Basic Information | |
---|---|
Family ID | F097538 |
Family Type | Metagenome |
Number of Sequences | 104 |
Average Sequence Length | 43 residues |
Representative Sequence | EQGLTVATNALRLEYELTRSLTLRAEAGTISGVGIYFRRSFD |
Number of Associated Samples | 92 |
Number of Associated Scaffolds | 104 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | No |
Most common taxonomic group | Unclassified |
% of genes with valid RBS motifs | 0.00 % |
% of genes near scaffold ends (potentially truncated) | 0.00 % |
% of genes from short scaffolds (< 2000 bps) | 0.00 % |
Associated GOLD sequencing projects | 87 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.60 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Unclassified (100.000 % of family members) |
NCBI Taxonomy ID | N/A |
Taxonomy | N/A |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen (12.500 % of family members) |
Environment Ontology (ENVO) | Unclassified (38.462 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (48.077 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 57.14% β-sheet: 0.00% Coil/Unstructured: 42.86% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.60 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 104 Family Scaffolds |
---|---|---|
PF01206 | TusA | 15.38 |
PF00326 | Peptidase_S9 | 15.38 |
PF04357 | TamB | 10.58 |
PF02698 | DUF218 | 9.62 |
PF02780 | Transketolase_C | 5.77 |
PF03466 | LysR_substrate | 4.81 |
PF13442 | Cytochrome_CBB3 | 3.85 |
PF13686 | DrsE_2 | 2.88 |
PF00590 | TP_methylase | 2.88 |
PF13365 | Trypsin_2 | 2.88 |
PF13418 | Kelch_4 | 1.92 |
PF02737 | 3HCDH_N | 1.92 |
PF01464 | SLT | 1.92 |
PF14023 | DUF4239 | 0.96 |
PF03006 | HlyIII | 0.96 |
PF13628 | DUF4142 | 0.96 |
PF00294 | PfkB | 0.96 |
PF02627 | CMD | 0.96 |
PF07452 | CHRD | 0.96 |
PF01436 | NHL | 0.96 |
PF00108 | Thiolase_N | 0.96 |
PF01694 | Rhomboid | 0.96 |
PF01565 | FAD_binding_4 | 0.96 |
COG ID | Name | Functional Category | % Frequency in 104 Family Scaffolds |
---|---|---|---|
COG0425 | Sulfur carrier protein TusA (tRNA thiolation, molybdenum cofactor biosynthesis) | Translation, ribosomal structure and biogenesis [J] | 15.38 |
COG2911 | Phospholipid transport to the outer membrane protein TamB | Cell wall/membrane/envelope biogenesis [M] | 10.58 |
COG1434 | Lipid carrier protein ElyC involved in cell wall biogenesis, DUF218 family | Cell wall/membrane/envelope biogenesis [M] | 9.62 |
COG2949 | Uncharacterized periplasmic protein SanA, affects membrane permeability for vancomycin | Cell wall/membrane/envelope biogenesis [M] | 9.62 |
COG0240 | Glycerol-3-phosphate dehydrogenase | Energy production and conversion [C] | 1.92 |
COG0287 | Prephenate dehydrogenase | Amino acid transport and metabolism [E] | 1.92 |
COG0677 | UDP-N-acetyl-D-mannosaminuronate dehydrogenase | Cell wall/membrane/envelope biogenesis [M] | 1.92 |
COG1004 | UDP-glucose 6-dehydrogenase | Cell wall/membrane/envelope biogenesis [M] | 1.92 |
COG1250 | 3-hydroxyacyl-CoA dehydrogenase | Lipid transport and metabolism [I] | 1.92 |
COG1748 | Saccharopine dehydrogenase, NADP-dependent | Amino acid transport and metabolism [E] | 1.92 |
COG2084 | 3-hydroxyisobutyrate dehydrogenase or related beta-hydroxyacid dehydrogenase | Lipid transport and metabolism [I] | 1.92 |
COG0183 | Acetyl-CoA acetyltransferase | Lipid transport and metabolism [I] | 0.96 |
