Succinyl-CoA synthetase, beta subunit	Energy production and conversion [C]	1.92
COG0074	Succinyl-CoA synthetase, alpha subunit	Energy production and conversion [C]	1.92
COG1197	Transcription-repair coupling factor (superfamily II helicase)	Transcription [K]	1.92
COG0405	Gamma-glutamyltranspeptidase	Amino acid transport and metabolism [E]	0.96
COG0465	ATP-dependent Zn proteases	Posttranslational modification, protein turnover, chaperones [O]	0.96
COG0563	Adenylate kinase or related kinase	Nucleotide transport and metabolism [F]	0.96
COG0825	Acetyl-CoA carboxylase alpha subunit	Lipid transport and metabolism [I]	0.96
COG1505	Prolyl endopeptidase PreP, S9A serine peptidase family	Amino acid transport and metabolism [E]	0.96
COG1770	Protease II	Amino acid transport and metabolism [E]	0.96
COG2114	Adenylate cyclase, class 3	Signal transduction mechanisms [T]	0.96
COG2353	Polyisoprenoid-binding periplasmic protein YceI	General function prediction only [R]	0.96
COG3181	Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctC	Energy production and conversion [C]	0.96
COG3590	Predicted metalloendopeptidase	Posttranslational modification, protein turnover, chaperones [O]	0.96
COG3909	Cytochrome c556	Energy production and conversion [C]	0.96

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	86.54 %
Unclassified	root	N/A	13.46 %

Name	Rank	Taxonomy	Distribution
cellular organisms	root	All Organisms → cellular organisms	86.54 %
Unclassified	root	N/A	13.46 %

Name	Rank	Taxonomy	Distribution
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	86.54 %
Unclassified	root	N/A	13.46 %

Name	Rank	Taxonomy	Distribution
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	80.77 %
Unclassified	root	N/A	13.46 %
Acidobacteria	phylum	All Organisms → cellular organisms → Bacteria → Acidobacteria	0.96 %

Name	Rank	Taxonomy	Distribution
Betaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	66.35 %
Unclassified	root	N/A	13.46 %
Alphaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1.92 %
Acidobacteria	phylum	All Organisms → cellular organisms → Bacteria → Acidobacteria	0.96 %

Name	Rank	Taxonomy	Distribution
unclassified Betaproteobacteria	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria	16.35 %
Unclassified	root	N/A	13.46 %
Burkholderiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	3.85 %
Hyphomicrobiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales	1.92 %
Acidobacteria	phylum	All Organisms → cellular organisms → Bacteria → Acidobacteria	0.96 %

Name	Rank	Taxonomy	Distribution
Betaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	16.35 %
Unclassified	root	N/A	13.46 %
Burkholderiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	3.85 %
unclassified Hyphomicrobiales	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales	1.92 %
Acidobacteria	phylum	All Organisms → cellular organisms → Bacteria → Acidobacteria	0.96 %

