NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F097581

Metagenome / Metatranscriptome Family F097581

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F097581
Family Type Metagenome / Metatranscriptome
Number of Sequences 104
Average Sequence Length 155 residues
Representative Sequence PTPTFGAEVKILRYFGASFDYGFFPKLTISGVDVSYSMWNVAARVYPFGDVFFVGAVYGHYGIEASATVAQGTGSVRASSNFLGPQIGARWIQPSGFFFGIDVAWAFPLGYSSEASPDPSGTTTSVKDTADRYLRNGIPLVGLVSVGWMF
Number of Associated Samples 92
Number of Associated Scaffolds 104

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 3.85 %
% of genes near scaffold ends (potentially truncated) 96.15 %
% of genes from short scaffolds (< 2000 bps) 90.38 %
Associated GOLD sequencing projects 89
AlphaFold2 3D model prediction No

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (100.000 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(41.346 % of family members)
Environment Ontology (ENVO) Unclassified
(50.000 % of family members)
Earth Microbiome Project Ontology (EMPO) Unclassified
(52.885 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Transmembrane (beta-barrel) Signal Peptide: No Secondary Structure distribution: α-helix: 6.67%    β-sheet: 55.33%    Coil/Unstructured: 38.00%
Feature Viewer
Powered by Feature Viewer

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 104 Family Scaffolds
PF16697Yop-YscD_cpl 23.08
PF00498FHA 11.54
PF00027cNMP_binding 0.96
PF00230MIP 0.96
PF02954HTH_8 0.96
PF01370Epimerase 0.96
PF13899Thioredoxin_7 0.96

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 104 Family Scaffolds
COG0580Glycerol uptake facilitator or related aquaporin (Major Intrinsic protein Family)Carbohydrate transport and metabolism [G] 0.96

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms100.00 %
UnclassifiedrootN/A0.00 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000364|INPhiseqgaiiFebDRAFT_105274535All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium653Open in IMG/M
3300000364|INPhiseqgaiiFebDRAFT_105558091All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium1317Open in IMG/M
3300000955|JGI1027J12803_103217643All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium1112Open in IMG/M
3300000956|JGI10216J12902_112144543All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium627Open in IMG/M
3300002070|JGI24750J21931_1075091All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium556Open in IMG/M
3300005548|Ga0070665_101079307All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium814Open in IMG/M
3300005564|Ga0070664_101220134All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium710Open in IMG/M
3300005718|Ga0068866_10525606All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium787Open in IMG/M
3300005764|Ga0066903_100035445All Organisms → cellular organisms → Bacteria → Proteobacteria5758Open in IMG/M
3300005764|Ga0066903_100969845All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium1549Open in IMG/M
3300006237|Ga0097621_100062838All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria3050Open in IMG/M
3300006573|Ga0074055_11119030All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium572Open in IMG/M
3300006579|Ga0074054_11953713All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium690Open in IMG/M
3300006605|Ga0074057_11213941All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium635Open in IMG/M
3300006605|Ga0074057_11869745All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium564Open in IMG/M
3300006880|Ga0075429_101120242All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium687Open in IMG/M
3300009100|Ga0075418_12701553All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium542Open in IMG/M
3300009156|Ga0111538_10104028All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales3608Open in IMG/M
3300009792|Ga0126374_10173839All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium1334Open in IMG/M
3300010043|Ga0126380_11923273All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium539Open in IMG/M
3300010046|Ga0126384_10477154All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium1070Open in IMG/M
3300010046|Ga0126384_11049676All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium744Open in IMG/M
3300010046|Ga0126384_11549526All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium622Open in IMG/M
3300010048|Ga0126373_11845273All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium668Open in IMG/M
3300010358|Ga0126370_11925226All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium576Open in IMG/M
3300010360|Ga0126372_12510652All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium566Open in IMG/M
3300010360|Ga0126372_13288963All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium503Open in IMG/M
3300010361|Ga0126378_10849860All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium1021Open in IMG/M
3300010362|Ga0126377_10941266All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium928Open in IMG/M
3300010376|Ga0126381_102767764All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium700Open in IMG/M
3300010398|Ga0126383_10232181All Organisms → cellular organisms → Bacteria → Proteobacteria1796Open in IMG/M
3300012948|Ga0126375_11042983All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium669Open in IMG/M
3300012989|Ga0164305_11035359All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium700Open in IMG/M