COG0599 | Uncharacterized conserved protein YurZ, alkylhydroperoxidase/carboxymuconolactone decarboxylase family | General function prediction only [R] | 0.96 |
COG0705 | Membrane-associated serine protease, rhomboid family | Posttranslational modification, protein turnover, chaperones [O] | 0.96 |
COG1272 | Predicted membrane channel-forming protein YqfA, hemolysin III family | Intracellular trafficking, secretion, and vesicular transport [U] | 0.96 |
COG2128 | Alkylhydroperoxidase family enzyme, contains CxxC motif | Inorganic ion transport and metabolism [P] | 0.96 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
Unclassified | root | N/A | 100.00 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 12.50% |
Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 8.65% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 5.77% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 5.77% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 4.81% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 3.85% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 3.85% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 3.85% |
Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 2.88% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 2.88% |
Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 1.92% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.92% |
Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 1.92% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.92% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.92% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 1.92% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.92% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.92% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 1.92% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 1.92% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 0.96% |
Wetland | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland | 0.96% |
Wetland Sediment | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment | 0.96% |
Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 0.96% |
Polar Desert Sand | Environmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand | 0.96% |
Wetland | Environmental → Aquatic → Marine → Wetlands → Sediment → Wetland | 0.96% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.96% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.96% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.96% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 0.96% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.96% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.96% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.96% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.96% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.96% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.96% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.96% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.96% |
Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 0.96% |
Fen | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Fen | 0.96% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 0.96% |
Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 0.96% |
Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.96% |
Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.96% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.96% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.96% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.96% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300001213 | Combined assembly of wetland microbial communities from Twitchell Island in the Sacramento Delta (Jan 2013 JGI Velvet Assembly) | Environmental | Open in IMG/M |
3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Host-Associated | Open in IMG/M |
3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Host-Associated | Open in IMG/M |
3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Environmental | Open in IMG/M |
3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Environmental | Open in IMG/M |
3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Host-Associated | Open in IMG/M |
3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Host-Associated | Open in IMG/M |
3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Host-Associated | Open in IMG/M |
3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Host-Associated | Open in IMG/M |
3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
3300006050 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014 | Environmental | Open in IMG/M |
3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
3300006791 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 | Environmental | Open in IMG/M |
3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
3300009166 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 10-12cm May2015 | Environmental | Open in IMG/M |
3300009179 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Plant_0915_D1 | Environmental | Open in IMG/M |
3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
3300012045 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ449 (21.06) | Environmental | Open in IMG/M |
3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
3300014316 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushMan_CattailNLC_D1 | Environmental | Open in IMG/M |
3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Host-Associated | Open in IMG/M |
3300014498 | Permafrost microbial communities from Stordalen Mire, Sweden - 812E2M metaG | Environmental | Open in IMG/M |
3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
3300018027 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_coex | Environmental | Open in IMG/M |
3300020006 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1m2 | Environmental | Open in IMG/M |
3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Host-Associated | Open in IMG/M |
3300025862 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostL2-A (SPAdes) | Environmental | Open in IMG/M |
3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) | Host-Associated | Open in IMG/M |
3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) | Environmental | Open in IMG/M |
3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) | Environmental | Open in IMG/M |
3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300027831 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T0Bare3Fresh (SPAdes) | Environmental | Open in IMG/M |
3300028652 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_E3_3 | Environmental | Open in IMG/M |