Name	Rank	Taxonomy	Distribution
Betaproteobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	16.35 %
Unclassified	root	N/A	13.46 %
Burkholderiales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	3.85 %
Hyphomicrobiales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium	1.92 %
Acidobacteria	phylum	All Organisms → cellular organisms → Bacteria → Acidobacteria	0.96 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
2170459003\|FZ032L002GQ74P	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium	512	Open in IMG/M
3300000312\|WSSedB2BaDRAFT_1016801	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	565	Open in IMG/M
3300001593\|JGI12635J15846_10241474	All Organisms → cellular organisms → Bacteria → Proteobacteria	1165	Open in IMG/M
3300004047\|Ga0055499_10105732	Not Available	525	Open in IMG/M
3300004152\|Ga0062386_101581262	All Organisms → cellular organisms → Bacteria → Proteobacteria	547	Open in IMG/M
3300005171\|Ga0066677_10201955	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1113	Open in IMG/M
3300005176\|Ga0066679_10029198	All Organisms → cellular organisms → Bacteria → Proteobacteria	3018	Open in IMG/M
3300005335\|Ga0070666_10864994	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	667	Open in IMG/M
3300005440\|Ga0070705_100684810	All Organisms → cellular organisms → Bacteria → Proteobacteria	803	Open in IMG/M
3300005455\|Ga0070663_100151478	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1779	Open in IMG/M
3300005459\|Ga0068867_101567332	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	615	Open in IMG/M
3300005545\|Ga0070695_101275723	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	606	Open in IMG/M
3300005546\|Ga0070696_100012436	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	5709	Open in IMG/M
3300005559\|Ga0066700_10851050	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	610	Open in IMG/M
3300005576\|Ga0066708_10476067	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	803	Open in IMG/M
3300005577\|Ga0068857_100676599	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	979	Open in IMG/M
3300005578\|Ga0068854_102228261	Not Available	507	Open in IMG/M
3300005617\|Ga0068859_100155854	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	2361	Open in IMG/M
3300005719\|Ga0068861_100029425	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	4019	Open in IMG/M
3300005834\|Ga0068851_10416097	All Organisms → cellular organisms → Bacteria → Proteobacteria	793	Open in IMG/M
3300005840\|Ga0068870_10327683	All Organisms → cellular organisms → Bacteria	975	Open in IMG/M
3300006237\|Ga0097621_100001374	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	16741	Open in IMG/M
3300006854\|Ga0075425_102463056	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	577	Open in IMG/M
3300006871\|Ga0075434_100534333	All Organisms → cellular organisms → Bacteria → Proteobacteria	1193	Open in IMG/M
3300006871\|Ga0075434_100631936	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	1089	Open in IMG/M
3300006903\|Ga0075426_11219407	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales	571	Open in IMG/M
3300007076\|Ga0075435_100022088	All Organisms → cellular organisms → Bacteria	4906	Open in IMG/M
3300009100\|Ga0075418_12437901	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	571	Open in IMG/M
3300009137\|Ga0066709_104565549	Not Available	506	Open in IMG/M
3300009148\|Ga0105243_12422770	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	563	Open in IMG/M
3300009792\|Ga0126374_11394902	Not Available	570	Open in IMG/M
3300009870\|Ga0131092_11398584	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	538	Open in IMG/M
3300010321\|Ga0134067_10316114	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	606	Open in IMG/M
3300010366\|Ga0126379_10136645	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	2258	Open in IMG/M
3300010398\|Ga0126383_11684382	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	723	Open in IMG/M
3300010398\|Ga0126383_13451570	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	516	Open in IMG/M
3300010401\|Ga0134121_11434783	All Organisms → cellular organisms → Bacteria → Proteobacteria	702	Open in IMG/M
3300012004\|Ga0120134_1034821	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	841	Open in IMG/M
3300012093\|Ga0136632_10534781	Not Available	518	Open in IMG/M
3300012202\|Ga0137363_10454250	All Organisms → cellular organisms → Bacteria → Acidobacteria	1072	Open in IMG/M
3300012285\|Ga0137370_10365877	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	869	Open in IMG/M
3300012354\|Ga0137366_10522737	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	856	Open in IMG/M
3300012357\|Ga0137384_11341352	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	563	Open in IMG/M
3300012681\|Ga0136613_10537563	Not Available	631	Open in IMG/M
3300012943\|Ga0164241_11070862	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	593	Open in IMG/M
3300013308\|Ga0157375_10547071	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	1320	Open in IMG/M
3300014304\|Ga0075340_1126431	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	541	Open in IMG/M
3300014325\|Ga0163163_12471493	Not Available	578	Open in IMG/M
3300014326\|Ga0157380_13418387	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	508	Open in IMG/M
3300014968\|Ga0157379_10078831	All Organisms → cellular organisms → Bacteria → Proteobacteria	2950	Open in IMG/M
3300015374\|Ga0132255_104474848	All Organisms → cellular organisms → Bacteria → Proteobacteria	592	Open in IMG/M
3300019377\|Ga0190264_12039772	Not Available	527	Open in IMG/M
3300022309\|Ga0224510_10267159	All Organisms → cellular organisms → Bacteria	1028	Open in IMG/M
3300025903\|Ga0207680_10926189	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	624	Open in IMG/M
3300025917\|Ga0207660_10653615	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	857	Open in IMG/M
3300025931\|Ga0207644_11847671	Not Available	505	Open in IMG/M
3300025942\|Ga0207689_11681065	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	526	Open in IMG/M
3300025961\|Ga0207712_10697052	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	886	Open in IMG/M
3300025972\|Ga0207668_11065781	All Organisms → cellular organisms → Bacteria → Proteobacteria	724	Open in IMG/M
3300025985\|Ga0210117_1033849	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	802	Open in IMG/M
3300026035\|Ga0207703_12153701	All Organisms → cellular organisms → Bacteria → Proteobacteria	534	Open in IMG/M
3300026041\|Ga0207639_11676469	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	596	Open in IMG/M
3300026116\|Ga0207674_10592821	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1071	Open in IMG/M
3300026281\|Ga0209863_10093971	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	883	Open in IMG/M
3300026291\|Ga0209890_10215041	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium	611	Open in IMG/M
3300026523\|Ga0209808_1225818	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	603	Open in IMG/M
3300026530\|Ga0209807_1260488	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	585	Open in IMG/M
3300027543\|Ga0209999_1028681	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1032	Open in IMG/M
3300027681\|Ga0208991_1129827	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	749	Open in IMG/M
3300027831\|Ga0209797_10465425	Not Available	505	Open in IMG/M
3300027890\|Ga0209496_10284436	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	823	Open in IMG/M
3300028379\|Ga0268266_11545610	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	639	Open in IMG/M
3300028380\|Ga0268265_12140927	Not Available	566	Open in IMG/M
3300028665\|Ga0302160_10167177	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	519	Open in IMG/M
3300029984\|Ga0311332_11781531	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	501	Open in IMG/M
3300029987\|Ga0311334_10813141	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	770	Open in IMG/M
3300029989\|Ga0311365_10053166	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	3460	Open in IMG/M
3300030000\|Ga0311337_11737657	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	547	Open in IMG/M
3300030003\|Ga0302172_10227172	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	592	Open in IMG/M
3300030294\|Ga0311349_10830925	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	869	Open in IMG/M
3300030294\|Ga0311349_11431959	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	642	Open in IMG/M
3300030943\|Ga0311366_10570043	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	985	Open in IMG/M
3300030943\|Ga0311366_11526028	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	572	Open in IMG/M
3300031226\|Ga0307497_10257926	Not Available	782	Open in IMG/M
3300031232\|Ga0302323_101787884	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	696	Open in IMG/M
3300031366\|Ga0307506_10530220	All Organisms → cellular organisms → Bacteria → Proteobacteria	503	Open in IMG/M
3300031716\|Ga0310813_10384003	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1204	Open in IMG/M
3300031726\|Ga0302321_101494387	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	778	Open in IMG/M
3300031847\|Ga0310907_10189189	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	975	Open in IMG/M
3300031873\|Ga0315297_11632513	All Organisms → cellular organisms → Bacteria → Proteobacteria	518	Open in IMG/M
3300031999\|Ga0315274_10586657	Not Available	1235	Open in IMG/M
3300032003\|Ga0310897_10096417	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1167	Open in IMG/M
3300032066\|Ga0318514_10334477	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	802	Open in IMG/M
3300032074\|Ga0308173_11705099	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	593	Open in IMG/M
3300032090\|Ga0318518_10690478	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	519	Open in IMG/M
3300032122\|Ga0310895_10353647	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	708	Open in IMG/M
3300032205\|Ga0307472_101444060	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	669	Open in IMG/M
3300032275\|Ga0315270_10397535	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	878	Open in IMG/M
3300032954\|Ga0335083_10743539	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium	792	Open in IMG/M
3300033290\|Ga0318519_10426646	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	792	Open in IMG/M
3300033412\|Ga0310810_10521152	All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	1173	Open in IMG/M
3300033413\|Ga0316603_10703696	All Organisms → cellular organisms → Bacteria	944	Open in IMG/M
3300033419\|Ga0316601_101393512	Not Available	705	Open in IMG/M
3300034090\|Ga0326723_0200105	All Organisms → cellular organisms → Bacteria	885	Open in IMG/M