3300016270|Ga0182036_10320087All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium1186Open in IMG/M
3300016341|Ga0182035_12092402All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium514Open in IMG/M
3300016445|Ga0182038_10146083All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium1798Open in IMG/M
3300017959|Ga0187779_11359053All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium504Open in IMG/M
3300021445|Ga0182009_10676219All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium557Open in IMG/M
3300021560|Ga0126371_12160675All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium671Open in IMG/M
3300025928|Ga0207700_11827070All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium534Open in IMG/M
3300025938|Ga0207704_10007605All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria5131Open in IMG/M
3300025944|Ga0207661_10250642All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium1573Open in IMG/M
3300027743|Ga0209593_10072688All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium1293Open in IMG/M
3300031543|Ga0318516_10851386All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium514Open in IMG/M
3300031544|Ga0318534_10842301All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium514Open in IMG/M
3300031547|Ga0310887_10550684All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium701Open in IMG/M
3300031549|Ga0318571_10431796All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium519Open in IMG/M
3300031564|Ga0318573_10612072All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium586Open in IMG/M
3300031640|Ga0318555_10750233All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium527Open in IMG/M
3300031713|Ga0318496_10095554All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium1591Open in IMG/M
3300031716|Ga0310813_10986531All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium767Open in IMG/M
3300031719|Ga0306917_10724551All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium781Open in IMG/M
3300031724|Ga0318500_10367482All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium712Open in IMG/M
3300031724|Ga0318500_10683219All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium523Open in IMG/M
3300031744|Ga0306918_10335041All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium1172Open in IMG/M
3300031747|Ga0318502_10134325All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium1400Open in IMG/M
3300031747|Ga0318502_10351901All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium872Open in IMG/M
3300031748|Ga0318492_10508292All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium639Open in IMG/M
3300031764|Ga0318535_10350068All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium660Open in IMG/M
3300031765|Ga0318554_10007622All Organisms → cellular organisms → Bacteria5243Open in IMG/M
3300031768|Ga0318509_10254393All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium981Open in IMG/M
3300031770|Ga0318521_10986878All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium516Open in IMG/M
3300031777|Ga0318543_10192682All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium904Open in IMG/M
3300031778|Ga0318498_10493443All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium540Open in IMG/M
3300031781|Ga0318547_10222630All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium1132Open in IMG/M
3300031792|Ga0318529_10138058All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium1117Open in IMG/M
3300031793|Ga0318548_10444974All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium634Open in IMG/M
3300031795|Ga0318557_10023465All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium2432Open in IMG/M
3300031799|Ga0318565_10583022All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium538Open in IMG/M
3300031805|Ga0318497_10250358All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium983Open in IMG/M
3300031832|Ga0318499_10379832All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium542Open in IMG/M
3300031833|Ga0310917_10336435All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium1024Open in IMG/M
3300031833|Ga0310917_10408851All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium923Open in IMG/M
3300031859|Ga0318527_10454484All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium546Open in IMG/M
3300031890|Ga0306925_11052538All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium826Open in IMG/M
3300031892|Ga0310893_10341708All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium643Open in IMG/M
3300031896|Ga0318551_10025155All Organisms → cellular organisms → Bacteria2822Open in IMG/M
3300031912|Ga0306921_10993838All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium947Open in IMG/M
3300031941|Ga0310912_10422138All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium1039Open in IMG/M
3300031942|Ga0310916_11132365All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium649Open in IMG/M
3300031945|Ga0310913_11300237All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium504Open in IMG/M
3300031947|Ga0310909_11512909All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium534Open in IMG/M
3300031981|Ga0318531_10337849All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium681Open in IMG/M
3300032017|Ga0310899_10615995All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium544Open in IMG/M