3300028740 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Fen_N2_3 | Environmental | Open in IMG/M |
3300028869 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Fen_N1_4 | Environmental | Open in IMG/M |
3300029987 | I_Fen_E3 coassembly | Environmental | Open in IMG/M |
3300030003 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_N2_3 | Environmental | Open in IMG/M |
3300030294 | II_Fen_E3 coassembly | Environmental | Open in IMG/M |
3300030339 | III_Bog_N1 coassembly | Environmental | Open in IMG/M |
3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031521 | III_Fen_E2 coassembly | Environmental | Open in IMG/M |
3300031726 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_1 | Environmental | Open in IMG/M |
3300031784 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA112 | Environmental | Open in IMG/M |
3300031873 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G15_0 | Environmental | Open in IMG/M |
3300031908 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D1 | Environmental | Open in IMG/M |
3300031918 | III_Fen_N3 coassembly | Environmental | Open in IMG/M |
3300031940 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D2 | Environmental | Open in IMG/M |
3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Host-Associated | Open in IMG/M |
3300031996 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2 | Environmental | Open in IMG/M |
3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Host-Associated | Open in IMG/M |
3300032067 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f22 | Environmental | Open in IMG/M |
3300032118 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G05_15 | Environmental | Open in IMG/M |
3300032163 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G07_0 | Environmental | Open in IMG/M |
3300032164 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_0 | Environmental | Open in IMG/M |
3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
3300032275 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C1_bottom | Environmental | Open in IMG/M |
3300032342 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G10_0 | Environmental | Open in IMG/M |
3300032397 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_0 | Environmental | Open in IMG/M |
3300032516 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_0 | Environmental | Open in IMG/M |
3300033414 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D4_B | Environmental | Open in IMG/M |
3300033550 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day4 | Environmental | Open in IMG/M |
3300034148 | Sediment microbial communities from East River floodplain, Colorado, United States - 18_j17 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
JGIcombinedJ13530_1067514042 | 3300001213 | Wetland | ATNALRLEYHLSRTLTLRAEAGTVSGVGIFYRRSFE* |
JGI24744J21845_100971871 | 3300002077 | Corn, Switchgrass And Miscanthus Rhizosphere | TNALRIEYALSNTLTLRAEAGTISGLGIFYRRSFE* |
Ga0063356_1054960171 | 3300004463 | Arabidopsis Thaliana Rhizosphere | RLTLVYEQGLTVATNALRIEYALSRTLTLRAEAGVVSSVGLFFRRSFD* |
Ga0062595_1018801182 | 3300004479 | Soil | KLSLVYEQGLTVASNALRIEYALTRTITLRAEAGTISSLGLYYRRSYD* |
Ga0070658_101789744 | 3300005327 | Corn Rhizosphere | TLGYEQGLWLASGALRLEYALTRTLTLRAEAGTVSALGLFYRRSFE* |