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Environmental	Environmental	67.31%
Host-Associated	Host-Associated	31.73%
Engineered	Engineered	0.96%

Habitat	Taxonomy	Distribution
Terrestrial	Environmental → Terrestrial	55.77%
Plants	Host-Associated → Plants	31.73%
Aquatic	Environmental → Aquatic	11.54%
Wastewater	Engineered → Wastewater	0.96%

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil	43.27%
Rhizosphere	Host-Associated → Plants → Rhizosphere	16.35%
Rhizoplane	Host-Associated → Plants → Rhizoplane	13.46%
Peat	Environmental → Terrestrial → Peat	12.50%
Freshwater	Environmental → Aquatic → Freshwater	7.69%
Marine	Environmental → Aquatic → Marine	3.85%
Roots	Host-Associated → Plants → Roots	1.92%
Activated Sludge	Engineered → Wastewater → Activated Sludge	0.96%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified	30.77%
Unclassified	Environmental → Terrestrial → Peat → Unclassified	12.50%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	12.50%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	10.58%
Loam	Environmental → Terrestrial → Soil → Loam	6.73%
Wetlands	Environmental → Terrestrial → Soil → Wetlands	5.77%
Soil	Host-Associated → Plants → Rhizosphere → Soil	5.77%
Lake	Environmental → Aquatic → Freshwater → Lake	2.88%
Wetlands	Environmental → Aquatic → Marine → Wetlands	2.88%
Wetlands	Environmental → Aquatic → Freshwater → Wetlands	1.92%
Ice	Environmental → Aquatic → Freshwater → Ice	1.92%
Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere	1.92%
Sediment	Environmental → Aquatic → Freshwater → Sediment	0.96%
Sediment	Environmental → Aquatic → Marine → Sediment	0.96%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified	0.96%
Unclassified	Engineered → Wastewater → Activated Sludge → Unclassified	0.96%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified → Unclassified	15.38%
Unclassified	Environmental → Terrestrial → Peat → Unclassified → Unclassified	12.50%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	12.50%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	10.58%
Grasslands	Environmental → Terrestrial → Soil → Unclassified → Grasslands	6.73%
Unclassified	Host-Associated → Plants → Rhizosphere → Soil → Unclassified	5.77%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil	3.85%
Agricultural	Environmental → Terrestrial → Soil → Unclassified → Agricultural	3.85%
Unclassified	Environmental → Terrestrial → Soil → Wetlands → Unclassified	3.85%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil	3.85%
Sediment	Environmental → Aquatic → Freshwater → Lake → Sediment	2.88%
Unclassified	Environmental → Aquatic → Freshwater → Ice → Unclassified	1.92%
Unclassified	Environmental → Aquatic → Marine → Wetlands → Unclassified	1.92%
Permafrost	Environmental → Terrestrial → Soil → Wetlands → Permafrost	1.92%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil	1.92%
Soil	Host-Associated → Plants → Roots → Rhizosphere → Soil	1.92%
Unclassified	Environmental → Aquatic → Freshwater → Sediment → Unclassified	0.96%
Bog	Environmental → Aquatic → Freshwater → Wetlands → Bog	0.96%
Unclassified	Environmental → Aquatic → Freshwater → Wetlands → Unclassified	0.96%
Sediment	Environmental → Aquatic → Marine → Wetlands → Sediment	0.96%
Unclassified	Environmental → Aquatic → Marine → Sediment → Unclassified	0.96%
Permafrost	Environmental → Terrestrial → Soil → Unclassified → Permafrost	0.96%
Grasslands	Environmental → Terrestrial → Soil → Loam → Grasslands	0.96%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified	0.96%
Unclassified	Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified	0.96%