3300032025|Ga0318507_10442188All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium566Open in IMG/M
3300032055|Ga0318575_10317382All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium789Open in IMG/M
3300032063|Ga0318504_10610743All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium524Open in IMG/M
3300032067|Ga0318524_10014265All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria3435Open in IMG/M
3300032067|Ga0318524_10683607All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium541Open in IMG/M
3300032076|Ga0306924_10315609All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium1793Open in IMG/M
3300032089|Ga0318525_10587634All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium568Open in IMG/M
3300032090|Ga0318518_10285214All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium848Open in IMG/M
3300032090|Ga0318518_10381133All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium724Open in IMG/M
3300032094|Ga0318540_10660949All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium503Open in IMG/M
3300032174|Ga0307470_11615181All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium543Open in IMG/M
3300032180|Ga0307471_101106690All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium958Open in IMG/M
3300032180|Ga0307471_103713455All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium540Open in IMG/M
3300032205|Ga0307472_101683964All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium626Open in IMG/M
3300032261|Ga0306920_104071722All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium529Open in IMG/M
3300032892|Ga0335081_12748519All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium501Open in IMG/M
3300032893|Ga0335069_10352580All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium1738Open in IMG/M
3300032954|Ga0335083_10142075All Organisms → cellular organisms → Bacteria2281Open in IMG/M
3300033290|Ga0318519_10102036All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Myxococcaceae → unclassified Myxococcaceae → Myxococcaceae bacterium1545Open in IMG/M
3300033475|Ga0310811_10015404All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Archangiaceae9998Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil41.35%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil14.42%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil8.65%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil4.81%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil3.85%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil3.85%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil2.88%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil2.88%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil2.88%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere2.88%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil1.92%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere1.92%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment0.96%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland0.96%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere0.96%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere0.96%
Corn, Switchgrass And Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere0.96%
Miscanthus RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere0.96%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere0.96%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere0.96%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000364Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300000955Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300000956Soil microbial communities from Great Prairies - Kansas, Native Prairie soilEnvironmentalOpen in IMG/M
3300002070Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4Host-AssociatedOpen in IMG/M
3300005548Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaGHost-AssociatedOpen in IMG/M
3300005564Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaGHost-AssociatedOpen in IMG/M
3300005718Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2Host-AssociatedOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300006237Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2)Host-AssociatedOpen in IMG/M
3300006573Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLAC (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006579Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLAB (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006605Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHAB (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006880Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3Host-AssociatedOpen in IMG/M
3300009100Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2Host-AssociatedOpen in IMG/M
3300009156Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009792Tropical forest soil microbial communities from Panama - MetaG Plot_12EnvironmentalOpen in IMG/M
3300010043Tropical forest soil microbial communities from Panama - MetaG Plot_26EnvironmentalOpen in IMG/M
3300010046Tropical forest soil microbial communities from Panama - MetaG Plot_36EnvironmentalOpen in IMG/M
3300010048Tropical forest soil microbial communities from Panama - MetaG Plot_11EnvironmentalOpen in IMG/M
3300010358Tropical forest soil microbial communities from Panama - MetaG Plot_3EnvironmentalOpen in IMG/M
3300010360Tropical forest soil microbial communities from Panama - MetaG Plot_6EnvironmentalOpen in IMG/M
