Basic Information | |
---|---|
Family ID | F097549 |
Family Type | Metagenome |
Number of Sequences | 104 |
Average Sequence Length | 43 residues |
Representative Sequence | MAQVTLGIGSSHSPMLSTPHEAFAGLGDLDRARLPEFAARARE |
Number of Associated Samples | 93 |
Number of Associated Scaffolds | 104 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | No |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 95.15 % |
% of genes near scaffold ends (potentially truncated) | 94.23 % |
% of genes from short scaffolds (< 2000 bps) | 88.46 % |
Associated GOLD sequencing projects | 92 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.36 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (87.500 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil (9.615 % of family members) |
Environment Ontology (ENVO) | Unclassified (28.846 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (38.462 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 33.80% β-sheet: 0.00% Coil/Unstructured: 66.20% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.36 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 104 Family Scaffolds |
---|---|---|
PF00496 | SBP_bac_5 | 19.23 |
PF16363 | GDP_Man_Dehyd | 7.69 |
PF00296 | Bac_luciferase | 2.88 |
PF01370 | Epimerase | 2.88 |
PF12399 | BCA_ABC_TP_C | 1.92 |
PF00005 | ABC_tran | 1.92 |
PF08020 | DUF1706 | 1.92 |
PF02738 | MoCoBD_1 | 1.92 |
PF13538 | UvrD_C_2 | 1.92 |
PF00072 | Response_reg | 0.96 |
PF01882 | DUF58 | 0.96 |
PF16338 | AGL_N | 0.96 |
PF00282 | Pyridoxal_deC | 0.96 |
PF00903 | Glyoxalase | 0.96 |
PF02900 | LigB | 0.96 |
PF07238 | PilZ | 0.96 |
PF12770 | CHAT | 0.96 |
PF09335 | SNARE_assoc | 0.96 |
PF12706 | Lactamase_B_2 | 0.96 |
PF05694 | SBP56 | 0.96 |
PF00355 | Rieske | 0.96 |
PF13361 | UvrD_C | 0.96 |
PF13416 | SBP_bac_8 | 0.96 |
PF13754 | Big_3_4 | 0.96 |
PF01547 | SBP_bac_1 | 0.96 |
PF04963 | Sigma54_CBD | 0.96 |
COG ID | Name | Functional Category | % Frequency in 104 Family Scaffolds |
---|---|---|---|
COG2141 | Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase) | Coenzyme transport and metabolism [H] | 2.88 |
COG4283 | Uncharacterized conserved protein DfsB/IRC4, DUF1706 (PF08020) domain | General function prediction only [R] | 1.92 |
COG0076 | Glutamate or tyrosine decarboxylase or a related PLP-dependent protein | Amino acid transport and metabolism [E] | 0.96 |
COG0398 | Uncharacterized membrane protein YdjX, related to fungal oxalate transporter, TVP38/TMEM64 family | Function unknown [S] | 0.96 |
COG0586 | Membrane integrity protein DedA, putative transporter, DedA/Tvp38 family | Cell wall/membrane/envelope biogenesis [M] | 0.96 |
COG1238 | Uncharacterized membrane protein YqaA, VTT domain | Function unknown [S] | 0.96 |
COG1508 | DNA-directed RNA polymerase specialized sigma subunit, sigma54 homolog | Transcription [K] | 0.96 |
COG1721 | Uncharacterized conserved protein, DUF58 family, contains vWF domain | Function unknown [S] | 0.96 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 88.46 % |
Unclassified | root | N/A | 11.54 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2065487018|GPINP_F5MS3JC02J4MGC | All Organisms → cellular organisms → Bacteria | 547 | Open in IMG/M |
2199352025|deepsgr__Contig_165827 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3000 | Open in IMG/M |
3300001139|JGI10220J13317_10142256 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 574 | Open in IMG/M |
3300004643|Ga0062591_100912005 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 825 | Open in IMG/M |
3300005183|Ga0068993_10037799 | All Organisms → cellular organisms → Bacteria | 1344 | Open in IMG/M |
3300005295|Ga0065707_10642963 | All Organisms → cellular organisms → Bacteria | 667 | Open in IMG/M |
3300005457|Ga0070662_101654165 | All Organisms → cellular organisms → Bacteria | 553 | Open in IMG/M |
3300005458|Ga0070681_11253064 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 664 | Open in IMG/M |
3300005518|Ga0070699_100220872 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1688 | Open in IMG/M |
3300005518|Ga0070699_101918197 | All Organisms → cellular organisms → Bacteria | 542 | Open in IMG/M |