Habitat	Taxonomy	Distribution
Fen	Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen	11.54%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	5.77%
Populus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere	5.77%
Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil	4.81%
Corn Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere	4.81%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere	4.81%
Vadose Zone Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil	3.85%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil	3.85%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil	3.85%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	3.85%
Sediment	Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment	2.88%
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	2.88%
Soil	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil	2.88%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere	2.88%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere	2.88%
Polar Desert Sand	Environmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand	1.92%
Natural And Restored Wetlands	Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands	1.92%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil	1.92%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere	1.92%
Wetland	Environmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland	0.96%
Bog Forest Soil	Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil	0.96%
Wetland Sediment	Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment	0.96%
Wetland	Environmental → Aquatic → Marine → Wetlands → Sediment → Wetland	0.96%
Sediment	Environmental → Aquatic → Marine → Sediment → Unclassified → Sediment	0.96%
Terrestrial Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil	0.96%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil	0.96%
Permafrost	Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost	0.96%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil	0.96%
Grass Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil	0.96%
Hardwood Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil	0.96%
Natural And Restored Wetlands	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands	0.96%
Soil	Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil	0.96%
Prmafrost Soil	Environmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil	0.96%
Soil	Environmental → Terrestrial → Soil → Loam → Grasslands → Soil	0.96%
Corn Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere	0.96%
Peat Soil	Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil	0.96%
Arabidopsis Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere	0.96%
Arabidopsis Thaliana Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere	0.96%
Miscanthus Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere	0.96%
Switchgrass Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere	0.96%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere	0.96%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	0.96%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	0.96%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere	0.96%
Activated Sludge	Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Activated Sludge	0.96%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
2170459003	Grass soil microbial communities from Rothamsted Park, UK - March 2009 indirect MP BIO 1O1 lysis 0-21cm	Environmental	Open in IMG/M
3300000312	Wetland microbial communities from Twitchell Island in the Sacramento Delta, sample from surface sediment Feb2011 Site B2 Bulk	Environmental	Open in IMG/M
3300001593	Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2	Environmental	Open in IMG/M
3300004047	Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_ThreeSqC_D1	Environmental	Open in IMG/M
3300004152	Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3	Environmental	Open in IMG/M
3300005171	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126	Environmental	Open in IMG/M
3300005176	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128	Environmental	Open in IMG/M
3300005335	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG	Host-Associated	Open in IMG/M
3300005440	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG	Environmental	Open in IMG/M
3300005455	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG	Host-Associated	Open in IMG/M
3300005459	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2	Host-Associated	Open in IMG/M