3300010361Tropical forest soil microbial communities from Panama - MetaG Plot_23EnvironmentalOpen in IMG/M
3300010362Tropical forest soil microbial communities from Panama - MetaG Plot_22EnvironmentalOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300010398Tropical forest soil microbial communities from Panama - MetaG Plot_35EnvironmentalOpen in IMG/M
3300012948Tropical forest soil microbial communities from Panama - MetaG Plot_14EnvironmentalOpen in IMG/M
3300012989Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MGEnvironmentalOpen in IMG/M
3300016270Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080EnvironmentalOpen in IMG/M
3300016341Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170EnvironmentalOpen in IMG/M
3300016445Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108EnvironmentalOpen in IMG/M
3300017959Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MGEnvironmentalOpen in IMG/M
3300021445Bulk soil microbial communities from the field in Mead, Nebraska, USA - 072115-187_1 MetaGEnvironmentalOpen in IMG/M
3300021560Tropical forest soil microbial communities from Panama - MetaG Plot_4EnvironmentalOpen in IMG/M
3300025928Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025938Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025944Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027743Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 19-21cm September2015 (SPAdes)EnvironmentalOpen in IMG/M
3300031543Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20EnvironmentalOpen in IMG/M
3300031544Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26EnvironmentalOpen in IMG/M
3300031547Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D4EnvironmentalOpen in IMG/M
3300031549Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f24EnvironmentalOpen in IMG/M
3300031564Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21EnvironmentalOpen in IMG/M
3300031640Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23EnvironmentalOpen in IMG/M
3300031713Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22EnvironmentalOpen in IMG/M
3300031716Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3EnvironmentalOpen in IMG/M
3300031719Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2)EnvironmentalOpen in IMG/M
3300031724Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20EnvironmentalOpen in IMG/M
3300031744Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2)EnvironmentalOpen in IMG/M
3300031747Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22EnvironmentalOpen in IMG/M
3300031748Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22EnvironmentalOpen in IMG/M
3300031764Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f27EnvironmentalOpen in IMG/M
3300031765Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22EnvironmentalOpen in IMG/M
3300031768Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22EnvironmentalOpen in IMG/M
3300031770Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17EnvironmentalOpen in IMG/M
3300031777Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f24EnvironmentalOpen in IMG/M
3300031778Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f24EnvironmentalOpen in IMG/M
3300031781Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20EnvironmentalOpen in IMG/M
3300031792Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f23EnvironmentalOpen in IMG/M
3300031793Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f21EnvironmentalOpen in IMG/M
3300031795Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f19EnvironmentalOpen in IMG/M
3300031799Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f21EnvironmentalOpen in IMG/M
3300031805Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23EnvironmentalOpen in IMG/M
3300031832Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f25EnvironmentalOpen in IMG/M
3300031833Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178EnvironmentalOpen in IMG/M
3300031859Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f25EnvironmentalOpen in IMG/M
3300031890Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2)EnvironmentalOpen in IMG/M
3300031892Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D2EnvironmentalOpen in IMG/M
3300031896Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19EnvironmentalOpen in IMG/M
3300031912Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2)EnvironmentalOpen in IMG/M
3300031941Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080EnvironmentalOpen in IMG/M
3300031942Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176EnvironmentalOpen in IMG/M
3300031945Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082EnvironmentalOpen in IMG/M
3300031947Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000HEnvironmentalOpen in IMG/M
3300031981Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f25EnvironmentalOpen in IMG/M
3300032017Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D4EnvironmentalOpen in IMG/M
3300032025Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f20EnvironmentalOpen in IMG/M
3300032055Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f23EnvironmentalOpen in IMG/M
3300032063Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f17EnvironmentalOpen in IMG/M
3300032067Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f22EnvironmentalOpen in IMG/M