3300005564|Ga0070664_101016012 | All Organisms → cellular organisms → Bacteria | 780 | Open in IMG/M |
3300005713|Ga0066905_100155183 | All Organisms → cellular organisms → Bacteria | 1655 | Open in IMG/M |
3300005713|Ga0066905_100645468 | All Organisms → cellular organisms → Bacteria | 902 | Open in IMG/M |
3300005713|Ga0066905_101717851 | All Organisms → cellular organisms → Bacteria | 577 | Open in IMG/M |
3300005764|Ga0066903_102230068 | All Organisms → cellular organisms → Bacteria | 1057 | Open in IMG/M |
3300005843|Ga0068860_100583705 | All Organisms → cellular organisms → Bacteria | 1122 | Open in IMG/M |
3300005843|Ga0068860_101333409 | All Organisms → cellular organisms → Bacteria | 738 | Open in IMG/M |
3300005888|Ga0075289_1085049 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 526 | Open in IMG/M |
3300006047|Ga0075024_100546549 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 614 | Open in IMG/M |
3300006237|Ga0097621_101165376 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 725 | Open in IMG/M |
3300006796|Ga0066665_11681793 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 502 | Open in IMG/M |
3300006871|Ga0075434_100358842 | All Organisms → cellular organisms → Bacteria | 1478 | Open in IMG/M |
3300006904|Ga0075424_100046968 | All Organisms → cellular organisms → Bacteria | 4504 | Open in IMG/M |
3300006904|Ga0075424_102478203 | All Organisms → cellular organisms → Bacteria | 543 | Open in IMG/M |
3300006914|Ga0075436_100107716 | All Organisms → cellular organisms → Bacteria | 1944 | Open in IMG/M |
3300006931|Ga0097620_101054156 | All Organisms → cellular organisms → Bacteria | 894 | Open in IMG/M |
3300009087|Ga0105107_11134038 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 545 | Open in IMG/M |
3300009147|Ga0114129_12480749 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Acidiphilium → unclassified Acidiphilium → Acidiphilium sp. PM | 620 | Open in IMG/M |
3300009792|Ga0126374_10844990 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Acidiphilium → unclassified Acidiphilium → Acidiphilium sp. PM | 704 | Open in IMG/M |
3300009804|Ga0105063_1048268 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 602 | Open in IMG/M |
3300009837|Ga0105058_1106389 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 661 | Open in IMG/M |
3300010048|Ga0126373_10249508 | All Organisms → cellular organisms → Bacteria | 1746 | Open in IMG/M |
3300010048|Ga0126373_12573202 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 567 | Open in IMG/M |
3300010159|Ga0099796_10083078 | Not Available | 1178 | Open in IMG/M |
3300010325|Ga0134064_10274613 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 633 | Open in IMG/M |
3300010358|Ga0126370_10264164 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1343 | Open in IMG/M |
3300010358|Ga0126370_11270243 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 688 | Open in IMG/M |
3300010359|Ga0126376_11408738 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 722 | Open in IMG/M |
3300010366|Ga0126379_11257916 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 846 | Open in IMG/M |
3300010397|Ga0134124_10538989 | Not Available | 1134 | Open in IMG/M |
3300010400|Ga0134122_10002455 | All Organisms → cellular organisms → Bacteria | 13633 | Open in IMG/M |
3300010400|Ga0134122_10408170 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Rhabditina → Rhabditomorpha → Rhabditoidea → Rhabditidae → Rhabditidae incertae sedis → Diploscapter → Diploscapter pachys | 1202 | Open in IMG/M |
3300011270|Ga0137391_11460700 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 529 | Open in IMG/M |
3300011271|Ga0137393_10316342 | All Organisms → cellular organisms → Bacteria | 1330 | Open in IMG/M |
3300011442|Ga0137437_1344720 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 504 | Open in IMG/M |
3300012189|Ga0137388_11554824 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 598 | Open in IMG/M |
3300012208|Ga0137376_11024886 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 707 | Open in IMG/M |
3300012350|Ga0137372_10938603 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 609 | Open in IMG/M |