3300005545	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG	Environmental	Open in IMG/M
3300005546	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG	Environmental	Open in IMG/M
3300005559	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149	Environmental	Open in IMG/M
3300005576	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157	Environmental	Open in IMG/M
3300005577	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2	Host-Associated	Open in IMG/M
3300005578	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2	Host-Associated	Open in IMG/M
3300005617	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2	Host-Associated	Open in IMG/M
3300005719	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2	Host-Associated	Open in IMG/M
3300005834	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2	Host-Associated	Open in IMG/M
3300005840	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2	Host-Associated	Open in IMG/M
3300006237	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2)	Host-Associated	Open in IMG/M
3300006854	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4	Host-Associated	Open in IMG/M
3300006871	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3	Host-Associated	Open in IMG/M
3300006903	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5	Host-Associated	Open in IMG/M
3300007076	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4	Host-Associated	Open in IMG/M
3300009100	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2	Host-Associated	Open in IMG/M
3300009137	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158	Environmental	Open in IMG/M
3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Host-Associated	Open in IMG/M
3300009792	Tropical forest soil microbial communities from Panama - MetaG Plot_12	Environmental	Open in IMG/M
3300009870	Activated sludge microbial diversity in wastewater treatment plant from Taiwan - Linkou plant	Engineered	Open in IMG/M
3300010321	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09212015	Environmental	Open in IMG/M
3300010366	Tropical forest soil microbial communities from Panama - MetaG Plot_24	Environmental	Open in IMG/M
3300010398	Tropical forest soil microbial communities from Panama - MetaG Plot_35	Environmental	Open in IMG/M
3300010401	Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1	Environmental	Open in IMG/M
3300012004	Permafrost microbial communities from Nunavut, Canada - A30_5cm_6M	Environmental	Open in IMG/M
3300012093	Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ611 (21.06)	Environmental	Open in IMG/M
3300012202	Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG	Environmental	Open in IMG/M
3300012285	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG	Environmental	Open in IMG/M
3300012354	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG	Environmental	Open in IMG/M
3300012357	Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG	Environmental	Open in IMG/M
3300012681	Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ272 (21.06)	Environmental	Open in IMG/M
3300012943	Backyard soil microbial communities from Emeryville, California, USA - Original compost - Back yard soil (BY)	Environmental	Open in IMG/M
3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Host-Associated	Open in IMG/M
3300014304	Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushMan_ThreeSqA_D1	Environmental	Open in IMG/M
3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Host-Associated	Open in IMG/M
3300014326	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG	Host-Associated	Open in IMG/M
3300014968	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG	Host-Associated	Open in IMG/M
3300015374	Col-0 rhizosphere combined assembly	Host-Associated	Open in IMG/M
3300019377	Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 112 T	Environmental	Open in IMG/M
3300022309	Sediment microbial communities from San Francisco Bay, California, United States - SF_May12_sed_USGS_4_1	Environmental	Open in IMG/M
3300025903	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025917	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes)	Environmental	Open in IMG/M
3300025931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025942	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes)	Host-Associated	Open in IMG/M
3300025961	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025972	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025985	Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_ThreeSqC_D2 (SPAdes)	Environmental	Open in IMG/M