3300032076Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2)EnvironmentalOpen in IMG/M
3300032089Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f23EnvironmentalOpen in IMG/M
3300032090Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f22EnvironmentalOpen in IMG/M
3300032094Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f25EnvironmentalOpen in IMG/M
3300032174Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300032205Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05EnvironmentalOpen in IMG/M
3300032261Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2)EnvironmentalOpen in IMG/M
3300032892Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5EnvironmentalOpen in IMG/M
3300032893Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1EnvironmentalOpen in IMG/M
3300032954Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2EnvironmentalOpen in IMG/M
3300033290Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15EnvironmentalOpen in IMG/M
3300033475Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YCEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
INPhiseqgaiiFebDRAFT_10527453513300000364SoilRLRGVSEVRGQVSAGPKESGLIPGVLIGPRLSVAVPTPTFGAEVKVLRYFGASFDYGFFPKLNISGVDVSYSMWNVAARVYPFGDVLFVGAVYGHYGVEAXATVAQGTGSVRASSDFLGPQIGARWIQPSGFFFGIDVAWAFPLAYSSEASPDPSGTTTSVKVTADRYLRNGIPLVGLISVGWMF*
INPhiseqgaiiFebDRAFT_10555809123300000364SoilSDAGHRAEGVEGPTGAVATGDRRSGTRDSGLIPGVLIGPRLSLLALPTPALGVEAKILRYVGLSFDYGFFPKIDISGVSVSYSMWNVAARVYPWGNAFFIGAVYGHYGVEATATVAQGSGAVRASSTFIGPQLGARWIQSSGFFVGVDLAWAFPVGYTSEATPDPSGTTASVKQTADRYLQHGIPLVGLASVGWLF*
JGI1027J12803_10321764313300000955SoilEGPTGAVATGDRRSGTRDSGLIPGVLIGPRLSLLALPTPALGVEAKILRYVGLSFDYGFFPKIDISGVSVSYSMWNVAARVYPWGNAFFIGAVYGHYGVEATATVAQGSGAVRASSTFIGPQLGARWIQSSGFFVGVDLAWAFPVGYTSEATPDPSGTTASVKQTADRYLQHG
JGI10216J12902_11214454313300000956SoilLAVAVPAPTVGAEVKILRYFGASFDYGFFPKLTISGVDVNYSMWNVAARVYPFGDVFFVGAVYGHYGVEASATVAQGSGFVRASSNFLGPQIGARWVQPSGFFFGVDLAWAFPLGYSSEASPDPSGTTASVKETADRYLKNGIPLVGLISVGWMF*
JGI24750J21931_107509113300002070Corn, Switchgrass And Miscanthus RhizosphereEPRGKESGLIPGVLIGPRLSVAVPTPTFGAEVKVLRYFGASFDYGLVPKLTINGVDVNYSMWNVAARVYPFGDVFFVGAVYGHYGVEASATVAQGSGSVRASSDFLGPQIGARWIQPSGFFFGVDVAWAFPLSYHSEASPDPTGTTTSVKETADRWLKSGIPLAGLISVGWMF*
Ga0070665_10107930713300005548Switchgrass RhizosphereIGPRLSVAVPTPTFGAEVKVLRYFGASFDYGLVPKLTINGVDVNYSMWNVAARVYPFGDVFFVGAVYGHYGVEASATVAQGSGSVRASSDFLGPQIGARWIQPSGFFFGVDVAWAFPLSYHSEASPDPTGTTTSVKETADRWLKSGIPLAGLISVGWMF*
Ga0070664_10122013413300005564Corn RhizosphereVEVKVLRYFGASFDYGLIPKITINGVAVNYSMWNVGARVYPFGDVFFVGAVYGHYGVEASATVAQGTGSVSASSDFLGPQIGARWIQPSGFFFGIDVAWAFPLAYHSDASPDPSGTTTSVKETADRYLRNGIPLVGLVSVGWMF*
Ga0068866_1052560613300005718Miscanthus RhizosphereEVKVLRYFGASFDYGFFPKLTISGVDVSYSMWNVAARVYPFGDVFFVGAVYGHYGVEASATVAQGTGSVRASSDFLGPQIGARWIQPSGFFVGIDVAWAFPLGYRSEASPDPTGTTTSVKATADRYLRNGIPLVGLVSVGWMF*
Ga0066903_10003544513300005764Tropical Forest SoilDYALIPKVTISGVDVNYSMWNVAARFYPFGDVFFVGAVYGYYGVEATATVAQGTGSVRASSNFLGPQIGARWIQPSGFFFGVDLAWAFPLSYSSEASPDPSGTTTSVKVTADRYLKNGIPLAGLIAVGWMF*
Ga0066903_10096984513300005764Tropical Forest SoilDYALIPKVTISGVDVNYSMWNVAARFYPFGDVFFVGAVYGHYGVEAATTVAQGSGSVRASSNFLGPQIGARWIQPSGFFFGVDLAWAFPLSYSSEASPDPSGTTASVKETADRYLKNGIPLAGLISVGWMF*
Ga0097621_10006283843300006237Miscanthus RhizosphereSGLIPGVLIGPRLSVAVPSPTIGAEVKVLRYFGASFDYGLVPKISINGVDVNYSMWNVAARVYPFGDVFFVGAVYGHYGVEASATVAQGTGSVRASSDFLGPQIGARWIQPSGFFFGIDVAWAFPLAYHSDASPDPSGTTTSVKETADRYLRNGIPLVGLVSVGWMF*
Ga0074055_1111903023300006573SoilKVLRYFGASFDYGLFPKLTISGVDVSYSMWNVAARVYPFGDVFFVGAVYGHYGVEATKTVAQGTGSVRASSDFLGPQIGARWIQPSGFFFGIDVAWAFPLGYRSEASPDPTGTTTSVKETADRYLRNGIPLVGLVSVGWMF*
Ga0074054_1195371323300006579SoilPTLALELTISGVDVNYSMWNVAARVYPFGDVFFVGAVYGHYGVEATKTVAQGTGSVRASSDFLGPQIGARWIQPSGFFFGIDVAWAFPLAYHSEASPDPTGTTTSVKETADRYLRNGIPLVGLVSVGWMF*
Ga0074057_1121394123300006605SoilSVAVPTPTFGAEVKVLRYFGASFDYGLFPKLTISGVDVSYSMWNVAARVYPFGDVFFVGAVYGHYGVEATKTVAQGTGSVRASSDFLGPQIGARWIQPSGFFFGIDVAWAFPLGYRSEASPDPTGTTTSVKETADRYLRNGIPLVGLVSVGWMF*
Ga0074057_1186974513300006605SoilAEVKILRYFGASFDYGFFPKLTISGVDVNYSMWNVAARVYPFGDVFFVGAVYGHYGVEASATVAQGSGFVRASSNFLGPQVGARWIQPSGFFFGIDVAWAFPLGYSSEASPDPSGTTTSVKETADRYLKNGIPLVGLISVGWMF*
Ga0075429_10112024213300006880Populus RhizospherePRLTVAVPTPTFGVEVKILRFVGASFDYGFFPKLTISGVDVSYSMWNVAARAYPFGDVFFVGLVYGHYGVEASATVAQGTGSVRASSDFLGPQIGARWIQPSGFFFGIDVAWAFPLGYRSEASFDPTGTTTSVKETADRYLKNGIPLVGLVSVGWMF*
Ga0075418_1270155313300009100Populus RhizosphereTVAVPTPTFGVEVKILRFVGASFDYGFFPKLTISGVDVSYSMWNVAARAYPFGDVFFVGLVYGHYGVEASATVAQGTGSVRASSDFLGPQIGARWIQPSGFFFGIDVAWAFPLGYRSEASFDPTGTTTSVKETADRYLKNGIPLVGLVSVGWMF*
Ga0111538_1010402833300009156Populus RhizosphereEATRASEVRTHAEAGGSGPKQSGLIPGVLIGPRLTVAVPTPTFGVEVKILRFVGASFDYGFFPKLTISGVDVSYSMWNVAARAYPFGDVFFVGLVYGHYGVEASATVAQGTGSVRASSDFLGPQIGARWIQPSGFFFGIDVAWAFPLGYRSEASFDPTGTTTSVKETADRYLKNGIPLVGLVSVGWMF*
Ga0126374_1017383913300009792Tropical Forest SoilMPGVPRVDARVAAESKGSSSGTKESGLIPGVLIGPRLAVAVPVPTVGVEAKVLRYFGAAFDYGIFPKISISGVDVSYSSWNVAARIYPWGDTFFIGAVYGHYGIDASATVAQGTGSVRANSNFIGPQIGARWIQPSGFFFGIDLAWAFPVGYSSEASPDPTGTTTSVKQTADRWLQNGIPLVGLVSVGWLF*
Ga0126380_1192327313300010043Tropical Forest SoilPRVDGRAGAESGNRTSGSKESGLIPGVLIGPRLAVAVPVPTVGVEAKILRYFGAAFDYGVFPKINISGVDVSYSSWNVAARVYPWGDTFFVGAVYGHYGIEASATVAQGSGYVRANSNFIGPQIGARWIQPSGFFFGIDLAWAFPLGYSSEASPDPSGTTTSVKQTADRWLQNGIPLVG