3300012362|Ga0137361_10010688 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 6547 | Open in IMG/M |
3300012363|Ga0137390_11782817 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 547 | Open in IMG/M |
3300012906|Ga0157295_10292914 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 565 | Open in IMG/M |
3300012929|Ga0137404_10232269 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1576 | Open in IMG/M |
3300012948|Ga0126375_11070073 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 662 | Open in IMG/M |
3300012958|Ga0164299_10104142 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1481 | Open in IMG/M |
3300012971|Ga0126369_12106946 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 652 | Open in IMG/M |
3300012971|Ga0126369_12201141 | All Organisms → cellular organisms → Bacteria | 638 | Open in IMG/M |
3300013102|Ga0157371_10047989 | All Organisms → cellular organisms → Bacteria | 3035 | Open in IMG/M |
3300014324|Ga0075352_1101677 | All Organisms → cellular organisms → Bacteria | 755 | Open in IMG/M |
3300015259|Ga0180085_1025432 | All Organisms → cellular organisms → Bacteria | 1653 | Open in IMG/M |
3300015374|Ga0132255_102292562 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 824 | Open in IMG/M |
3300018054|Ga0184621_10207506 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 702 | Open in IMG/M |
3300018422|Ga0190265_11036770 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium RIFCSPLOWO2_12_FULL_65_14 | 942 | Open in IMG/M |
3300019458|Ga0187892_10023605 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 5577 | Open in IMG/M |
3300021088|Ga0210404_10789466 | Not Available | 542 | Open in IMG/M |
3300021445|Ga0182009_10034445 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 2049 | Open in IMG/M |
3300025558|Ga0210139_1013752 | All Organisms → cellular organisms → Bacteria | 1517 | Open in IMG/M |
3300025916|Ga0207663_11032919 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 660 | Open in IMG/M |
3300025926|Ga0207659_11029538 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 709 | Open in IMG/M |
3300025932|Ga0207690_10005391 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 7535 | Open in IMG/M |
3300025934|Ga0207686_11061584 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 659 | Open in IMG/M |
3300025981|Ga0207640_11482832 | All Organisms → cellular organisms → Bacteria | 609 | Open in IMG/M |
3300026041|Ga0207639_11353134 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 668 | Open in IMG/M |
3300026075|Ga0207708_11563139 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 580 | Open in IMG/M |
3300026304|Ga0209240_1097634 | Not Available | 1057 | Open in IMG/M |
3300026318|Ga0209471_1049999 | All Organisms → cellular organisms → Bacteria | 1946 | Open in IMG/M |
3300026320|Ga0209131_1178432 | Not Available | 1030 | Open in IMG/M |
3300026328|Ga0209802_1058902 | All Organisms → cellular organisms → Bacteria | 1863 | Open in IMG/M |
3300026333|Ga0209158_1198972 | Not Available | 702 | Open in IMG/M |
3300026371|Ga0257179_1037677 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 607 | Open in IMG/M |
3300027360|Ga0209969_1024377 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 909 | Open in IMG/M |
3300027614|Ga0209970_1030289 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 939 | Open in IMG/M |
3300027654|Ga0209799_1042714 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1011 | Open in IMG/M |
3300027669|Ga0208981_1141541 | Not Available | 612 | Open in IMG/M |
3300027695|Ga0209966_1166052 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 516 | Open in IMG/M |
3300027725|Ga0209178_1020053 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 2083 | Open in IMG/M |
3300027846|Ga0209180_10353287 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 838 | Open in IMG/M |
3300027952|Ga0209889_1011648 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 2133 | Open in IMG/M |
3300028381|Ga0268264_10631929 | Not Available | 1058 | Open in IMG/M |
3300028587|Ga0247828_10252267 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium HGW-Deltaproteobacteria-20 | 949 | Open in IMG/M |