3300026035	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026041	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026116	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026281	Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-046 (SPAdes)	Environmental	Open in IMG/M
3300026291	Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-049 (SPAdes)	Environmental	Open in IMG/M
3300026523	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 (SPAdes)	Environmental	Open in IMG/M
3300026530	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 (SPAdes)	Environmental	Open in IMG/M
3300027543	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes)	Host-Associated	Open in IMG/M
3300027681	Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M2 (SPAdes)	Environmental	Open in IMG/M
3300027831	Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T0Bare3Fresh (SPAdes)	Environmental	Open in IMG/M
3300027890	Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Plant_0915_D1 (SPAdes)	Environmental	Open in IMG/M
3300028379	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300028380	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes)	Host-Associated	Open in IMG/M
3300028665	Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_E1_3	Environmental	Open in IMG/M
3300029984	I_Fen_E1 coassembly	Environmental	Open in IMG/M
3300029987	I_Fen_E3 coassembly	Environmental	Open in IMG/M
3300029989	III_Fen_N1 coassembly	Environmental	Open in IMG/M
3300030000	I_Fen_N3 coassembly	Environmental	Open in IMG/M
3300030003	Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_N2_3	Environmental	Open in IMG/M
3300030294	II_Fen_E3 coassembly	Environmental	Open in IMG/M
3300030943	III_Fen_N2 coassembly	Environmental	Open in IMG/M
3300031226	Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 10_S	Environmental	Open in IMG/M
3300031232	Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_3	Environmental	Open in IMG/M
3300031366	Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 25_S	Environmental	Open in IMG/M
3300031716	Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3	Environmental	Open in IMG/M
3300031726	Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_1	Environmental	Open in IMG/M
3300031847	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D4	Environmental	Open in IMG/M
3300031873	Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G15_0	Environmental	Open in IMG/M
3300031999	Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_20	Environmental	Open in IMG/M
3300032003	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D1	Environmental	Open in IMG/M
3300032066	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f18	Environmental	Open in IMG/M
3300032074	Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R1	Environmental	Open in IMG/M
3300032090	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f22	Environmental	Open in IMG/M
3300032122	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D4	Environmental	Open in IMG/M
3300032205	Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05	Environmental	Open in IMG/M
3300032275	Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C1_bottom	Environmental	Open in IMG/M
3300032954	Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2	Environmental	Open in IMG/M
3300033290	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15	Environmental	Open in IMG/M
3300033412	Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC	Environmental	Open in IMG/M
3300033413	Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day10_noCT	Environmental	Open in IMG/M
3300033419	Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day5_noCT	Environmental	Open in IMG/M
3300034090	Peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF00N	Environmental	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
E4A_11143280	2170459003	Grass Soil	VQQDGRYRFAGPDRVRIERAAPTLEERVALVEAFLGRLT
WSSedB2BaDRAFT_10168011	3300000312	Wetland	PPFDPGKLILLVQRDGRIRFAGPDRVRIERGAPALTERFALVRDFLARLA*
JGI12635J15846_102414743	3300001593	Forest Soil	GRYRFAGPDRVRIERAAPTLEERVALVEGFLGRLT*
Ga0055499_101057321	3300004047	Natural And Restored Wetlands	GKLILNMQRDGRTRFAGPDRVRIDRASPALADRVALVRSFLAQLA*
Ga0062386_1015812622	3300004152	Bog Forest Soil	IQKDGRYRLAGQDRVRIERAAPSLEERVALVREFLGRLA*
Ga0066677_102019552	3300005171	Soil	IQKDGRHRFAGQDRVRIERAAPSLEERSALVREFLGRLA*