Ga0126384_1047715413300010046Tropical Forest SoilRGARDSGLSPGILIGPRVSVAVPTPTIGAEAKVLRYFGASFDYGYFPKINISGVDVSYSMWNVAARVYPWGDTFFVGVVYGHYGVEANATVAQGSGFVRASSSFVGPQIGARWIQPSGFLVGVDVAWAFPVGYSSEASPDPSGTTTSVKETADRYLKNGIPIVGLVSVGWMF*
Ga0126384_1104967613300010046Tropical Forest SoilLIPGVLIGPRLSVAVPTPTFGVEVKVLRYFGASFDYGFFPKLTISGVDVSYSMWNVAARVYPFGDVLFVGAVYGHYGVEASANVAQGSGSVRASSDFLGPQIGARWIQPSGFFFGIDVAWAFPLAYSSEASPDPSGTTTSVKVTADRYLKNGIPLVGLVSVGWMF*
Ga0126384_1154952613300010046Tropical Forest SoilAVAVPVPTVGVEVKALRYFGAAFDYGIFPKISISGVDVSYSSWNVAARIYPWGDTFFVGAVYGHYRIEATATVAQGTGYVRANSTFIGPQIGARWIQPSGFFFGIDLAWAFPLGYSSEASPDPSGTTTSVKQTADRWLQNGIPLVGLVSVGWLF*
Ga0126373_1184527313300010048Tropical Forest SoilVDVTGSGPKVSGLIPGVLIGPRLSVAVPTPTFGAEVKILRYFGASFDYGFFPKLTISGVDVSYSMWNVAARVYPFGDVFFVGAVYGHYGVEATVAQGTGSVRASSDFLGPQIGARWIQPSGFFFGVDVAWAFPLGYSSEASPDPSGTTTSVKETADRYLRNGIPLVGLVSVGWMF*
Ga0126370_1192522613300010358Tropical Forest SoilRADESAGRPPVTESRVDTDRTIDSRPDRKDSGLIPGVLIGPRLSVAVPTPTLGVETKILRYFGASFDYALIPKVTISGVDVNYSMWNVAARFYPFGDVFFVGAVYGYYGVEATATVAQGTGSVRASSNFLGPQIGARWIQPSGFFFGVDLAWAFPLSYSSEASPDPSGTTASVKETADRYLKNGIPLAGLI
Ga0126372_1251065213300010360Tropical Forest SoilRLTVAVPTPTFGAEVKVLRFFGASFDYGFFPKLKISGVDVSYSMWNVAARVYPFGDVFFVGAVYGHYGVEASATVAQGTGSVHASSDFLGPQIGARWIQPSGFFFGVDVAWAFPLSYRSEASPDPTGTTTSVKETADRYLKNGIPLVGLVSVGWMF*
Ga0126372_1328896313300010360Tropical Forest SoilVLAAPLAHAEEATRSSEVRTYAEPGGSGPKQSGLIPGVLIGPRLAVAVPTPTFGAEVKILRFIGASFDYGFFPKITISGVDVSYSMWNVAARVYPFGDVFFVGAVYGHYGVEASATVAQGTGWVRASSDFLGPQIGARWIQPSGFFFGIDLAWAFPLGYSSEASPDP
Ga0126378_1084986023300010361Tropical Forest SoilSGTKESGLIPGVLIGPRLAVAVPVPTVGVEAKVLRYFGAAFDYGIFPKISISGVDVSYSSWNVAARIYPWGDTFFIGAVYGHYGIDASATVAQGTGSVRANSNFIGPQVGARWIQPSGFFFGIDLAWAFPVGYSSEASPDPTGTTTSVKQTADRWLQNGIPLVGLVSVGWLF*
Ga0126377_1094126613300010362Tropical Forest SoilGNRTSGSKESGLIPGVLIGPRLAVAVPVPTVGVEAKILRYLGAAFDYGIFPKINISGVDVSYSSWNVAARVYPWGDTFFVGAVYGHYGIEASATVAQGSGYVRANSNFIGPQIGARWLQPSGFFFGIDVAWAFPVGYSSEASPDPSGTTTSVKQTADRWLQNGIPLVGLVSVGWLF*
Ga0126381_10276776413300010376Tropical Forest SoilVDGRVEAESKGSSSGTKESGLIPGVLIGPRLAVAVPVPTVGVEAKVLRYFGAAFDYGIFPKISISGVDVSYSSWNVAARIYPWGDTFFIGAVYGHYGIDASATVAQGTGYVRANSTFIGPQIGARWIQPSGFFFGIDLAWAFPLGYS
Ga0126383_1023218123300010398Tropical Forest SoilMPGVPRVDGRVEAESKGSSSGTKESGLIPGVLIGPRLAVAVPVPTVGVEAKVLRYFGAAFDYGIFPKISISGVDVSYSSWNVAARIYPWGDTFFIGAVYGHYGIDASATVAQGTGSVRANSNFIGPQVGARWIQPSGFFFGIDLAWAFPVGYSSEASPDPTGTTTSVKQTADRWLQNGIPLVGLVSVGWLF*
Ga0126375_1104298323300012948Tropical Forest SoilGPRLAVAVPVPTVGVEAKILRYFGAAFDYGVFPKINISGVDVSYSSWNVAARVYPWGDTFFVGAVYGHYGIEASATVAQGSGYVRANSNFIGPQIGARWLQPSGFFFGIDVAWAFPVGYSSEASPDPSGTTTSVKQTADRWLQNGIPLVGLVSVGWLF*
Ga0164305_1103535913300012989SoilINGVDVNYSMWNVAARVYPFGDVFFVGAVYGHYGVEASATVAQGSGSVRASSDFLGPQIGARWIQPSGFFFGVDVAWAFPLAYHSEASPDPTGTTTSVKETADRWLKNGIPLAGLISVGWMF*
Ga0182036_1032008713300016270SoilPSRHRDSGLIPGMLIGPRLTVAVPTPTIGAEAKILRYFGASFDYGYFPKINIAGVDVSYSMWNVAARVYPFGDVFFIGAVYGHYGVEATATVAQGTGFVRASSNFLGPQIGARWIQPSGFFFGVEVAWAFALGYSSEASPDPSGTTQSVKQTADRYLQNGIPIVGLVSVGWMF
Ga0182035_1209240213300016341SoilKLFRYFGASFDYALFPKITINGVEVSYSMWNVAARVYPFGDVFFVGAVYGHYGIEASATVAQGTGSVRASSNFLGPQIGARWIQPSGFFFGIDVAWAFPLGYSSEASPGPSGTTTSVKDTADRYLRNGIPLVGLISVGWLF
Ga0182038_1014608313300016445SoilTKESGIIPGVLIGPRLSVAVPTPTFGAEVKILRYFGASFDYGFFPKLTISGVDVSYSMWNVAARVYPFGDVFFIGAVYGHYGIEASATVAQGTGSVRASSNFLGPQIGARWIQPSGFFFGIDVAWAFPLGYSSEASPDPSGTTTSVKNTGDRYLRNGIPLVGLVSVGWMF
Ga0187779_1135905313300017959Tropical PeatlandSVAVPAPTLGAEVKFMRYLGASFDYGLFPKLTISGVDVSYSMWSVGARVYPWGDVFFIGAVYGHYGVEATANVAQGSGTVRASSDFLGPQIGARWIQPSGFFFGLDLAWAFPIGYSSEASPDPSGTTTSVKETADRYLRNGIPLVGLISVGWMF
Ga0182009_1067621913300021445SoilPTFGAEVKVLRYFGASFDYGVVPKLTINGVDVNYSMWNVAARVYPFGDVFFVGAVYGHYGVEASATVAQGSGSVRASSDFLGPQIGARWIQPSGFFFGVDVAWAFPLAYHSEASPDPTGTTTSVKETADRWLKNGIPLAGLISVGWMF
Ga0126371_1216067513300021560Tropical Forest SoilTKILRYFGASFDYALIPKVTISGVDVNYSMWNVAARFYPFGDVFFVGAVYGHYGVEATATVAQGTGSVRASSNFLGPQIGARWIQPSGFFFGVDLAWAFPLSYSSEASPDPSGTTTSVKVTADRYLKNGIPLAGLIAVGWMF
Ga0207700_1182707023300025928Corn, Switchgrass And Miscanthus RhizosphereVPKLTINGVDVNYSMWNVAARVYPFGDVFFVGAVYGHYGVEASATVAQGSGSVRASSDFLGPQIGARWIQPSGFFFGVDVAWAFPLSYHSEASPDPTGTTTSVKETADRWLKSGIPLAGLISVGWMF
Ga0207704_1000760513300025938Miscanthus RhizosphereLTINGVDVNYSMWNVAARVYPFGDVFFVGAVYGHYGVEASATVAQGSGSVRASSDFLGPQIGARWIQPSGFFFGVDVAWAFPLSYHSEASPDPTGTTTSVKETADRWLKSGIPLAGLISVGWMF
Ga0207661_1025064213300025944Corn RhizosphereLTINGVDVNYSMWNVAARVYPFGDVFFVGAVYGHYGVEASATVAQGSGSVRASSDFLGPQIGARWIQPSGFFFGVDVAWAFPLAYHSEASPDPTGTTTSVKETADRWLKSGIPLAGLISVGWMF
Ga0209593_1007268813300027743Freshwater SedimentVEVKILRFVGASFDYGFFPKLTISGVDVTYSMWNVAARVYPFGDVFFVGAVYGHYGVEASATVAQGTGSVRASSDFLGPQVGARWIQPSGFFFGVDVAWAFPLGYRSEASFDPSGTTTSVKETADRYLKNGIPLVGLVSVGWMF
Ga0318516_1085138613300031543SoilEVERRAGEDHDTPSRHRDSGLIPGMLIGPRLTVAVPTPTIGAEAKILRYFGASFDYGYFPKINIAGVDVSYSMWNVAARIYPFGDVFFIGAVYGHYGVEATATVAQGTGFVRASSNFLGPQIGARWIQPSGFFFGVEVAWAFALGYSSEASPDPSGTTQSVKQTADRYLQN
Ga0318534_1084230113300031544SoilDYALIPKVTISNVDVNYSMWNVAARFYPFGDVFFVGAVYGHYGVEATTTVAQGTGSVRASSNFFGPQIGARWIQPSGFFFGVDLAWAFPLSYSSEASPDPSGTTASVKETADRYLKNGIPLAGLISVGWMF
Ga0310887_1055068413300031547SoilAGEATLDSSEVRRQAEPGPKTSGLIPGVLIGPRLSVAVPTPTFGAEVKILRYFGASFDYGFFPKLTISGVDVSYSMWNVAARVYPFGDVLFVGAVYGHYGVEASATVAQGTGSVRASSDFLGPQIGARWIQPSGFFFGIDVAWAFPLAYSSEASPDPSGTTTSVKVTADRYLRNGIPLVGLISVGWMF
Ga0318571_1043179613300031549SoilDHDTPSRHRDSGLIPGMLIGPRLTVAVPTPTIGAEAKILRYFGASFDYGYFPKINIAGVDVSYSMWNVAARVYPFGDVFFIGAVYGHYGVEATATVAQGTGYVRASSNFLGPQIGARWIQPSGFFFGVEVAWAFALGYSSEASPDPSGTTQSVKQTADRYLQNGIPIVGLVSV
Ga0318573_1061207213300031564SoilVAVPTPTFGAEVKILRYFGASFDYGFFPKLNISGVDVSYSMWNVAARVYPFGDVFFIGAVYGHYGIEASATVAQGTGSVRASSNFLGPQIGARWIQPSGFFFGIDVAWAFPLGYSSEASPDPSGTTTSVKDTADRYLRNGIPLVGLVSVGWMF
Ga0318555_1075023313300031640SoilRGSGTKESGIIPGVLIGPRLSVAVPTPTFGAEVKILRYFGASFDYGFFPKLNISGVDVSYSMWNVAARVYPFGDVFFIGAVYGHYGIEASATVAQGTGSVRASSDFLGPQIGARWIQPSGFFFGIDVAWAFPLGYSSEASPDPSGTTTSVKDTADRYLRNGIPLVGLVSVGWMF
Ga0318496_1009555413300031713SoilADESAGGPPVMESRVDTDRRTTESRTDHKDSGLIPGVLIGPRLSVAVPTPTLGVETKILRYFGASFDYALIPKVTISNVDVNYSMWNVAARFYPFGDVFFVGAVYGHYGVEATTTVAQGTGSVRASSNFFGPQIGARWIQPSGFFFGVDLAWAFPLSYSSEASPDPSGTTASVKETADRYLKNGIPLAGLISVGWMF
Ga0310813_1098653113300031716SoilDVSYSLWNVAARAYPFGDVFFVGLVYGHYGVEASATVAQGTGSVRASSDFLGPQIGARWIQPSGFFFGIDVAWAFPLGYRSEASFDPTGTTTSVKETADRYLKNGIPLVGLVSVGWMF
Ga0306917_1072455113300031719SoilAKILRYFGASFDYGYFPKINIAGVDVSYSMWNVAARIYPFGDVFFIGAVYGHYGVEATATVAQGTGFVRASSNFLGPQIGARWIQPSGFFFGVEVAWAFALGYSSEASPDPSGTTQSVKQTADRYLQNGIPIVGLVSVGWMF
Ga0318500_1036748223300031724SoilALFDYALIPKVTISNVDVNYSMWNVAARFYPFGDVFFVGAVYGHYGVEATTTVAQGTGSVRASSNFFGPQIGARWIQPSGFFFGVDLAWAFPLSYSSEASPDPSGTTASVKETADRYLKNGIPLAGLISVGWMF
Ga0318500_1068321913300031724SoilRYFGASFDYALFPKITINGVNVSYSMWNVAARVYPFGDVFFVGAVYGHYGIEASATVAQGTGSVRASSDFLGPQIGARWIQPSGFFFGIDVAWAFPLGYSSEASPDPSGTTTSVKNTADRYLRNGIPLVGLVSVGWMF
Ga0306918_1033504123300031744SoilGILIGPRLSVAVPTPTFGAEVKILRYFGASFDYGFFPKLSISGVDVSYSMWNVAARVYPFGDVFFVGAVYGHYGIEASATVAQGTGSVRASSDFLGPQIGARWIQPSGFFFGIDVAWAFPLGYSSEASPDPSGTTTSVKNTADRYLRNGIPLVGLVSVGWMF
Ga0318502_1013432523300031747SoilPGMLLGPRLTVAVPTPTIGAEAKILRYFGASFDYGYFPKINIAGVDVSYSMWNVAARIYPFGDVFFIGAVYGHYGVEATATVAQGTGFVRASSNFLGPQIGARWIQPSGFFFGVEVAWAFALGYSSEASPDPSGTTQSVKQTADRYLQNGIPIVGLVSVGWMF
Ga0318502_1035190113300031747SoilPTPTFGAEVKILRYFGASFDYGFFPKLTISGVDVSYSMWNVAARVYPFGDVFFVGAVYGHYGIEASATVAQGTGSVRASSDFLGPQIGARWIQPSGFFFGIDVAWAFPLGYSSEASPDPSGTTTSVKVTADRYLKNGIPLVGLVSVGWMF
Ga0318492_1050829213300031748SoilLFPKISISGVDVSYSSWNVAARIYPWGDTFFVGAVYGHYGIEASATVAQGTGSVRANSNFIGPQIGARWIQPSGFFFGIDLAWAFPLGYSSEATPDPTGTTTSVKQTADRWLQNGIPLVGLVSVGWLF
Ga0318535_1035006813300031764SoilEVRGQVDGTGRGSGTKESGIIPGVLIGPRLSVAVPTPTFGAEVKILRYFGASFDYGFFPKLTISGVDVSYSMWNVAARVYPFGDVFFVGAVYGHYGIEASATVAQGTGSVRASSDFLGPQIGARWIQPSGFFFGIDVAWAFPLGYSSEASPDPSGTTTSVKNTADRYLRNGIPLVGLVSVGWMF
Ga0318554_1000762273300031765SoilGMLIGPRLTVAVPTPTIGAEAKILRYFGASFDYGYFPKINIAGVDVSYSMWNVAARIYPFGDVFFIGAVYGHYGVEATATVAQGTGFVRASSNFLGPQIGARWIQPSGFFFGVEVAWAFALGYSSEASPDPSGTTQSVKQTADRYLQNGIPIVGLVSVGWMF
Ga0318509_1025439323300031768SoilAVPTPTIGAEAKILRYFGASFDYGYFPKINIAGVDVSYSMWNVAARIYPFGDVFFIGAVYGHYGVEATATVAQGTGFVRASSNFLGPQIGARWIQPSGFFFGVEVAWAFALGYSSEASPDPSGTTQSVKQTADRYLQNGIPIVGLVSVGWMF
Ga0318521_1098687813300031770SoilYGFFPKLSISGVDVSYSMWNVAARVYPFGDVFFVGAVYGHYGIEASATVAQGTGSVRASSNFLGPQIGARWIQPSGFFFGIDVAWAFPLGYSSEASPDPSGTTTSVKNTADRYLRNGIPLVGLVSVGWMF
Ga0318543_1019268213300031777SoilVTEVERRAGEDHDTPSRHRDSGLIPGMLIGPRLTVAVPTPTIGAEAKILRYFGASFDYGYFPKINIAGVDVSYSMWNVAARIYPFGDVFFIGAVYGHYGVEATATVAQGTGFVRASSNFLGPQIGARWIQPSGFFFGVEVAWAFALGYSSEASPDPSGTTQSVKQTADRYLQNGIPIVGLVSVGWMF
Ga0318498_1049344313300031778SoilIPGVLIGPRLSVAVPTPTFGAEVKILRYFGASFDYGFFPKLTISGVDVSYSMWNVAARVYPFGDVFFVGAVYGHYGVEASATVAQGSGFVRASSNFLGPQIGARWIQPSGFFFGIDVAWAFPLGYSSEASPDPSGTTTSVKNTADRYLRNGIPLVGLVSVGWMF
Ga0318547_1022263023300031781SoilMLIGPRLTVAVPTPTIGAEAKILRYFGASFDYGYFPKINIAGVDVSYSMWNVAARIYPFGDVFFIGAVYGHYGVEATATVAQGTGFVRASSNFLGPQIGARWIQPSGFFFGVEVAWAFALGYSSEASPDPSGTTQSVKQTADRYLQNGIPIVGLVSVGWMF
Ga0318529_1013805823300031792SoilPKVTISNVDVNYSMWNVAARFYPFGDVFFVGAVYGHYGVEATTTVAQGTGSVRASSNFFGPQIGARWIQPSGFFFGVDLAWAFPLSYSSEASPDPSGTTASVKETADRYLKNGIPLAGLISVGWMF
Ga0318548_1044497413300031793SoilKVAVPTPTFGAEVKILRYFGASFDYGFFPKLSISGVDVSYSMWNVAARVYPFGDVFFVGAVYGHYGIEASATVAQGTGSVRASSNFLGPQIGARWIQPSGFFFGIDVAWAFPLGYSSEASPDPSGTTTSVKDTADRYLRNGIPLVGLVSVGWMF
Ga0318557_1002346533300031795SoilVAVPTPTLGVETKILRYFGASFDYALIPKVTISNVDVNYSMWNVAARFYPFGDVFFVGAVYGHYGVEATTTVAQGTGSVRASSNFFGPQIGARWIQPSGFFFGVDLAWAFPLSYSSEASPDPSGTTASVKETADRYLKNGIPLAGLISVGWMF
Ga0318565_1058302213300031799SoilLIGPRLSVAVPTPTFGAEVKILRYFGASFDYGFFPKLSISGVDVSYSMWNVAARVYPFGDVFFVGAVYGHYGIEASATVAQGTGSVRASSDFLGPQIGARWIQPSGFFFGIDVAWAFPLGYSSEASPDPSGTTTSVKDTADRYLRNGIPLVGLVSVGWMF
Ga0318497_1025035813300031805SoilLIPKVTISNVDVNYSMWNVAARFYPFGDVFFVGAVYGHYGVEATTTVAQGTGSVRASSNFFGPQIGARWIQPSGFFFGVDLAWAFPLSYSSEASPDPSGTTASVKETADRYLKNGIPLAGLISVGWMF
Ga0318499_1037983213300031832SoilPKLSISGVDVSYSMWNVAARVYPFGDVFFVGAVYGHYGIEASATVAQGTGSVRASSDFLGPQIGARWIQPSGFFFGIDVAWAFPLGYSSEASPDPSGTTTSVKDTADRYLRNGIPLVGLVSVGWMF
Ga0310917_1033643523300031833SoilATEVRGQVDGTGRGSGTKESGIIPGVLIGPRLSVAVPTPTFGAEVKILRYCGASFDYGFFPKLTISGVDVSYSMWNVAARVYPFGDVFFIGAVYGHYGIEASATVAQGTGSVRASSDFLGPQIGARWIQPSGFFFGIDVAWAFPLGYSSEASPDPSGTTTSVKDTADRYLRNGIPLVGLVSVGWMF
Ga0310917_1040885113300031833SoilPRLSVAVPTPTLGVETKILRYFGASFDYGYFPKINIAGVDVSYSMWNVAARIYPFGDVFFIGAVYGHYGVEATATVAQGTGFVRASSNFLGPQIGARWIQPSGFFFGVEVAWAFALGYSSEASPDPSGTTQSVKQTADRYLQNGIPIVGLVSVGWMF
Ga0318527_1045448423300031859SoilKINIAGVDVSYSMWNVAARIYPFGDVFFIGAVYGHYGVEATATVAQGTGFVRASSNFLGPQIGARWIQPSGFFFGVEVAWAFALGYSSEASPDPSGTTQSVKQTADRYLQNGIPIVGLVSVGWMF
Ga0306925_1105253823300031890SoilFFPKLSISGVDVSYSMWNVAARVYPFGDVFFVGAVYGHYGIEASATVAQGTGSVRASSNFLGPQIGARWIQPSGFFFGIDVAWAFPLGYSSEASPDPSGTTTSVKNTADRYLRNGIPLVGLVSVGWMF
Ga0310893_1034170823300031892SoilRYFGASFDYGLVPKLTINGVDVNYSMWNVAARVYPFGDVFFVGAVYGHYGVEASATVAQGSGSVRASSDFLGPQIGARWIQPSGFFFGVDVAWAFPLSYHSEASPDPTGTTTSVKETADRWLKSGIPLAGLISVGWMF