3300028828|Ga0307312_10831395 | Not Available | 612 | Open in IMG/M |
3300031229|Ga0299913_11778842 | All Organisms → cellular organisms → Bacteria | 565 | Open in IMG/M |
(restricted) 3300031248|Ga0255312_1029529 | All Organisms → cellular organisms → Bacteria | 1309 | Open in IMG/M |
3300031720|Ga0307469_10811056 | Not Available | 859 | Open in IMG/M |
3300031740|Ga0307468_100585392 | All Organisms → cellular organisms → Bacteria | 907 | Open in IMG/M |
3300031740|Ga0307468_101387749 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 645 | Open in IMG/M |
3300031798|Ga0318523_10059590 | All Organisms → cellular organisms → Bacteria | 1814 | Open in IMG/M |
3300031820|Ga0307473_10033058 | All Organisms → cellular organisms → Bacteria | 2277 | Open in IMG/M |
3300031820|Ga0307473_10899773 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 639 | Open in IMG/M |
3300032044|Ga0318558_10124910 | All Organisms → cellular organisms → Bacteria | 1223 | Open in IMG/M |
3300032397|Ga0315287_12623675 | All Organisms → cellular organisms → Bacteria | 538 | Open in IMG/M |
3300032782|Ga0335082_11341899 | All Organisms → cellular organisms → Bacteria | 584 | Open in IMG/M |
3300033432|Ga0326729_1061277 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 576 | Open in IMG/M |
3300034354|Ga0364943_0168495 | Not Available | 796 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 9.62% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 9.62% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 5.77% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 4.81% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 4.81% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 4.81% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.85% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 3.85% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.85% |
Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 3.85% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 3.85% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 2.88% |
Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 2.88% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 2.88% |
Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 1.92% |
Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 1.92% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.92% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.92% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.92% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 0.96% |
Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 0.96% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.96% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.96% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.96% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.96% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.96% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.96% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.96% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil | 0.96% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.96% |
Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 0.96% |
Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 0.96% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.96% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.96% |
Sandy Soil | Environmental → Terrestrial → Soil → Sand → Unclassified → Sandy Soil | 0.96% |
Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.96% |
Bio-Ooze | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Bio-Ooze | 0.96% |
Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 0.96% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.96% |
Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.96% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.96% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.96% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.96% |
Visualization |
---|
Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2065487018 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
2199352025 | Soil microbial communities from Rothamsted, UK, for project Deep Soil - DEEP SOIL | Environmental | Open in IMG/M |
3300001139 | Soil microbial communities from Great Prairies - Wisconsin, Switchgrass soil | Environmental | Open in IMG/M |
3300004643 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3 | Environmental | Open in IMG/M |
3300005183 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqC_D1 | Environmental | Open in IMG/M |
3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 | Environmental | Open in IMG/M |
3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Host-Associated | Open in IMG/M |
3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Environmental | Open in IMG/M |
3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Host-Associated | Open in IMG/M |
3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
3300005888 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_80N_103 | Environmental | Open in IMG/M |
3300006047 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 | Environmental | Open in IMG/M |
3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) | Host-Associated | Open in IMG/M |
3300009087 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 19-21cm September2015 | Environmental | Open in IMG/M |
3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
3300009804 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_30_40 | Environmental | Open in IMG/M |
3300009837 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_20_30 | Environmental | Open in IMG/M |
3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Environmental | Open in IMG/M |
3300010325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_0_1 metaG | Environmental | Open in IMG/M |
3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
3300011442 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT138_2 | Environmental | Open in IMG/M |
3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
3300012350 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG | Environmental | Open in IMG/M |
3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
3300012906 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S212-509R-1 | Environmental | Open in IMG/M |
3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Host-Associated | Open in IMG/M |
3300014324 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_TuleA_D1 | Environmental | Open in IMG/M |
3300015259 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT730_16_10D | Environmental | Open in IMG/M |
3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
3300018054 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_b1 | Environmental | Open in IMG/M |
3300018422 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 T | Environmental | Open in IMG/M |
3300019458 | Bio-ooze microbial communities from a basaltic lava cave in the Kipuka Kanohina Cave System on the Island of Hawaii, USA - MA170107-3 metaG | Environmental | Open in IMG/M |
3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
3300021445 | Bulk soil microbial communities from the field in Mead, Nebraska, USA - 072115-187_1 MetaG | Environmental | Open in IMG/M |
3300025558 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleB_D2 (SPAdes) | Environmental | Open in IMG/M |
3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300026304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_80cm (SPAdes) | Environmental | Open in IMG/M |
3300026318 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 (SPAdes) | Environmental | Open in IMG/M |
3300026320 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_40cm (SPAdes) | Environmental | Open in IMG/M |
3300026328 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 (SPAdes) | Environmental | Open in IMG/M |
3300026333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 (SPAdes) | Environmental | Open in IMG/M |
3300026371 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-01-B | Environmental | Open in IMG/M |
3300027360 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) | Host-Associated | Open in IMG/M |
3300027384 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_30_40 (SPAdes) | Environmental | Open in IMG/M |
3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) | Host-Associated | Open in IMG/M |
3300027654 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 MoBio (SPAdes) | Environmental | Open in IMG/M |
3300027669 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM1_M1 (SPAdes) | Environmental | Open in IMG/M |
3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) | Host-Associated | Open in IMG/M |
3300027725 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 (SPAdes) | Environmental | Open in IMG/M |
3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027952 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_0_10 (SPAdes) | Environmental | Open in IMG/M |
3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300028587 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day3 | Environmental | Open in IMG/M |
3300028828 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202 | Environmental | Open in IMG/M |
3300031229 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT155D38 | Environmental | Open in IMG/M |
3300031248 (restricted) | Sandy soil microbial communities from University of British Columbia, Vancouver, Canada - EtOH5_T0_E5 | Environmental | Open in IMG/M |
3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
3300031798 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f19 | Environmental | Open in IMG/M |
3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
3300032044 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f20 | Environmental | Open in IMG/M |
3300032397 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_0 | Environmental | Open in IMG/M |
3300032782 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1 | Environmental | Open in IMG/M |
3300033432 | Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF6AY SIP fraction | Environmental | Open in IMG/M |
3300034354 | Sediment microbial communities from East River floodplain, Colorado, United States - 23_s17 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Protein ID | Sample Taxon ID | Habitat | Sequence |
GPINP_01944830 | 2065487018 | Soil | MADIVLGIGSSHSPMLSTPWEAFAGHADRDRGRVPEFE |
deepsgr_02773760 | 2199352025 | Soil | MAEVTLGIGTSHSPMLSTPHEALAALADLDRARLPDFAAKARASEAWIAGSLTLR |
JGI10220J13317_101422561 | 3300001139 | Soil | MAQITLGIGSSHSPMLSTPYEAFAGLGDLDRARLR |
Ga0062591_1009120052 | 3300004643 | Soil | LADIVLGIGTSHSPMLSTPHEAFAGHRERDQQRVPEFAALARER |
Ga0068993_100377991 | 3300005183 | Natural And Restored Wetlands | MAEVTLGIGSSHSPMLSTPHEAFAGLTELDRARLPDFDVKAREN |
Ga0065707_106429631 | 3300005295 | Switchgrass Rhizosphere | MAEIVLGIGTSHSPMLSTPHEAFAGHRERDQQRVPEFAALAKERAARVAPE |
Ga0070662_1016541652 | 3300005457 | Corn Rhizosphere | MADIVLGIGSSHSPMLSTPWEAFAGHADRDRARVPEFEALAGAK |
Ga0070681_112530641 | 3300005458 | Corn Rhizosphere | MAQLTLGIGSSHSPMLSTPHEAFDGLGDLDRTRLPEFAAKARESAAWIG |
Ga0070699_1002208721 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | MAEVAFGIGSSHSPMLSTPYEAFSGLADLDRARLPEFEEKARRNVSWTA |
Ga0070699_1019181972 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | MAEVTLGIGTSHSPMLSTPHEALAALADLDRARLPDFAAKARASAGWID |
Ga0070664_1010160122 | 3300005564 | Corn Rhizosphere | VAQVALGIGTSHSPMLSTPYESFAALGELDRTRLP* |
Ga0066905_1001551833 | 3300005713 | Tropical Forest Soil | MADIVLGIGTSHSPMLSTPHEAFAGHRERDQQRVPEFAALVRERAERVAPELAPAV |
Ga0066905_1006454681 | 3300005713 | Tropical Forest Soil | MAEVTLGIGTSHSPMLSTPYEAFAGLGDFDRARLPDFAAKAHENAART |
Ga0066905_1017178512 | 3300005713 | Tropical Forest Soil | MAQITLGIGSSHSPMLSTPYEAFAGLGDLDRARLPEFPAKARESAGWID |
Ga0066903_1022300681 | 3300005764 | Tropical Forest Soil | MAEVTLGIGTSHSPMLSTPHEALAGLADLDRARLPEF |
Ga0068860_1005837052 | 3300005843 | Switchgrass Rhizosphere | MAEVTLGIGTSHSPMLSTPHEALAALADLDRARLPDFAAKARASEAWI |
Ga0068860_1013334091 | 3300005843 | Switchgrass Rhizosphere | MADIVLGIGSSHSPMLSTPWEAFAGHADRDRGRVPEFEALARDKA |
Ga0075289_10850492 | 3300005888 | Rice Paddy Soil | MAQVTLGIGSSHSPMLSTPYEAFAGLGELDRGRLPEFAAKAR |
Ga0075024_1005465491 | 3300006047 | Watersheds | MAQVTLGIGSSHSPMLSTPHEAFAGLGDLDRARLPEFAARARE |
Ga0097621_1011653762 | 3300006237 | Miscanthus Rhizosphere | MAQVALGIGTSHSPMLSTPYESFAALGELDRTRLP |
Ga0066665_116817931 | 3300006796 | Soil | MAEVTLGIGTSHSPMLSTPHEALAALADLDRARLPDFAAKARASEAW |
Ga0075434_1003588421 | 3300006871 | Populus Rhizosphere | MAEVTLGIGTSHSPMLSTPHEALTGLAELDRARLPEFAARARESA |
Ga0075424_1000469684 | 3300006904 | Populus Rhizosphere | MAEVTLGIGTSHSPMLSTPHEALTGLAELDRARLPEFAARARESAG |
Ga0075424_1024782032 | 3300006904 | Populus Rhizosphere | MAQITLGIGSSHSPMLSTPHEALGALADLDRARLP |
Ga0075436_1001077161 | 3300006914 | Populus Rhizosphere | MAEVTLGIGTSHSPMLSTPHEALAGLAELDRARLPEFAARARESA |
Ga0097620_1010541561 | 3300006931 | Switchgrass Rhizosphere | MADIVLGIGTSHSPMLSTPHEAFAGHRERDQQRVPQFAALARDNAAR |
Ga0105107_111340381 | 3300009087 | Freshwater Sediment | MAEVTLGIGSSHSPMLSTPHEAFTGLADLDRARLPEFAEKARENAKWIGR |
Ga0114129_124807491 | 3300009147 | Populus Rhizosphere | MAEIVLGIGTSHSPMLSTPHEAFAGHRERDQQRVPEFAALAKERAARVAPEL |
Ga0126374_108449902 | 3300009792 | Tropical Forest Soil | MADIVLGIGTSHSPMLSTPHEAFAGHRERDQQRVPEFAALARERAARVAPELAPA |
Ga0105063_10482682 | 3300009804 | Groundwater Sand | MAEVAFGIGSSHSPMLSTPYEAFSGLADLDRARLPEFEEKA |
Ga0105058_11063891 | 3300009837 | Groundwater Sand | MGEVTLGIGTSHSPMLSTPPEALAGLGDLDRGRLAEFARKARENASW |
Ga0126373_102495082 | 3300010048 | Tropical Forest Soil | MAEVTLGIGTSHSPMLSTPHEALSGLADLDRARLPEFAARAGES |
Ga0126373_125732021 | 3300010048 | Tropical Forest Soil | MAEITLGIGTSHSPMLSTPPEALTGLGDLDRERLPE |
Ga0099796_100830782 | 3300010159 | Vadose Zone Soil | MAQITLGIGSSHSPMLSTPYEAFAGLGNLDRARLPDFAARARE |
Ga0134064_102746131 | 3300010325 | Grasslands Soil | MAEITLGIGTSHSPMLSTPPEALAGLGDLDRGRLAEFAGKARENAAWI |
Ga0126370_102641641 | 3300010358 | Tropical Forest Soil | MAEVTLGIGTSHSPMLSTPHEALAGLADLDRTRLPEFAA |
Ga0126370_112702432 | 3300010358 | Tropical Forest Soil | MAEVTLGIGTSHSPMLSTPHEAFAQLADLDRARLP |
Ga0126376_114087381 | 3300010359 | Tropical Forest Soil | MAEVTLGIGTSHSPMLSTPHEALAVLADLDRARLPE |
Ga0126379_112579162 | 3300010366 | Tropical Forest Soil | MAEVTLGIGTSHSPMLSTPHEALAGLADLDRARLPEFAARARESAGWIE |
Ga0134124_105389892 | 3300010397 | Terrestrial Soil | MADIVLGIGSSHSPMLSTPWEAFAGHADRDRGRVPEFEAL |
Ga0134122_100024551 | 3300010400 | Terrestrial Soil | MAQVALGIGTSHSPMLSTPYESFAALGELDRTRLPEFAVMAGRNRSR |
Ga0134122_104081701 | 3300010400 | Terrestrial Soil | MADIVLGIGSSHSPMLSTPWEAFAGHADRDRARVPDFEALARDKAAWIGREL |
Ga0137391_114607001 | 3300011270 | Vadose Zone Soil | MAEVTLGIGSSHSPMLSAPHEALAQLGELDRGRLPEFAAKTRE |
Ga0137393_103163422 | 3300011271 | Vadose Zone Soil | MAEITLGIGTSHSPMLSTPHEALAGLGDLDRGRLAEFAGK |
Ga0137437_13447202 | 3300011442 | Soil | MAEVTLGIGTSHSPMLSTPHEAFAGLAELDRARLPEFDVKARES |
Ga0137388_115548242 | 3300012189 | Vadose Zone Soil | MAEVTLGIGTSHSPMLSTPHEAFDRLGELDRVLLP* |
Ga0137376_110248861 | 3300012208 | Vadose Zone Soil | MAEVTLGIGTSHSPMLSTPHEAFDRLGELDRGRLPEFAAKARENA |
Ga0137372_109386031 | 3300012350 | Vadose Zone Soil | MAEITLGIGTSHSPMLSTPPEALAGLGDLDRGRLAEFAGKARENAAW |
Ga0137361_100106881 | 3300012362 | Vadose Zone Soil | MAEVTLGIGTSHSPMLSTPHEAFDRLGELDRGRLPEFAAKA |
Ga0137390_117828172 | 3300012363 | Vadose Zone Soil | MAEITLGIGTSHSPMLSTPHEAFDRLGELDRGRLPEFAAKARE |
Ga0157295_102929141 | 3300012906 | Soil | MAQITLGIGSSHSPMLSTPYEAFAGLGDLDRARLREFAAKA |
Ga0137404_102322692 | 3300012929 | Vadose Zone Soil | MAEVTLGIGTSHSPMLSTPHEAFDRLGELDRGRLPEFSAKARENAS* |
Ga0126375_110700732 | 3300012948 | Tropical Forest Soil | MAEVTLGIGTSHSPMLSTPYEAFAGLGDLDRARLPDFAAKVHENGARTGRE |
Ga0164299_101041423 | 3300012958 | Soil | MAQVALGIGTSHSPMLSTPYESFAALGELDRTRLPE |
Ga0126369_121069462 | 3300012971 | Tropical Forest Soil | MAEVTLGIGTSHSPMLSTPYEALAGLADLDRARLP |
Ga0126369_122011411 | 3300012971 | Tropical Forest Soil | MAEIVLAIGSSHSPMLSTPHEGFAGHADRDRSRVPNFDALARDKAGWIGRELAP |
Ga0157371_100479891 | 3300013102 | Corn Rhizosphere | LADIVLGIGTSHSPMLSTPHEAFAGHRERDQQRVPEFAALARERAA |
Ga0075352_11016772 | 3300014324 | Natural And Restored Wetlands | MAEVTLGIGSSHSPMLSTPHEAFAGLTELDRARLPEF |
Ga0180085_10254321 | 3300015259 | Soil | MAEVTLGLGSSHSPMLSTPHEAFAGLGDLDRARLPEFAARAHESAAWI |
Ga0132255_1022925622 | 3300015374 | Arabidopsis Rhizosphere | MAQVALGIGTSHSPMLSTPYESFAALGELDRTRLPEFAV |
Ga0184621_102075062 | 3300018054 | Groundwater Sediment | MAEVTLGIGSSHSPMLSTPHEAFAGLADMDRARLSEFAAKAR |
Ga0190265_110367703 | 3300018422 | Soil | MAEVTLGIGSSHSPMLSTPYEAFAGLAELDRGRLP |
Ga0187892_100236057 | 3300019458 | Bio-Ooze | MAEVALGIGTSHSPMLSTPYEAFAGLAELDRARLPEFDEKARVHASRI |
Ga0210404_107894662 | 3300021088 | Soil | MAEIILGIGSSHSPMLSTPHEAFAGHAERDRARVGDFDALARGKA |
Ga0182009_100344452 | 3300021445 | Soil | VAQVALGIGTSHSPMLSTPYESFAALGELDRTRLP |
Ga0210139_10137522 | 3300025558 | Natural And Restored Wetlands | MAEVTLGIGTSHSPMLSTPHEAFAGLADLDRARLPDFDAKARENAPWI |
Ga0207663_110329192 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | MAEVTLGIGTSHSPMLSTPHEALAALADLDRARLPDF |
Ga0207659_110295382 | 3300025926 | Miscanthus Rhizosphere | MAQVALGIGTSHSPMLSTPYESFAALGELDRTRLPEFAVMA |
Ga0207690_100053919 | 3300025932 | Corn Rhizosphere | MAQVALGIGTSHSPMLSTPYESFAALGELDRTRLPEFAVMAGRNRSRV |
Ga0207686_110615842 | 3300025934 | Miscanthus Rhizosphere | MAEVTLGIGTSHSPMLSTPHEALAALADLDRARLPDFAAK |
Ga0207640_114828321 | 3300025981 | Corn Rhizosphere | MADIVLGIGSSHSPMLSTPWEAFAGHADRDRARVPEFEALAGAKAAWIGRELGP |
Ga0207639_113531341 | 3300026041 | Corn Rhizosphere | MAEVTLGIGTSHSPMLSTPHEALAALADLDRARLPDFAAKA |
Ga0207708_115631391 | 3300026075 | Corn, Switchgrass And Miscanthus Rhizosphere | MAQITLGIGSSHSPMLSTPYKAFAGLGDLDRARLREFA |
Ga0209240_10976341 | 3300026304 | Grasslands Soil | MAQVTLGIGSSHSPMLSTPYEAFAGLGDLDRARLPEFAAKARASA |
Ga0209471_10499993 | 3300026318 | Soil | MAEITLGIGTSHSPMLSTPPEALAGLGDLDRGRLAEF |
Ga0209131_11784321 | 3300026320 | Grasslands Soil | MAQITLGIGSSHSPMLSTPYEAFAGLGNLDRARLPDFAARARESATWIG |
Ga0209802_10589022 | 3300026328 | Soil | MAEITLGIGTSHSPMLSTPPEALAGLGDLDRGRLAEFA |
Ga0209158_11989722 | 3300026333 | Soil | MAQVTLGIGSSHSPMLSTPYEAFAGLGDLDRARLPEFAAKARAS |
Ga0257179_10376771 | 3300026371 | Soil | MAEVALGIGTSHSPMLSTPYEAFAGLAELDRARLPEFDEKVRE |
Ga0209969_10243772 | 3300027360 | Arabidopsis Thaliana Rhizosphere | MAQITLGIGSSHSPMLSTPYEAFAGLGDLDRARLREFAAKAREC |
Ga0209854_10983172 | 3300027384 | Groundwater Sand | MAEVALGIGSSHSPMLSTPYEVFSGLADLDRVRLPEFEEKARQNVSWTARELRQD |
Ga0209970_10302891 | 3300027614 | Arabidopsis Thaliana Rhizosphere | MAQITLGIGSSHSPMLSTPYEAFAGLGDLDRARLREFAAK |
Ga0209799_10427141 | 3300027654 | Tropical Forest Soil | MAEVTLGIGTSHSPMLSTPHEALAGLADLDRARLPEFAAKSREN |
Ga0208981_11415411 | 3300027669 | Forest Soil | MAQITLGIGSSHSPMLSTPHEAFAGLGDLDRARLPEFAAKARECAAW |
Ga0209966_11660522 | 3300027695 | Arabidopsis Thaliana Rhizosphere | LADIVLGIGTSHSPMLSTPHEAFAGHRERDQQRVPEFAALARE |
Ga0209178_10200531 | 3300027725 | Agricultural Soil | MAQVALGIGTSHSPMLSTPYESFAALGELDRTRLPEFAVMAGRNRSRVA |
Ga0209180_103532873 | 3300027846 | Vadose Zone Soil | MAEVTLGIGTSHSPMLSTPHEAFAQLADLDRARLPDYAAK |
Ga0209889_10116484 | 3300027952 | Groundwater Sand | MAEVAFGIGSSHSPMLSTPYEAFSGLADLDRARLPEFEEKARQN |
Ga0268264_106319292 | 3300028381 | Switchgrass Rhizosphere | MADIVLGIGSSHSPMLSTPWEAFAGHADRDRGRVPEFEALARDKAAWIDRELDPH |
Ga0247828_102522672 | 3300028587 | Soil | MADIVLGIGSSHSPMLSTPWEAFAGHADRDRARVPEFEALAGAKASH |
Ga0307312_108313952 | 3300028828 | Soil | MAQITLGIGSSHSPMLSTPHEAFAGLGDLDRARLPE |
Ga0299913_117788421 | 3300031229 | Soil | MAQISLGVGSSHSPMLSTPHEAFGGHADRDRARVPAFARLARDKAGWIDREL |
(restricted) Ga0255312_10295291 | 3300031248 | Sandy Soil | MAEVTLGIGSSHSPMLSTPHEAFAGLGDLDRARLPEFA |
Ga0307469_108110562 | 3300031720 | Hardwood Forest Soil | MAEIILGIGSSHSPMLSTPHEAFAGHAERDRARVGDF |
Ga0307468_1005853923 | 3300031740 | Hardwood Forest Soil | MAEVTLGIGSSHSPMLSTPYEAFAGLGDLDRARLPEFAARARESAAW |
Ga0307468_1013877491 | 3300031740 | Hardwood Forest Soil | MAEIVLGIGTSHSPMLSTPHEDFAGHADRDRARVPQFEALAREN |
Ga0318523_100595901 | 3300031798 | Soil | MAEVTLGIGTSHSPMLSTPHEALAGLADLDRARLPE |
Ga0307473_100330582 | 3300031820 | Hardwood Forest Soil | MAEVTLGIGTSHSPMLSTPHEALAALADLDRARLPDFAAKARASEAWID |
Ga0307473_108997732 | 3300031820 | Hardwood Forest Soil | MAEIILGIGSSHSPMLSTPHEAFAGHAERDRARVGDFDALARGKAAWIGREL |
Ga0318558_101249101 | 3300032044 | Soil | MAEVTLGIGTSHSPMLSTPHEALAGLADLDRARLPEFAARARESAGW |
Ga0315287_126236751 | 3300032397 | Sediment | MANIVLGIGSSHSPMLSTPWEAFAGHADRDRARVPDF |
Ga0335082_113418991 | 3300032782 | Soil | MAQVTLGMGSSHSPMLSTPYEAFAGLADLDRARLPDFAVKARESAGWIGR |
Ga0326729_10612771 | 3300033432 | Peat Soil | MAEVTLGIGSSHSPMLSTPYEAFAELADLDRARLPDFAVKARENAAW |
Ga0364943_0168495_687_794 | 3300034354 | Sediment | MADIVLGIGSSHSPMLSTPWDAFAGHADRDRGRVPE |
⦗Top⦘ |