Ga0070689_1003486981 | 3300005340 | Switchgrass Rhizosphere | GLTVATNALRLEYALSRTLTLRAEAGTTSSLGVYFRRSYD* |
Ga0070687_1013319131 | 3300005343 | Switchgrass Rhizosphere | GLTLATQALRLEYELTRSLTVRAEAGTYGAIGLYFRRTFD* |
Ga0070673_1010392123 | 3300005364 | Switchgrass Rhizosphere | RLTLVYEQGLTLATQALRLEYELTRSLTIRAEAGTYGALGIYFRRTFD* |
Ga0070672_1000311119 | 3300005543 | Miscanthus Rhizosphere | RLSLVYEQGLTIATNALRLEYELTRSITLRAEAGTVGAVGLYFRRTFD* |
Ga0070672_1000491463 | 3300005543 | Miscanthus Rhizosphere | ISDRLNLVYEQGLTAATNALRVEYALTRTLTLRAEAGVVSSLGMYFRRTFD* |
Ga0068856_1011468332 | 3300005614 | Corn Rhizosphere | GYEQGLSVAANAVRLEYALTNTLTLRAEAGTVSGIGVYYRRTYN* |
Ga0068859_1000375881 | 3300005617 | Switchgrass Rhizosphere | TIATNALRLEYELTRSITLRAEAGTVGAVGLYFRRTFD* |
Ga0068864_1012698801 | 3300005618 | Switchgrass Rhizosphere | TLVYEQGLTLATQALRLEYELTRSLTVRAEAGTYGAIGLYFRRTFD* |
Ga0068851_107832961 | 3300005834 | Corn Rhizosphere | DRLNLVYEQGLTAASNALRIEYTLTRTLTLRAEAGVVSSLGLYFRRTFD* |
Ga0068863_1013398222 | 3300005841 | Switchgrass Rhizosphere | SLATNALRIEYALSRTLTLRAEAGAIASFGLYYRRSYD* |
Ga0068863_1027239462 | 3300005841 | Switchgrass Rhizosphere | ATNALRIEYALSSTLTVRAEAGTVSGVGLVYRRAFD* |
Ga0066652_1008039741 | 3300006046 | Soil | LSEHLTVAWEQGLTVATNALRIEYSLTQSLSVRAEAGTVSGLGLFYRKSF* |
Ga0075028_1004421381 | 3300006050 | Watersheds | LTVATNALRIEYALSSTLSVRAEAGTVSGLGLVYRRNFE* |
Ga0097621_1017553432 | 3300006237 | Miscanthus Rhizosphere | LGYEQGLSIAANALRLEYTLTNTLTVRAEAGAISGVGIYYRRSYD* |
Ga0066653_106414131 | 3300006791 | Soil | QGLSIASNALRLEYALTKTLTLRAEAGTVSGVGVYYRRTYN* |
Ga0075425_1013872241 | 3300006854 | Populus Rhizosphere | LMLVYEQGLTVAKNALRLEYALTRTVTLRAEAGVISSFGIYYRKVFD* |
Ga0066710_1034301871 | 3300009012 | Grasslands Soil | LSEHLTVAWEQGLTVATNALRIEYSLTQSLSVRAEAGTVSGLGLFYRKSF |
Ga0105243_101170187 | 3300009148 | Miscanthus Rhizosphere | LTDRLSLVYEQGLTIATNALRLEYELTRSITLRAEAGTVGAVGLYFRRTFD* |
Ga0075423_112463981 | 3300009162 | Populus Rhizosphere | GLSIAANALRLEYALTNTLTVRAEAGAVSGIGLYYRRTYN* |
Ga0105100_102349352 | 3300009166 | Freshwater Sediment | LPEKLYLFAEQGRTVATNGLKLESALTRNSTLRAEAGVVSGFGIYYRRSFE* |
Ga0115028_120219982 | 3300009179 | Wetland | NALRLEYSLTRTLTLRAEAGVISGFGIYYRRTFE* |
Ga0105237_110915862 | 3300009545 | Corn Rhizosphere | SLVYEQGLTVATNALRLEYALSRTLTLRAEAGTTSSLGVYFRRSYD* |
Ga0105249_114977703 | 3300009553 | Switchgrass Rhizosphere | INDKLTLVYEQGLTVAKNALRLEYSLTRTLTLRAEAGVVSSFGIYYRRVFD* |
Ga0134124_122135921 | 3300010397 | Terrestrial Soil | TVAKNALRLEYALTRTLTLRAEAGVVSSFGIYYRKVFD* |
Ga0126383_118193883 | 3300010398 | Tropical Forest Soil | GLTVATNALRVEYALSNTLSVRAEAGTVSGVGLYYRRNFE* |
Ga0136623_105160993 | 3300012045 | Polar Desert Sand | LSLIYEQGLSLASNALRIEYALTRTLTLRAEAGTVSGIGIFYRRTYD* |
Ga0137376_104325123 | 3300012208 | Vadose Zone Soil | AANALRLEYALTNTLTLRAEAGAVSGIGVYYRRAFD* |
Ga0157374_115033481 | 3300013296 | Miscanthus Rhizosphere | LTVAKNALRLEYALTRTLTLRAEAGVVSSFGIYYRKVFD* |
Ga0157378_113988241 | 3300013297 | Miscanthus Rhizosphere | LVYEQGLTIATNALRLEYELTRSLTLRAEAGTVGGLGIYFRRTFD* |
Ga0075339_11161532 | 3300014316 | Natural And Restored Wetlands | VATNALRLEYELTRSLRLRAEAGTVSGLGIYFRRSFD* |
Ga0182008_109892342 | 3300014497 | Rhizosphere | ASGALRLEYALTRTLTLRAEAGTVSALGLIYRRSFE* |
Ga0182019_107636882 | 3300014498 | Fen | TVATNALRIEYTLSRTLTLRAEAGVVSSVGLYFRRTYD* |