Ga0318551_1002515533300031896SoilPGSGVGAPAPEGVRSVTEVERRAGEDHDTPSRHRDSGLIPGMLIGPRLTVAVPTPTIGAEAKILRYFGASFDYGYFPKINIAGVDVSYSMWNVAARIYPFGDVFFIGAVYGHYGVEATATVAQGTGFVRASSNFLGPQIGARWIQPSGFFFGVEVAWAFALGYSSEASPDPSGTTQSVKQTADRYLQNGIPIVGLVSVGWMF
Ga0306921_1099383813300031912SoilPTPTFGAEVKILRYFGASFDYGFFPKLTISGVDVSYSMWNVAARVYPFGDVFFVGAVYGHYGIEASATVAQGTGSVRASSNFLGPQIGARWIQPSGFFFGIDVAWAFPLGYSSEASPDPSGTTTSVKDTADRYLRNGIPLVGLVSVGWMF
Ga0310912_1042213823300031941SoilLRYFGASFDYGFFPKLNISGVDVSYSMWNVAARVYPFGDVFFVGAVYGHYGIEASATVAQGTGSVRASSNFLGPQIGARWIQPSGFFFGIDVAWAFPLGYSSEASPDPSGTTTSVKDTADRYLRNGIPLVGLVSVGWMF
Ga0310916_1113236523300031942SoilKILRYFGASFDYGFFPKLNISGVDVSYSMWNVAARVYPFGDVFFIGAVYGHYGIEASATVAQGTGSVRASSDFLGPQIGARWIQPSGFFFGIDVAWAFPLGYSSEASPDPSGTTTSVKNTADRYLRNGIPLVGLVSVGWMF
Ga0310913_1130023713300031945SoilVLIGPRLSVAVPTPTLGVETKILRYFGASFDYALIPKVTISNVDVNYSMWNVAARFYPFGDVFFVGAVYGHYGVEATTTVAQGTGSVRASSNFFGPQIGARWIQPSGFFFGVDLAWAFPLSYSSEASPDPSGTTASVKETADRYLKNGIPLAGLISVGWMF
Ga0310909_1151290923300031947SoilVSYSMWNVAARVYPFGDVFFVGAVYGHYGIEASATVAQGTGSVRASSNFLGPQIGARWIQPSGFFFGIDVAWAFPLGYSSEASPDPSGTTTSVKDTADRYLRNGIPLVGLVSVGWMF
Ga0318531_1033784923300031981SoilVDVSYSMWNVAARVYPFGDVFFIGAVYGHYGIEASATVAQGTGSVRASSDFLGPQIGARWIQPSGFFFGIDVAWAFPLGYSSEASPDPSGTTTSVKNTADRYLRNGIPLVGLVSVGWMF
Ga0310899_1061599513300032017SoilLIGPRLSVAVPTPTFGAEVKVLRYFGASFDYGLVPKLTINGVDVNYSMWNVAARVYPFGDVFFVGAVYGHYGVEASATVAQGSGSVRASSDFLGPQIGARWVQPSGFFFGVDVAWAFPLSYHSEASPDPTGTTTSVKETADRWLKSGIPLAGLISVGWMF
Ga0318507_1044218813300032025SoilPGVLIGPRLSVAVPTPTFGAEVKILRYFGASFDYGFFPKLTISGVDVSYSMWNVAARVYPFGDVFFVGAVYGHYGIEASATVAQGTGSVRASSDFLGPQIGARWIQPSGFFFGIDVAWAFPLGYSSEASPDPSGTTTSVKNTADRYLRNGIPLVGLVSVGWMF
Ga0318575_1031738213300032055SoilKILRYFGASFDYGFFPKLTISGVDVSYSMWNVAARVYPFGDVFFVGAVYGHYGVEASATVAQGTGSVRASSDFLGPQIGARWIQPSGFFFGVDVAWAFPLAYSSEASPDPSGTTTSVKVTADRYLRNGIPLVGLVSVGWMF
Ga0318504_1061074313300032063SoilPKLNISGVDVSYSMWNVAARVYPFGDVLFIGAVYGHYGIEASATVAQGTGSVRASSDFLGPQIGARWIQPSGFFFGIDVAWAFPLGYSSEASPDPSGTTTSVKDTADRYLRNGIPLVGLVSVGWMF
Ga0318524_1001426543300032067SoilLRYFGASFDYGYFPKINIAGVDVSYSMWNVAARIYPFGDVFFIGAVYGHYGVEATATVAQGTGFVRASSNFLGPQIGARWIQPSGFFFGVEVAWAFALGYSSEASPDPSGTTQSVKQTADRYLQNGIPIVGLVSVGWMF
Ga0318524_1068360713300032067SoilTKESGIIPGVLIGPRLSVAVPTPTFGAEVKILRYFGASFDYGFFPKLNISGVDVSYSMWNVAARVYPFGDVFFIGAVYGHYGIEASATVAQGTGSVRASSNFLGPQIGARWIQPSGFFFGIDVAWAFPLGYSSEASPDPSGTTTSVKDTADRYLRNGIPLVGLVSVGWMF
Ga0306924_1031560913300032076SoilIPGVLIGPRLSVAVPTPTFGAEVKILRYFGASFDYGFFPKLNISGVDVSYSMWNVAARVYPFGDVFFVGAVYGHYGIEASATVAQGTGSVRASSDFLGPQIGARWIQPSGFFFGIDVAWAFPLGYSSEASPDPSGTTTSVKDTADRYLRNGIPLVGLVSVGWMF
Ga0318525_1058763413300032089SoilTGRGSDTKESGIIPGVLIGPRLSVAVPTPTFGAEVKILRYFGASFDYGFFPKLTISGVDVSYSMWNVAARVYPFGDVFFVGAVYGHYGIEASATVAQGTGSVRASSDFLGPQIGARWIQPSGFFFGIDVAWAFPLGYSSEASPDPSGTTTSVKNTADRYLRNGIPLVGLVSVGWMF
Ga0318518_1028521413300032090SoilPTPTIGAEAKILRYFGASFDYGYFPKINIAGVDVSYSMWNVAARIYPFGDVFFIGAVYGHYGVEATATVAQGTGFVRASSNFLGPQIGARWIQPSGFFFGVEVAWAFALGYSSEASPDPSGTTQSVKQTADRYLQNGIPIVGLVSVGWMF
Ga0318518_1038113323300032090SoilILIGPRLSVAVPTPTFGAEVKILRYFGASFDYGFFPKLTISGVDVSYSMWNVAARVYPFGDVFFVGAVYGHYGVEASATVAQGTGSVRASSDFLGPQIGARWIQPSGFFFGVDVAWAFPLAYSSEASPDPSGTTTSVKVTADRYLRNGIPLVGLVSVGWMF
Ga0318540_1066094913300032094SoilVRGQVDGTGRGSDTKESGIIPGVLIGPRLSVAVPTPTFGAEVKILRYFGASFDYGFFPKLTISGVDVSYSMWNVAARVYPFGDVFFVGAVYGHYGIEASATVAQGTGSVRASSDFLGPQIGARWIQPSGFFFGIDVAWAFPLGYSSEASPDPSGTTTSVKNTADRYL
Ga0307470_1161518123300032174Hardwood Forest SoilDYGLVPKLTINGVDVNYSMWNVAARVYPFGDVFFVGAVYGHYGVEASATVAQGSGSVRASSDFLGPQIGARWIQPSGFFFGVDVAWAFPLSYHSEASPDPTGTTTSVKETADRWLKSGIPLAGLISVGWMF
Ga0307471_10110669013300032180Hardwood Forest SoilGFFPKLNINGVDVNYSMWNVAARVYPFGDVFFVGAVYGHYGVEASATVAQGSGSVRASSDFLGPQIGARWIQPSGFFFGVDVAWAFPLSYHSEASPDPTGTTTSVKETADRWLKSGIPLAGLISVGWMF
Ga0307471_10371345513300032180Hardwood Forest SoilPGPKESGLIPGILIGPRLAVAVPAPTFGVEAKILRYFGASFDYGLLPRFNISGVDVSYSMWSVAARVFPWGDTFFVGAVYGHYGIEGSATVAQGTGAVRASTSFIGPQIGARWIQPSGFFFGIDLAWAFPLGYSSEATPDPSGTTLSAKETVDRYLKNGIPLVGLVSVGWLF
Ga0307472_10168396413300032205Hardwood Forest SoilLRGSQQLDGRDASGTKVSGIIPGVLFGPRLSVAVPTPTFGAEVKVLRYFGASFDYGFFPKLNIAGVDVNYSMWNVAARVYPFGDVFFVGLVYGHYGVEASATVAQGTGFVRASSTFLGPQVGARWIQPSGFFFGVDVAWAFPLGYSSEASPDPSGTTASVKETADRYLKNGIPLAGLISFGWMF
Ga0306920_10407172213300032261SoilTKESGIIPGVLIGPRLSVAVPTPTFGAEVKILRYFGASFDYGFFPKLTISGVDVSYSMWNVAARVYPFGDVFFVGAVYGHYGIEASATVAQGTGSVRASSDFLGPQIGARWIQPSGFFFGIDVAWAFPLGYSSEASPDPSGTTTSVKNTADRYLRNGIPLVGLVSVGWMF
Ga0335081_1274851913300032892SoilFPKLTISGVDVSYSMWSVGARVYPWGDVFFVGAVYGHYGVEATANVAQGSGTVRASSDFLGPQIGARWIQPSGFFFGIDLAWAFPIGYSSEASPDPSGTTTSVKETADRYLRNGIPLVGLISVGWMF
Ga0335069_1035258013300032893SoilVAVPAPTLGAEVKFMRYLGASFDYGLFPKLTISGVDVSYSMWSVGARVYPWGDVFFVGAVYGHYGVEATANVAQGSGTVRASSDFLGPQIGARWIQPSGFFFGIDLAWAFPIGYSSEASPDPSGTTTSVKETADRYLRNGIPLVGLISVGWMF
Ga0335083_1014207513300032954SoilGVDVSYSMWSVGARVYPWGDVFFVGAVYGHYGVEATANVAQGSGTVRASSDFLGPQIGARWIQPSGFFFGIDLAWAFPIGYSSEASPDPSGTTTSVKETADRYLRNGIPLVGLISVGWMF
Ga0318519_1010203623300033290SoilVRSVTEVERRAGEDHDTPSRHRDSGLIPGMLIGPRLTVAVPTPTIGAEAKILRYFGASFDYGYFPKINIAGVDVSYSMWNVAARIYPFGDVFFIGAVYGHYGVEATATVAQGTGFVRASSNFLGPQIGARWIQPSGFFFGVEVAWAFALGYSSEASPDPSGTTQSVKQTADRYLQNGIPIVGLVSVGWMF
Ga0310811_1001540493300033475SoilEVKVLRYFGASFDYGVVPKLTINGVDVNYSMWNVAARVYPFGDVFFVGAVYGHYGVEASATVAQGSGSVRASSDFLGPQIGARWIQPSGFFFGVDVAWAFPLAYHSEASPDPTGTTTSVKETADRWLKNGIPLAGLISVGWMF

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.