Ga0066679_100291984	3300005176	Soil	VQQDGRYRFAGPDRVRIERAAPTLEERVALVESFLGRLT*
Ga0070666_108649941	3300005335	Switchgrass Rhizosphere	LEVQRDGRTRFAGPDRIRLERAAPTLDDRVALVRDFLGRL*
Ga0070705_1006848101	3300005440	Corn, Switchgrass And Miscanthus Rhizosphere	LVQRDGRIRFAGQDRVRIERAAPALAERVGLVVDFLGRLR*
Ga0070663_1001514781	3300005455	Corn Rhizosphere	PPFDAGKLIALIQQDGRYRFAGQDRVRIERAAPAVEDRVGLIEEFLGRLR*
Ga0068867_1015673321	3300005459	Miscanthus Rhizosphere	VAMIRNDGRLRFAGPDRIRIDRAAPTLADRVTLVKEFVGRIG*
Ga0070695_1012757231	3300005545	Corn, Switchgrass And Miscanthus Rhizosphere	AIVQKDGRVRFAGPDKVRIECAAPALADRVALVRDFVGKLT*
Ga0070696_1000124361	3300005546	Corn, Switchgrass And Miscanthus Rhizosphere	IALIQQDGRYRFAGQDRVRIERAAPAVEDRVGLIEEFLGRLR*
Ga0066700_108510502	3300005559	Soil	RHRFAGQNRVRIERAAPSLDQRVALVREFLGRLS*
Ga0066708_104760672	3300005576	Soil	IQKDRRHKLAGPDKVRIEREAPTIEDRVAVVREFLGRLA*
Ga0068857_1006765991	3300005577	Corn Rhizosphere	RIRFAGPDRIRIERAAPTLNDRVAVVRDFLGKLT*
Ga0068854_1022282612	3300005578	Corn Rhizosphere	QRDGRTRFAGPDRVRIDRAAPTLADRVALVRSFLGQLA*
Ga0068859_1001558541	3300005617	Switchgrass Rhizosphere	MIRNDGRLRFAGPDRIRIDRAAPTLADRVTLVKEFVGRIG*
Ga0068861_1000294256	3300005719	Switchgrass Rhizosphere	GRVRFAGPDKVRIECAAPALADRVALVRDFAGKLT*
Ga0068851_104160971	3300005834	Corn Rhizosphere	DGRIRFAGPDRVRIDRGAPTLAERVALVRDFLAKLA*
Ga0068870_103276834	3300005840	Miscanthus Rhizosphere	LIRFAGPDRIRIERAAPALAERVALVREFIERLK*
Ga0097621_10000137418	3300006237	Miscanthus Rhizosphere	DGRVRFAGPDKVRIECAAPALADRVALVRDFAGKLT*
Ga0075425_1024630562	3300006854	Populus Rhizosphere	LVQRDGRMRFAGPDRLRIEQAAPTLDERVTLVRDFVARLK*
Ga0075434_1005343331	3300006871	Populus Rhizosphere	RMRFAGPDRIRIEQAAPTLDERVTLVRDFLTRLK*
Ga0075434_1006319362	3300006871	Populus Rhizosphere	IPIIRNDGRVRFAGPDRLRIDRAAPTLAERVSLVKEFIGRLN*
Ga0075426_112194071	3300006903	Populus Rhizosphere	AGKLIALIQQDGRYRFAGQDRVRIERAAPAVEDRVGLIEEFLGRLR*
Ga0075435_1000220885	3300007076	Populus Rhizosphere	GRHRFAGQNRVRIDRAAPTLDERVALVREFLGRLA*
Ga0075418_124379012	3300009100	Populus Rhizosphere	GRTRFAGPDRVRLERAAPTLDERYALVRDFLNRL*
Ga0066709_1045655491	3300009137	Grasslands Soil	KLISLVQRDGHYRFAGQDRVRIERAAPELADRVVLVEEFLGKLK*
Ga0105243_124227701	3300009148	Miscanthus Rhizosphere	GRIRFHGQDRIRIERGAPTLADRVALVRDFLGKLQ*
Ga0126374_113949021	3300009792	Tropical Forest Soil	RVRFAGPDRIRIDRPAPTLAERVALVKEFIGRLA*
Ga0131092_113985841	3300009870	Activated Sludge	RTRFSGPDRVRIDRAAPMLDERIALVREFLGTLA*
Ga0134067_103161142	3300010321	Grasslands Soil	DGRHRFAGQDRVRIERAAPTLEERSALVREFLARLA*
Ga0126379_101366454	3300010366	Tropical Forest Soil	QKDGRHRLAGQDRVRIERAAPALEERVALVREFLSRLS*
Ga0126383_116843822	3300010398	Tropical Forest Soil	GRMRFAGPDRIRIDRAAPTLDERVALVRDFLARLR*
Ga0126383_134515701	3300010398	Tropical Forest Soil	KDGRYRLAGPDKVRIERAAPMLDERVTSVREFLATLS*
Ga0134121_114347832	3300010401	Terrestrial Soil	ALMKVDGHIRFAGPNRVRIERGAPGLPDRVALIRDFLARLV*
Ga0120134_10348211	3300012004	Permafrost	QKDGRVRFAGPDRVRIERAAATLADRIALVREFIGTLV*
Ga0136632_105347812	3300012093	Polar Desert Sand	VQKDGRIRFAGNDKIRIERGAPMLAERVALVQDFLVGLK*
Ga0137363_104542502	3300012202	Vadose Zone Soil	LVQRDGRYRFAGQDRVRIERAAPMLGDRVALVEEFLTKLR*
Ga0137370_103658771	3300012285	Vadose Zone Soil	GRHRFAGQNRVRIERAAPSLDERVALVREFLGRLA*
Ga0137366_105227371	3300012354	Vadose Zone Soil	KDGRHRFAGQDRVRIERAAPTLEERSALVREFLARLA*
Ga0137384_113413521	3300012357	Vadose Zone Soil	RYRFAGADRVRIERAAPSLDERVALVEEFLSKVS*
Ga0136613_105375631	3300012681	Polar Desert Sand	FDAANLITRVQKDGRIRFAGNDKIRIERGAPMLAERVALVQDFLVGLK*
Ga0164241_110708621	3300012943	Soil	DGRIRFAGPDRIRIDHAAPGLVERIALVRDFLGKLG*
Ga0157375_105470712	3300013308	Miscanthus Rhizosphere	RNDGRVRFAGPDRVRIDRAAPTLAERVALVKEFVAKLA*
Ga0075340_11264312	3300014304	Natural And Restored Wetlands	LDGRIRFAGPDRIRIERAAPALADRFALVKDFIARLA*
Ga0163163_124714931	3300014325	Switchgrass Rhizosphere	QKDVRIRFAGPDRVRIERAAPTLSERIALVRDFLASLR*
Ga0157380_134183871	3300014326	Switchgrass Rhizosphere	EVQRDGRTRFAGPDRIRLERAAPTLDDRVALVRDFLGRL*
Ga0157379_100788313	3300014968	Switchgrass Rhizosphere	KDGRVRFAGPDRIRIERAAPTLAERVAVIREFLEMLR*
Ga0132255_1044748481	3300015374	Arabidopsis Rhizosphere	VQKDGRIRFAGPDRVRIDRAAPELADRVGLVREFLGRLD*
Ga0190264_120397721	3300019377	Soil	DGRVRFAGPDRVRIERAAPALADRVTLVKEFLAKVSGSDQRPAA
Ga0224510_102671591	3300022309	Sediment	GRTRFAGPDRVRIDRAAPALAERAALVREFFARLR
Ga0207680_109261892	3300025903	Switchgrass Rhizosphere	NDGRLRFAGPDRIRIDRAAPTLADRVTLVKEFVGRIG
Ga0207660_106536152	3300025917	Corn Rhizosphere	KLIALIQQDGRYRFAGQDRVRIERAAPAVEDRVGLIEEFLGKLR