Ga0157379_116870661 | 3300014968 | Switchgrass Rhizosphere | NALRIEYALSRTLTLRAEAGAIASFGLYYRRSYD* |
Ga0157376_119321152 | 3300014969 | Miscanthus Rhizosphere | YEQGLTIATNALRIEYALSSTLTVRAEAGTVSGVGLVYRRSFD* |
Ga0132258_104222494 | 3300015371 | Arabidopsis Rhizosphere | LTVAYEQGLTVATNALRIEYALSSTLSVRAEAGTVSGLGLVYRRNFE* |
Ga0132255_1049172841 | 3300015374 | Arabidopsis Rhizosphere | LSENLTVAWEQGLTVATNALRIEYSLTTSLSVRAEAGTVSGLGLFYRKSFE* |
Ga0184605_101449981 | 3300018027 | Groundwater Sediment | QGLSIAANALRLEYALTNTLTLRAEAGMVSGVGVYYRRAFD |
Ga0193735_11655741 | 3300020006 | Soil | KLMLVYEQGLTVATNALRLEYSLSRTLTLRAEGGAISGFGIYYRRVFD |
Ga0207697_104205531 | 3300025315 | Corn, Switchgrass And Miscanthus Rhizosphere | ATQALRLEYELTRSLTIRAEAGTYGALGIYFRRTFD |
Ga0209483_10290301 | 3300025862 | Arctic Peat Soil | LSNRLTLVYEQGLTVATNALRLEYALTRTLTLRVEAGTVSGLGIFFRRSYD |
Ga0209483_11219202 | 3300025862 | Arctic Peat Soil | SRLTLVYEQGLTVATNALRLEYALTRTLTLRVEAGTVSGLGIFFRRSYD |
Ga0207688_107352661 | 3300025901 | Corn, Switchgrass And Miscanthus Rhizosphere | GLTAASNALRIEYTLTRTLTLRAEAGVVSSLGLYFRRTFD |
Ga0207693_112483201 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | VYEQGLTIATNALRIEYTLTRTITLRAEAGTVASVGIYYRKTFD |
Ga0207662_111160713 | 3300025918 | Switchgrass Rhizosphere | LTLATQALRLEYELTRSLTVRAEAGTYGAIGLYFRRTFD |
Ga0207662_113182391 | 3300025918 | Switchgrass Rhizosphere | YEQGLTVATNALRLEYALSRTLTLRAEAGTTSSLGVYFRRSYD |
Ga0207681_105915711 | 3300025923 | Switchgrass Rhizosphere | YQQGLSIATNALRIEYALSNTLTLRAEAGTISGLGIFYRRSFE |
Ga0207650_105617562 | 3300025925 | Switchgrass Rhizosphere | GLSFASGALRLEYALTRTVTLRAEAGTVSAIGLYFRRSFE |
Ga0207686_104029752 | 3300025934 | Miscanthus Rhizosphere | TNTLRIEYALTRTVTLRAEAGTVGSVGVFYRRSFD |
Ga0207670_103084121 | 3300025936 | Switchgrass Rhizosphere | GLTVATNALRLEYALSRTLTLRAEAGTTSSLGVYFRRSYD |
Ga0207704_118503871 | 3300025938 | Miscanthus Rhizosphere | LVYEQGLTIATNALRLEYELTRSITLRAEAGTVGAVGLYFRRTFD |
Ga0207711_120908282 | 3300025941 | Switchgrass Rhizosphere | RLTLVYEQGLTVATQALRLEYELTRSLTIRAEAGTYGALGIYFRRTFD |
Ga0207689_103730443 | 3300025942 | Miscanthus Rhizosphere | SLVYEQGLTIATNALRLEYELTRSLTLRAEAGTVGGLGIYFRRTFD |
Ga0207679_100148667 | 3300025945 | Corn Rhizosphere | SGALRLEYALTRTLTLRAEAGTVSALGLFYRRSFE |
Ga0207651_112918222 | 3300025960 | Switchgrass Rhizosphere | QGLTAASNALRIEYTLTRTLTLRAEAGVVSSLGLYFRRTFD |
Ga0207640_108590451 | 3300025981 | Corn Rhizosphere | LVYEQGLTVAKNALRLEYALTRTLTLRAEAGVVSSFGIYYRKVFD |
Ga0207658_106891431 | 3300025986 | Switchgrass Rhizosphere | EQGLSLAQNALRIEYALSRTLTLRAEAGAVASFGLYYRRSYD |
Ga0207658_106977271 | 3300025986 | Switchgrass Rhizosphere | FASGALRLEYALTRTVTLRAEAGTVSAIGLYFRRSFE |
Ga0207703_101774071 | 3300026035 | Switchgrass Rhizosphere | KRISDRLTLVYEQGLSLATNALRIEYALSRTLTLRAEAGAIASFGLYYRRSYD |
Ga0207641_113805653 | 3300026088 | Switchgrass Rhizosphere | ERLSLVYEQGLTIATNALRLEYELTRSITLRAEAGTVGAVGLYFRRTFD |
Ga0207648_109259802 | 3300026089 | Miscanthus Rhizosphere | EQGLSFASGALRLEYALTRTVTLRAEAGTVSAIGLYFRRSFE |
Ga0207648_113749773 | 3300026089 | Miscanthus Rhizosphere | GLTIATNALRLEYELTRSITLRAEAGTVGAVGLYFRRTFD |
Ga0207674_123036471 | 3300026116 | Corn Rhizosphere | GYEQGLSLAANALRLEYALTSTLTLRAEAGTVSGVGVYYRRTYN |
Ga0209797_101512481 | 3300027831 | Wetland Sediment | DRLSLVYEQGLSLANNTLRLEYELTRSLRLRAEAGTISGVGLYFGRSFD |
Ga0302166_100545331 | 3300028652 | Fen | TVANNALRIEYALTRSLTLRAEAGIISSLGLYFRRSYD |
Ga0302294_102041681 | 3300028740 | Fen | EQGLTVANNALRIEYALTRSLTLRAEAGIVSSLGLYFRRSYD |
Ga0302263_100230764 | 3300028869 | Fen | TLVYEQGLTVANNALRIEYALTRSLTLRAEAGIISSLGLYYRRSYE |
Ga0311334_117017111 | 3300029987 | Fen | LSESLTVAWEQGLTVATNALRVEYSLSNSLSVRAEAGTVSGVGLYYRRSFE |
Ga0302172_101181832 | 3300030003 | Fen | RMTLVYEQGLTVATNALRIEYTLSRTLTLRAEAGVVSSLGLFFRRTYD |
Ga0311349_100189031 | 3300030294 | Fen | TVANNALRIEYALTRSLTLRAEAGIVSSLGLYFRRSYD |
Ga0311349_113391172 | 3300030294 | Fen | SETLTVAWEQGLTVATNALRVEYSLSNSLSVRAEAGTVSGVGLYYRRSFE |
Ga0311349_116129402 | 3300030294 | Fen | TDRLTLVYEQGLTVATNALRLEYSLTRAITLRAEAGTISSVGVYYRRNFD |
Ga0311360_107175351 | 3300030339 | Bog | ANNALRIEYALTRSLTLRAEAGIVSSLGLYFRRSYD |
Ga0311360_108333841 | 3300030339 | Bog | QGLTVANNALRIEYALTRSLTLRAEAGIISSLGLYYRRSYE |
Ga0170824_1227002481 | 3300031231 | Forest Soil | LVYAQGLTVATNALRIEYALTRTLTLRAEAGVVGSFGIYYRRSFD |
Ga0311364_124159551 | 3300031521 | Fen | WEQGLTVATNALRVEYSLSNSLSVRAEAGTVSGVGLYYRRSFE |
Ga0302321_1000315315 | 3300031726 | Fen | LTVANNALRIEYALTRSLTLRAEAGIISSLGLYYRRSYE |
Ga0302321_1014462303 | 3300031726 | Fen | SESLTVAWEQGLTVATNALRVEYSLSNSLSVRAEAGTVSGVGLYYRRSFE |
Ga0302321_1024839521 | 3300031726 | Fen | LTVAWEQGLTVATNALRVEYSLSNSLSVRAEAGTVSGVGLYYRRSFE |
Ga0315899_117264082 | 3300031784 | Freshwater | EQGLTVATNALRLEYELTRSLTLRAEAGTISGVGIYFRRSFD |
Ga0315297_108350612 | 3300031873 | Sediment | EQGLTVATNALRLEYSLSRTLTLRAEAGAISGFGIYYRRTFE |
Ga0310900_103419451 | 3300031908 | Soil | TNALRLEYALTRTWTLRAEAGTVSGFGIYYRRAFD |
Ga0311367_111003793 | 3300031918 | Fen | TVANNALRIEYALTKSLTLRAEAGIISSLGLYFRRSYD |
Ga0310901_102230072 | 3300031940 | Soil | RLNLVYEQGLTAATNALRVEYALTRTLTLRAEAGVVSSLGMYFRRTFD |
Ga0307409_1024102221 | 3300031995 | Rhizosphere | DRLSLVYEQGLTAATNALRIEYALTRTLTLRAEAGVISSVGLYFRRTFD |
Ga0308176_102259263 | 3300031996 | Soil | TIGYEQGLALASSAVRIEYALTRTLTLRAEAGAASSLSLVYRRLFQ |
Ga0307416_1024328602 | 3300032002 | Rhizosphere | ATNALRIEYTLTRTLTLRAEAGVVSSVGLYFRRTFD |
Ga0318524_104098932 | 3300032067 | Soil | QGLTVAKNALRLDYALTRTLTLRAEGGAISSVGIFYRRVFD |
Ga0315277_108971661 | 3300032118 | Sediment | DNLSLVYEQGLTVATNALRLEYSLSRTLTLRAEAGVISGFGIYYRRTLE |
Ga0315281_111540093 | 3300032163 | Sediment | ATNALRLEYSLSRTLTLRAEAGVISGFGIYYRRTLE |
Ga0315283_106823101 | 3300032164 | Sediment | ATNALRLEYDLTRSLTRRAEAGTVGGVGLYFRRSFD |
Ga0307471_1011892843 | 3300032180 | Hardwood Forest Soil | VYEQGLTVANNALRIEYALTRTLTLRAEAGIISSLGVYFRRSYD |
Ga0315270_107300881 | 3300032275 | Sediment | DRLTIVYEQGLTIANNALRLEYTLSRTLTLRAETGVVSGVGVYYRHAFE |
Ga0315286_108793152 | 3300032342 | Sediment | QGLTVATNALRLEYSLSRTLTLRAEAGVISGFGIYYRRTFE |
Ga0315287_113095031 | 3300032397 | Sediment | TDRLSLVYEQGLTVATNALRLEYSLSRTLTLRAEAGVISGFGIYYRRTFE |
Ga0315273_112825763 | 3300032516 | Sediment | LANNTLRLEYELTRSLRLRAEAGAISGIGIFFRRSFD |
Ga0315273_115101692 | 3300032516 | Sediment | DRLSLVYEQGLTVATNALRLEYDLTRSLMLRAEAGTVGGIGLYFRRSFD |
Ga0316619_104255302 | 3300033414 | Soil | RLTERLSLVYEQGLTVATNGLRIEYALSRTMTLRAEAGTVSGVGIYYRRTMR |
Ga0247829_101356962 | 3300033550 | Soil | RLTLVYEQGLTVATNALRIEYALSRTLTLRAEAGVVSSVGLFFRRSFD |
Ga0364927_0086580_738_857 | 3300034148 | Sediment | LSVANNALRIEYALTRTLTVRAEAGVVSSLGLYFRRTYD |
⦗Top⦘ |