Ga0207644_118476711	3300025931	Switchgrass Rhizosphere	DGHIRFAGPDRIRIERAAPALAERVALVREFIERLK
Ga0207689_116810651	3300025942	Miscanthus Rhizosphere	AGKLIALIQQDGRYRFAGQDRVRIERAAPAVEDRVGLIEEFLGRLR
Ga0207712_106970522	3300025961	Switchgrass Rhizosphere	AEEFHDGRIRFAGQDRVRIERAAPALAERVGLVVEFLGRLR
Ga0207668_110657812	3300025972	Switchgrass Rhizosphere	MAQSIEVQRDGRTRFAGPDRIRLERAAPTLDDRVALVRDFLGRL
Ga0210117_10338492	3300025985	Natural And Restored Wetlands	REDGRVRFAGPDRVKIECAAPTLADRVALVREFAGRLA
Ga0207703_121537011	3300026035	Switchgrass Rhizosphere	LIALIQQDGRYRFAGQDRVRIERAAPTVEDRVGLIEEFLGRLR
Ga0207639_116764692	3300026041	Corn Rhizosphere	LLVQKDGRIRFAGPDRVRIERAAPTLADRVTLVGDFLGRLV
Ga0207674_105928211	3300026116	Corn Rhizosphere	KDGRIRFAGPDRVRIERAAPTLSDRVGLVREFLGKLT
Ga0209863_100939711	3300026281	Prmafrost Soil	RDGRVRFHGQDRIRIERGAPTLIDRVALVREFLGKLK
Ga0209890_102150412	3300026291	Soil	LIALVQQDGRYRFAGPDRIRIERAAPSLEERVTLVESFLGRLA
Ga0209808_12258182	3300026523	Soil	IQKDRRHKLAGPDKVRIEREAPTIEDRVAVVREFLGRLA
Ga0209807_12604881	3300026530	Soil	LIVQRDGRIRFAGQDRVRIERAAPTLAERVALVEDFLGRLR
Ga0209999_10286812	3300027543	Arabidopsis Thaliana Rhizosphere	QKDGRIRFAGPDRIRIERGAPTLNERVGLVRDFLTKLV
Ga0208991_11298271	3300027681	Forest Soil	GRYRFAGPDRIRIERAAPTLEERVALVEAFLGRLT
Ga0209797_104654251	3300027831	Wetland Sediment	DGRFRFAGPDRLRIEWPTRTLDDRVTLVKDFLKKLA
Ga0209496_102844362	3300027890	Wetland	VQRDGRFRFAGPDRVRIEKAAPVLAERVALVREFLGRLA
Ga0268266_115456102	3300028379	Switchgrass Rhizosphere	VQKDGRVRFAGPDRIRIERAAPTLAERVAVIREFLEMLR
Ga0268265_121409272	3300028380	Switchgrass Rhizosphere	MQRDGRTRFAGPDRVRIDRAAPTLADRVALVRSFLGQLA
Ga0302160_101671771	3300028665	Fen	GRIRFHGQDRIRIERGAPTLVDRVALVRDFLGKLK
Ga0311332_117815312	3300029984	Fen	GRIRFHGQDRIRIERGAPTLVDRVNLVREFLGRLG
Ga0311334_108131412	3300029987	Fen	LILLVQKDGRIRFAGQDRIRIERGAPTLGDRIALVGDFLRRLA
Ga0311365_100531661	3300029989	Fen	LVQKDGRIRFHGQDRIRIERGAPTLVDRVALVRDFLGKLK
Ga0311337_117376572	3300030000	Fen	LEQKDGRSRFHGQDRIRIERGAPTLVDRVALVRDFLGKLK
Ga0302172_102271722	3300030003	Fen	DGRYRFAGQDRVRIERAAPTIDDRLVLVKEFLGKLQ
Ga0311349_108309252	3300030294	Fen	RDGRYRFAGQDRVRIERAAPSIDDRLALVQEFLGRLA
Ga0311349_114319592	3300030294	Fen	QKDGRIRFHGQDRIRIERGAPTLVDRVALVRDFLGKLK
Ga0311366_105700431	3300030943	Fen	DGRYRFAGQDRVRIERAAPTIDDRLALVQEFLGKLQ
Ga0311366_115260282	3300030943	Fen	KDGRIRFHGQDRIRIERGAPTLVDRVALVRDFLGKLK
Ga0307497_102579261	3300031226	Soil	LIQQDGRYRFAGQDRVRIERAAPTVEDRVGLIEEFLGRLR
Ga0302323_1017878842	3300031232	Fen	GRIRFAGPDRVRIERAAPSVAERVALVRDFLGRLQ
Ga0307506_105302201	3300031366	Soil	RDGRVRFAGPDRLRIDRAAPTLGERVALVRGFLEKLT
Ga0310813_103840031	3300031716	Soil	KLIALIQQDGRYRFAGQDRVRIERAAPAVEDRVGLIEEFLGRLR
Ga0302321_1014943871	3300031726	Fen	LILLVQKDGRIRFHGQDRIRIERGAPTLVDRVNLVREFLGRLG
Ga0310907_101891891	3300031847	Soil	RLILHMQRDGRTRFAGPDRVRIERAAPALDERVALVRGFLATLA
Ga0315297_116325132	3300031873	Sediment	VQKDGRIRFAGPDRVRIERAAPMLADRFALVKDFIARLA
Ga0315274_105866572	3300031999	Sediment	MQEDGRVRFAGPDRVRIERAAPTLADRFALVRDFVARLA
Ga0310897_100964173	3300032003	Soil	QRDGRTRFAGPDRVRIERAAPALDERVALVRGFLATLA
Ga0318514_103344772	3300032066	Soil	GTHRLAGPNRVRIERAAPSLNERAVLVREFLSQLG
Ga0308173_117050992	3300032074	Soil	KDGRIRFAGPDRLRIESAAPALSDRVTLVRDFLAKLA
Ga0318518_106904781	3300032090	Soil	GRYRFAGQDRVRIERAAPELADRVATVGEFLEKLR
Ga0310895_103536471	3300032122	Soil	PARLILHMQRDGRTRFAGPDRVRIERAAPALDERVALVRGFLATLA
Ga0307472_1014440602	3300032205	Hardwood Forest Soil	DGRIRFAGPERIRIERAAPTLQERVALLRDFLGKVR
Ga0315270_103975352	3300032275	Sediment	QKDGRIRFHGPDRVRIERAAPALADRVALLREFLGRLA
Ga0335083_107435392	3300032954	Soil	GRVRFAGPDRVRIDRAAPALAERVALVKEFIGKLA
Ga0318519_104266461	3300033290	Soil	RSRRTRFAGPDRVRLERAAPTLDERVQLVRDFLSRL
Ga0310810_105211523	3300033412	Soil	LIQQDGRYRFAGQDRVRIERAAPAVEDRVGLIEEFLGRLR
Ga0316603_107036961	3300033413	Soil	QKDGRIRFAGPDRVRIDRAAPTLAERIMLVKDFLGRLG
Ga0316601_1013935122	3300033419	Soil	LMVQKDGRIRFAGPDRLRIERAAPTLSDRAALIKEFLGRLG
Ga0326723_0200105_3_140	3300034090	Peat Soil	TKLITLVQRDGRYRFAGQDRVRIERAAPDLEDRVALVEDFLGKLT

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.47
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.47
Powered by PDBe Molstar

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome Family F097584

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Gene Neighborhood

Neighboring Pfam domains

Neighboring Clusters of Orthologous Genes (COGs)

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign