


| Basic Information | |
|---|---|
| Family ID | F097488 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 104 |
| Average Sequence Length | 39 residues |
| Representative Sequence | MGLIDFFNDPNSAVIFGCGIGVSAIFLIGVTKSLYGPKK |
| Number of Associated Samples | 69 |
| Number of Associated Scaffolds | 104 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 74.04 % |
| % of genes near scaffold ends (potentially truncated) | 32.69 % |
| % of genes from short scaffolds (< 2000 bps) | 80.77 % |
| Associated GOLD sequencing projects | 61 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.51 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (62.500 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine (37.500 % of family members) |
| Environment Ontology (ENVO) | Unclassified (77.885 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (95.192 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 47.76% β-sheet: 0.00% Coil/Unstructured: 52.24% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.51 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 104 Family Scaffolds |
|---|---|---|
| PF08534 | Redoxin | 13.46 |
| PF09293 | RNaseH_C | 3.85 |
| PF02739 | 5_3_exonuc_N | 3.85 |
| PF00004 | AAA | 2.88 |
| PF08406 | CbbQ_C | 2.88 |
| PF14743 | DNA_ligase_OB_2 | 1.92 |
| PF00856 | SET | 1.92 |
| PF09723 | Zn-ribbon_8 | 1.92 |
| PF00190 | Cupin_1 | 0.96 |
| PF07486 | Hydrolase_2 | 0.96 |
| PF13640 | 2OG-FeII_Oxy_3 | 0.96 |
| COG ID | Name | Functional Category | % Frequency in 104 Family Scaffolds |
|---|---|---|---|
| COG0258 | 5'-3' exonuclease Xni/ExoIX (flap endonuclease) | Replication, recombination and repair [L] | 3.85 |
| COG0714 | MoxR-like ATPase | General function prediction only [R] | 2.88 |
| COG3773 | Cell wall hydrolase CwlJ, involved in spore germination | Cell cycle control, cell division, chromosome partitioning [D] | 0.96 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 62.50 % |
| All Organisms | root | All Organisms | 37.50 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000949|BBAY94_10200172 | Not Available | 538 | Open in IMG/M |
| 3300001833|ACM24_1039639 | All Organisms → cellular organisms → Bacteria | 619 | Open in IMG/M |
| 3300001964|GOS2234_1032695 | Not Available | 1954 | Open in IMG/M |
| 3300005057|Ga0068511_1006821 | Not Available | 1413 | Open in IMG/M |
| 3300005057|Ga0068511_1012594 | All Organisms → Viruses → Predicted Viral | 1143 | Open in IMG/M |
| 3300005057|Ga0068511_1012704 | All Organisms → Viruses → Predicted Viral | 1140 | Open in IMG/M |
| 3300005057|Ga0068511_1018394 | Not Available | 998 | Open in IMG/M |
| 3300005057|Ga0068511_1028538 | Not Available | 849 | Open in IMG/M |
| 3300005510|Ga0066825_10023046 | All Organisms → Viruses → Predicted Viral | 2151 | Open in IMG/M |
| 3300005934|Ga0066377_10029266 | All Organisms → Viruses → Predicted Viral | 1516 | Open in IMG/M |
| 3300005934|Ga0066377_10074069 | Not Available | 997 | Open in IMG/M |
| 3300005934|Ga0066377_10083088 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales → Porticoccaceae → unclassified Porticoccaceae → Porticoccaceae bacterium | 945 | Open in IMG/M |
| 3300005934|Ga0066377_10092091 | Not Available | 900 | Open in IMG/M |
| 3300005934|Ga0066377_10241093 | Not Available | 558 | Open in IMG/M |
| 3300005934|Ga0066377_10280809 | Not Available | 516 | Open in IMG/M |
| 3300005971|Ga0066370_10153936 | Not Available | 790 | Open in IMG/M |
| 3300006024|Ga0066371_10143526 | Not Available | 731 | Open in IMG/M |
| 3300006027|Ga0075462_10001694 | Not Available | 7149 | Open in IMG/M |
| 3300006329|Ga0068486_1189976 | All Organisms → cellular organisms → Bacteria | 774 | Open in IMG/M |
| 3300006350|Ga0099954_1029156 | Not Available | 756 | Open in IMG/M |
| 3300006480|Ga0100226_1027102 | Not Available | 752 | Open in IMG/M |
| 3300006481|Ga0100229_1081318 | Not Available | 579 | Open in IMG/M |
| 3300007113|Ga0101666_1041052 | All Organisms → cellular organisms → Bacteria | 845 | Open in IMG/M |
| 3300007113|Ga0101666_1063660 | Not Available | 683 | Open in IMG/M |
| 3300007114|Ga0101668_1040378 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 951 | Open in IMG/M |
| 3300007116|Ga0101667_1084030 | Not Available | 580 | Open in IMG/M |
| 3300009481|Ga0114932_10057705 | All Organisms → Viruses → Predicted Viral | 2474 | Open in IMG/M |
| 3300009748|Ga0123370_1026060 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales → Porticoccaceae → unclassified Porticoccaceae → Porticoccaceae bacterium | 655 | Open in IMG/M |
| 3300009790|Ga0115012_10813851 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales → Porticoccaceae → unclassified Porticoccaceae → Porticoccaceae bacterium | 758 | Open in IMG/M |
| 3300011013|Ga0114934_10521310 | Not Available | 525 | Open in IMG/M |
| 3300012920|Ga0160423_10025588 | All Organisms → Viruses → Predicted Viral | 4394 | Open in IMG/M |
| 3300012920|Ga0160423_10063588 | Not Available | 2651 | Open in IMG/M |
| 3300012920|Ga0160423_10479111 | Not Available | 847 | Open in IMG/M |
| 3300012928|Ga0163110_10151243 | Not Available | 1608 | Open in IMG/M |
| 3300012928|Ga0163110_10207741 | Not Available | 1391 | Open in IMG/M |
| 3300012928|Ga0163110_10296335 | All Organisms → Viruses → Predicted Viral | 1182 | Open in IMG/M |
| 3300012928|Ga0163110_10327586 | All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon | 1128 | Open in IMG/M |
| 3300012936|Ga0163109_10943774 | Not Available | 630 | Open in IMG/M |
| 3300012952|Ga0163180_10525821 | Not Available | 888 | Open in IMG/M |
| 3300012952|Ga0163180_10669955 | Not Available | 798 | Open in IMG/M |
| 3300013188|Ga0116834_1037912 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales → Porticoccaceae → unclassified Porticoccaceae → Porticoccaceae bacterium | 873 | Open in IMG/M |
| 3300013188|Ga0116834_1086074 | Not Available | 638 | Open in IMG/M |
| 3300013231|Ga0116832_1025401 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales → Porticoccaceae → unclassified Porticoccaceae → Porticoccaceae bacterium | 839 | Open in IMG/M |
| 3300013231|Ga0116832_1084842 | Not Available | 530 | Open in IMG/M |
| 3300017768|Ga0187220_1001010 | Not Available | 9103 | Open in IMG/M |
| 3300017951|Ga0181577_10076535 | Not Available | 2342 | Open in IMG/M |
| 3300017952|Ga0181583_10690246 | Not Available | 607 | Open in IMG/M |
| 3300017969|Ga0181585_10987675 | Not Available | 537 | Open in IMG/M |
| 3300018420|Ga0181563_10015636 | Not Available | 6117 | Open in IMG/M |
| 3300018424|Ga0181591_10810324 | Not Available | 649 | Open in IMG/M |
| 3300018424|Ga0181591_10835904 | Not Available | 637 | Open in IMG/M |
| 3300020246|Ga0211707_1001608 | All Organisms → Viruses → Predicted Viral | 3794 | Open in IMG/M |
| 3300020246|Ga0211707_1012116 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales → Porticoccaceae → unclassified Porticoccaceae → Porticoccaceae bacterium | 1244 | Open in IMG/M |
| 3300020246|Ga0211707_1022100 | Not Available | 889 | Open in IMG/M |
| 3300020255|Ga0211586_1027924 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales → Porticoccaceae → unclassified Porticoccaceae → Porticoccaceae bacterium | 1010 | Open in IMG/M |
| 3300020255|Ga0211586_1057243 | Not Available | 630 | Open in IMG/M |
| 3300020269|Ga0211484_1020015 | Not Available | 1344 | Open in IMG/M |
| 3300020296|Ga0211474_1017168 | Not Available | 1282 | Open in IMG/M |
| 3300020319|Ga0211517_1016379 | Not Available | 1503 | Open in IMG/M |
| 3300020371|Ga0211500_1130670 | Not Available | 739 | Open in IMG/M |
| 3300020379|Ga0211652_10163007 | Not Available | 679 | Open in IMG/M |
| 3300020380|Ga0211498_10081390 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales → Porticoccaceae → unclassified Porticoccaceae → Porticoccaceae bacterium | 1213 | Open in IMG/M |
| 3300020380|Ga0211498_10176249 | Not Available | 808 | Open in IMG/M |
| 3300020394|Ga0211497_10007746 | Not Available | 6295 | Open in IMG/M |
| 3300020394|Ga0211497_10306033 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales → Porticoccaceae → unclassified Porticoccaceae → Porticoccaceae bacterium | 592 | Open in IMG/M |
| 3300020394|Ga0211497_10379481 | Not Available | 517 | Open in IMG/M |
| 3300020395|Ga0211705_10044404 | Not Available | 1604 | Open in IMG/M |
| 3300020410|Ga0211699_10286404 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Cryomorphaceae → unclassified Cryomorphaceae → Cryomorphaceae bacterium | 640 | Open in IMG/M |
| 3300020411|Ga0211587_10070948 | Not Available | 1550 | Open in IMG/M |
| 3300020413|Ga0211516_10116159 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales → Porticoccaceae → unclassified Porticoccaceae → Porticoccaceae bacterium | 1268 | Open in IMG/M |
| 3300020413|Ga0211516_10438818 | Not Available | 576 | Open in IMG/M |
| 3300020419|Ga0211512_10239272 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales → Porticoccaceae → unclassified Porticoccaceae → Porticoccaceae bacterium | 829 | Open in IMG/M |
| 3300020428|Ga0211521_10026474 | All Organisms → Viruses → Predicted Viral | 3235 | Open in IMG/M |
| 3300020433|Ga0211565_10094118 | Not Available | 1289 | Open in IMG/M |
| 3300020433|Ga0211565_10509530 | Not Available | 522 | Open in IMG/M |
| 3300020436|Ga0211708_10006951 | All Organisms → Viruses → Predicted Viral | 4223 | Open in IMG/M |
| 3300020436|Ga0211708_10011502 | All Organisms → Viruses → Predicted Viral | 3317 | Open in IMG/M |
| 3300020436|Ga0211708_10040431 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales → Porticoccaceae → unclassified Porticoccaceae → Porticoccaceae bacterium | 1789 | Open in IMG/M |
| 3300020441|Ga0211695_10420549 | Not Available | 509 | Open in IMG/M |
| 3300020442|Ga0211559_10039273 | Not Available | 2352 | Open in IMG/M |
| 3300020442|Ga0211559_10107982 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales → Porticoccaceae → unclassified Porticoccaceae → Porticoccaceae bacterium | 1338 | Open in IMG/M |
| 3300020442|Ga0211559_10519518 | Not Available | 543 | Open in IMG/M |
| 3300020465|Ga0211640_10026586 | All Organisms → Viruses → Predicted Viral | 3465 | Open in IMG/M |
| 3300020467|Ga0211713_10036381 | Not Available | 2430 | Open in IMG/M |
| 3300020468|Ga0211475_10089439 | All Organisms → cellular organisms → Bacteria | 1616 | Open in IMG/M |
| 3300020468|Ga0211475_10459016 | Not Available | 613 | Open in IMG/M |
| 3300020471|Ga0211614_10150377 | All Organisms → Viruses → Predicted Viral | 1000 | Open in IMG/M |
| 3300020474|Ga0211547_10169450 | All Organisms → Viruses → Predicted Viral | 1127 | Open in IMG/M |
| 3300021356|Ga0213858_10539460 | Not Available | 535 | Open in IMG/M |
| 3300021364|Ga0213859_10159309 | Not Available | 1058 | Open in IMG/M |
| 3300022934|Ga0255781_10465042 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales → Porticoccaceae → unclassified Porticoccaceae → Porticoccaceae bacterium | 517 | Open in IMG/M |
| 3300023116|Ga0255751_10075771 | Not Available | 2182 | Open in IMG/M |
| 3300023176|Ga0255772_10190711 | Not Available | 1174 | Open in IMG/M |
| 3300023180|Ga0255768_10406299 | Not Available | 720 | Open in IMG/M |
| 3300025151|Ga0209645_1020151 | All Organisms → Viruses → Predicted Viral | 2548 | Open in IMG/M |
| 3300025151|Ga0209645_1038173 | Not Available | 1737 | Open in IMG/M |
| 3300025151|Ga0209645_1146661 | Not Available | 730 | Open in IMG/M |
| 3300025803|Ga0208425_1115211 | Not Available | 618 | Open in IMG/M |
| 3300026085|Ga0208880_1009347 | All Organisms → Viruses → Predicted Viral | 2006 | Open in IMG/M |
| 3300027830|Ga0209359_10046826 | All Organisms → Viruses → Predicted Viral | 1666 | Open in IMG/M |
| 3300029319|Ga0183748_1017468 | All Organisms → Viruses → Predicted Viral | 2654 | Open in IMG/M |
| 3300029319|Ga0183748_1081952 | Not Available | 793 | Open in IMG/M |
| 3300031774|Ga0315331_10325399 | Not Available | 1131 | Open in IMG/M |
| 3300032006|Ga0310344_10346315 | Not Available | 1273 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 37.50% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 20.19% |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 9.62% |
| Surface Seawater | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Surface Seawater | 7.69% |
| Marine Water | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine Water | 4.81% |
| Volcanic Co2 Seep Seawater | Environmental → Aquatic → Marine → Volcanic → Unclassified → Volcanic Co2 Seep Seawater | 3.85% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Marine | 2.88% |
| Seawater | Environmental → Aquatic → Marine → Oceanic → Unclassified → Seawater | 1.92% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 1.92% |
| Seawater | Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater | 1.92% |
| Deep Subsurface | Environmental → Aquatic → Marine → Volcanic → Unclassified → Deep Subsurface | 1.92% |
| Seawater | Environmental → Aquatic → Marine → Oceanic → Unclassified → Seawater | 0.96% |
| Marine Plankton | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine Plankton | 0.96% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Aphotic Zone → Marine | 0.96% |
| Seawater | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater | 0.96% |
| Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 0.96% |
| Macroalgal Surface | Host-Associated → Algae → Green Algae → Ectosymbionts → Unclassified → Macroalgal Surface | 0.96% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000949 | Macroalgal surface ecosystem from Botany Bay, Sydney, Australia - BBAY94 | Host-Associated | Open in IMG/M |
| 3300001833 | Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - ACM24, ROCA_DNA012_0.2um_2l | Environmental | Open in IMG/M |
| 3300001964 | Marine microbial communities from Rosario Bank, Honduras - GS018 | Environmental | Open in IMG/M |
| 3300005057 | Marine water microbial communities from the East Sea, Korea with extracellular vesicles - East-Sea-0.2um | Environmental | Open in IMG/M |
| 3300005510 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201306SV45 | Environmental | Open in IMG/M |
| 3300005934 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S23_td_SurfaceB_ad_5m_LV_B | Environmental | Open in IMG/M |
| 3300005971 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S15_td_SurfaceA_ad_5m_LV_A | Environmental | Open in IMG/M |
| 3300006024 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S15_td_DCM_ad_63m_LV_B | Environmental | Open in IMG/M |
| 3300006027 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006329 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT233_1_0500m | Environmental | Open in IMG/M |
| 3300006350 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT225_1_0075m | Environmental | Open in IMG/M |
| 3300006480 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT231_1_0075m | Environmental | Open in IMG/M |
| 3300006481 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT231_2_0025m | Environmental | Open in IMG/M |
| 3300007113 | Seawater microbiome, Papua New Guinea CO2 seep, Upa-Upasina 'bubble' site, Water-is | Environmental | Open in IMG/M |
| 3300007114 | Seawater microbiome, Papua New Guinea CO2 seep, Upa-Upasina 'bubble', waterEBis4 | Environmental | Open in IMG/M |
| 3300007116 | Seawater microbiome, Papua New Guinea CO2 seep, Upa-Upasina 'bubble' site, waterEBis3 | Environmental | Open in IMG/M |
| 3300009481 | Deep subsurface microbial communities from Kolumbo volcano to uncover new lineages of life (NeLLi) - 2SBTROV12_ACTIVE470 metaG | Environmental | Open in IMG/M |
| 3300009748 | Marine microbial and viral communities from Louisana Shelf, Gulf of Mexico - GoM_2015_C6C_210_18m (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300009790 | Marine eukaryotic phytoplankton communities from Atlantic Ocean - Tropical Atlantic ANT10 Metagenome | Environmental | Open in IMG/M |
| 3300011013 | Deep subsurface microbial communities from Kolumbo volcano to uncover new lineages of life (NeLLi) - 4SBTROV10_white metaG | Environmental | Open in IMG/M |
| 3300012920 | Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St8 metaG | Environmental | Open in IMG/M |
| 3300012928 | Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St17 metaG | Environmental | Open in IMG/M |
| 3300012936 | Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St13 metaG | Environmental | Open in IMG/M |
| 3300012952 | Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Atlantic ANT 4 Metagenome | Environmental | Open in IMG/M |
| 3300013188 | Marine hypoxic microbial communities from the Gulf of Mexico, USA - 6m_Station1_GOM_Metagenome | Environmental | Open in IMG/M |
| 3300013231 | Marine hypoxic microbial communities from the Gulf of Mexico, USA - 5m_Station5_GOM_Metagenome | Environmental | Open in IMG/M |
| 3300017768 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 6 SPOT_SRF_2009-12-23 (version 2) | Environmental | Open in IMG/M |
| 3300017951 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101413BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017952 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071405CT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017969 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071407BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018420 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011512CT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018424 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071412AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300020246 | Marine microbial communities from Tara Oceans - TARA_B100000424 (ERX555934-ERR599105) | Environmental | Open in IMG/M |
| 3300020255 | Marine microbial communities from Tara Oceans - TARA_B100000131 (ERX556136-ERR599013) | Environmental | Open in IMG/M |
| 3300020269 | Marine microbial communities from Tara Oceans - TARA_A100001035 (ERX556080-ERR599041) | Environmental | Open in IMG/M |
| 3300020296 | Marine microbial communities from Tara Oceans - TARA_A100000164 (ERX556002-ERR599140) | Environmental | Open in IMG/M |
| 3300020319 | Marine microbial communities from Tara Oceans - TARA_S200000501 (ERX556039-ERR599073) | Environmental | Open in IMG/M |
| 3300020371 | Marine microbial communities from Tara Oceans - TARA_B100000003 (ERX555978-ERR598991) | Environmental | Open in IMG/M |
| 3300020379 | Marine microbial communities from Tara Oceans - TARA_B100000902 (ERX556001-ERR599168) | Environmental | Open in IMG/M |
| 3300020380 | Marine microbial communities from Tara Oceans - TARA_B000000565 (ERX555945-ERR599058) | Environmental | Open in IMG/M |
| 3300020394 | Marine microbial communities from Tara Oceans - TARA_B000000557 (ERX556068-ERR599026) | Environmental | Open in IMG/M |
| 3300020395 | Marine microbial communities from Tara Oceans - TARA_B100000427 (ERX555987-ERR599133) | Environmental | Open in IMG/M |
| 3300020410 | Marine microbial communities from Tara Oceans - TARA_B100000519 (ERX555959-ERR599148) | Environmental | Open in IMG/M |
| 3300020411 | Marine microbial communities from Tara Oceans - TARA_B100000131 (ERX556098-ERR599130) | Environmental | Open in IMG/M |
| 3300020413 | Marine microbial communities from Tara Oceans - TARA_S200000501 (ERX555962-ERR599092) | Environmental | Open in IMG/M |
| 3300020419 | Marine microbial communities from Tara Oceans - TARA_X000000263 (ERX555964-ERR598955) | Environmental | Open in IMG/M |
| 3300020428 | Marine microbial communities from Tara Oceans - TARA_E500000331 (ERX556032-ERR599094) | Environmental | Open in IMG/M |
| 3300020433 | Marine microbial communities from Tara Oceans - TARA_B100001989 (ERX556106-ERR599030) | Environmental | Open in IMG/M |
| 3300020436 | Marine microbial communities from Tara Oceans - TARA_B100000424 (ERX556009-ERR598984) | Environmental | Open in IMG/M |
| 3300020441 | Marine prokaryotic communities collected during Tara Oceans survey from station TARA_078 - TARA_B100000524 (ERX556088-ERR599006) | Environmental | Open in IMG/M |
| 3300020442 | Marine microbial communities from Tara Oceans - TARA_B100002019 (ERX556121-ERR599162) | Environmental | Open in IMG/M |
| 3300020465 | Marine microbial communities from Tara Oceans - TARA_B100000579 (ERX556060-ERR598961) | Environmental | Open in IMG/M |
| 3300020467 | Marine microbial communities from Tara Oceans - TARA_B100000945 (ERX555966-ERR598957) | Environmental | Open in IMG/M |
| 3300020468 | Marine microbial communities from Tara Oceans - TARA_A100000164 (ERX555914-ERR598993) | Environmental | Open in IMG/M |
| 3300020471 | Marine microbial communities from Tara Oceans - TARA_B100000214 (ERX556063-ERR599002) | Environmental | Open in IMG/M |
| 3300020474 | Marine prokaryotic communities collected during Tara Oceans survey from station TARA_151 - TARA_B100001564 (ERX555957-ERR598976) | Environmental | Open in IMG/M |
| 3300021356 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO245 | Environmental | Open in IMG/M |
| 3300021364 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO304 | Environmental | Open in IMG/M |
| 3300022934 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101413BT metaG | Environmental | Open in IMG/M |
| 3300023116 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071412BT metaG | Environmental | Open in IMG/M |
| 3300023176 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071411BT metaG | Environmental | Open in IMG/M |
| 3300023180 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071412AT metaG | Environmental | Open in IMG/M |
| 3300025151 | Marine viral communities from the Pacific Ocean - ETNP_6_30 (SPAdes) | Environmental | Open in IMG/M |
| 3300025803 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300026085 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S23_td_SurfaceB_ad_5m_LV_B (SPAdes) | Environmental | Open in IMG/M |
| 3300027830 | Marine microbial communities from the Southern Atlantic Ocean, analyzing organic carbon cycling - Surface_A/KNORR_S2/LV (SPAdes) | Environmental | Open in IMG/M |
| 3300029319 | Marine viral communities collected during Tara Oceans survey from station TARA_032 - TARA_A100001516 | Environmental | Open in IMG/M |
| 3300031774 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 60m 34915 | Environmental | Open in IMG/M |
| 3300032006 | Marine microbial communities from station ALOHA, North Pacific Subtropical Gyre - HC15-DNA-20-200_MG | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| BBAY94_102001723 | 3300000949 | Macroalgal Surface | MGLIDFFNDPNSAIIFGFGICVSAVFLIGVTKSLYGPKK* |
| ACM24_10396391 | 3300001833 | Marine Plankton | MLLIDFFNDPNSAIIFGCGIGVSAIFLIGVTKSLYGPKK* |
| GOS2234_103269511 | 3300001964 | Marine | MGLIDFFNDPNSAIIFGCGIIVSAIFLIGVTKSLYGPKK* |
| Ga0068511_10068213 | 3300005057 | Marine Water | MGLIDFFNDPNSAIIFGCGIGVSAIFLIGVSKSLYGPKK* |
| Ga0068511_10125943 | 3300005057 | Marine Water | KQVEKMLLIDFFNDPNSAVIFGCGIGVSAIFLIGVTKSLYGPKK* |
| Ga0068511_10127045 | 3300005057 | Marine Water | MGLIDFFNDPNSAIIFGCGICVSAIFLIGVSKSLYGPKK* |
| Ga0068511_10183943 | 3300005057 | Marine Water | MGLIDFFNDPNSAVIFGCGIGVSAVFLIGVTKSLYGPKK* |
| Ga0068511_10285385 | 3300005057 | Marine Water | MGLIDFFNDPNSAVIFGCGVGVSIVFLIGVSKSLYGPKK* |
| Ga0066825_100230464 | 3300005510 | Marine | MGLIDFFNDPNSAVIFGCGIGVSAVFIIGITKTLYGPKK* |
| Ga0066377_100292661 | 3300005934 | Marine | MTLLDFFNDPNSAVIFGCGIGISAIFLVAVTHALYGP |
| Ga0066377_100740692 | 3300005934 | Marine | MTLLDFFNDPNSAVIFGCGIGISAIFLVAVTHALYGPKKKK* |
| Ga0066377_100830883 | 3300005934 | Marine | MGLIDFFNDPNSAVIFVCGIGVSAIFLIGVTKSLYGPKK* |
| Ga0066377_100920913 | 3300005934 | Marine | MLLIDFFNDPNSAIIFGCGVGVSAIFLIGVTKSLYGPKK* |
| Ga0066377_102410933 | 3300005934 | Marine | MGLIDFFNDPNSAIIFVFGIGVSAVFLIGVTKSLYG |
| Ga0066377_102808092 | 3300005934 | Marine | MGLIDFFNDPNSAVIFACGIGVSIIFLIGVTHSMYGPKK* |
| Ga0066370_101539361 | 3300005971 | Marine | KQVEKMLLIDFFNDPNSAIIFGCGIGVSAIFLIGVTKSLYGPKK* |
| Ga0066371_101435264 | 3300006024 | Marine | MGLIDFFNDPNSAIIFGFGIGVSAIFLIGVSKSLYGPKK* |
| Ga0075462_1000169424 | 3300006027 | Aqueous | MGLIDFFNDPNSAVIFGCGIGVSAIFLIGVSKSLYGPKK* |
| Ga0068486_11899763 | 3300006329 | Marine | MLLSDFFNDPNSAVIFFCGIGVSAIFLIGVTKSLYGPKK* |
| Ga0099954_10291563 | 3300006350 | Marine | MGLTDFFNDPNSAVIFGCGIIVSAIFLIGVTKSLYGPKK* |
| Ga0100226_10271022 | 3300006480 | Marine | MGLIDFFNDPNSAIIFGCGIGVSAVFLIGVTKSLYGPKK* |
| Ga0100229_10813181 | 3300006481 | Marine | MGLVEFFNDPNSAIIFGCGVGVSAVFLIGVTKSLYGPKK* |
| Ga0101666_10410522 | 3300007113 | Volcanic Co2 Seep Seawater | MTLLDFFNDPNSAVIFGCGIGISAIFLVAVTHALYGPKKAKK* |
| Ga0101666_10636602 | 3300007113 | Volcanic Co2 Seep Seawater | MGLIDFFNDPNSAVIFGCGVGVSAIFLIGVTKSLYGPKK* |
| Ga0101668_10403782 | 3300007114 | Volcanic Co2 Seep Seawater | MGLIDFFNDPNSAIIFGCGVIVSAIFIIGVTKSLYGPKK* |
| Ga0101667_10840303 | 3300007116 | Volcanic Co2 Seep Seawater | MLLIDFFNDPNSAVIFGCGIGVSAIFLIGVTKSLYGPKK* |
| Ga0114932_100577055 | 3300009481 | Deep Subsurface | MGLSDFFNDPNSAIIFGCGIVVSAVFIIGVTKSLYGPNK* |
| Ga0123370_10260601 | 3300009748 | Marine | MGLIDFFNDPNSAVIFGCGIIVSAIFLIGVSKSLY |
| Ga0115012_108138513 | 3300009790 | Marine | MGLIDFFNDPNSAVIFGCGIGVSIIFLIGVTHSMYGPKK* |
| Ga0114934_105213102 | 3300011013 | Deep Subsurface | DFFNDPNSAVIFACGIGVSAIFLIGITKTLYGPKK* |
| Ga0160423_100255886 | 3300012920 | Surface Seawater | MSLIDFFNDPNSAVIFACGIGVSAIFLIGVTKSLYGPKK* |
| Ga0160423_100635882 | 3300012920 | Surface Seawater | MGLVDFFNDPNSAIIFLLGIGVSSIFLIGVTKSLYGPKK* |
| Ga0160423_104791115 | 3300012920 | Surface Seawater | MGLIDFFNDPNSAVIFACGIGVSAIFLIGVSKSLYGPKK* |
| Ga0163110_101512432 | 3300012928 | Surface Seawater | MGLIDFFNDPNSAIIFGFGVGVSAIFLIGVTKTLYGPKK* |
| Ga0163110_102077411 | 3300012928 | Surface Seawater | LKLGERRMGLIDFFNDPNSAVIFACGIGVSAIFLIGVTKSLYGPKK* |
| Ga0163110_102963355 | 3300012928 | Surface Seawater | MLLIDFFNDPNSAIIFGCGIGVSAIFLIGVTKSLYGPK |
| Ga0163110_103275864 | 3300012928 | Surface Seawater | KMGLIDFFNDPNSAIIFCFGIGVSAIFLIGVTKSLYGPKK* |
| Ga0163109_109437743 | 3300012936 | Surface Seawater | MGLIDFFNDPNSAVIFACGIGVSAIFLIGVTKSLYGPKE* |
| Ga0163180_105258212 | 3300012952 | Seawater | MGLIDFFNDPNSAIIFGCGIGVSAIFLIGVTKSMYGPKK* |
| Ga0163180_106699552 | 3300012952 | Seawater | FFNDPNSAVIFGCGIGVSAIFIIGITKTLYGPKK* |
| Ga0116834_10379121 | 3300013188 | Marine | MGLIDFFNDPNSAIIFLLGIGVSAIFLIGVSKSLYGPKK* |
| Ga0116834_10860745 | 3300013188 | Marine | MGLIDFFNDPNSAVIFGCGIGVSVVFLIGVSKSLYGPKK* |
| Ga0116832_10254015 | 3300013231 | Marine | LRQVELKMGLIDFFNDPNSAVIFGCGIGVSIIFLIGVSKSLYGPK* |
| Ga0116832_10848421 | 3300013231 | Marine | MGLIDFFNDPNSAVIFGCGIGVSTIFLIGVSKSLYGPKK* |
| Ga0187220_10010101 | 3300017768 | Seawater | KMELSDFFNDPNSAVIFGCGIGVSAIFLIGITKALYGPKK |
| Ga0181577_100765355 | 3300017951 | Salt Marsh | MGLIDFFNDPNSAVIFGCGIGVSVIFLIGVTKSLYGPKE |
| Ga0181583_106902462 | 3300017952 | Salt Marsh | MGLIDFFNDPNSAVIFGCGIGVSVIFLIGITKSLYGPKE |
| Ga0181585_109876752 | 3300017969 | Salt Marsh | MGLIDFFNDPNSAVIFGCGIGVSAIFLIGVSKSLYGPKK |
| Ga0181563_1001563611 | 3300018420 | Salt Marsh | MGLIDFFNDPNSAIIFGCGIIVSAIFIIGVTKSLYGPKK |
| Ga0181591_108103241 | 3300018424 | Salt Marsh | MGLIDFFNDPNSAVIFGCGIGVSAIFLIGVTKSLYGPKK |
| Ga0181591_108359043 | 3300018424 | Salt Marsh | MGLIDFFNDPNSAGIFACGIGVSAIFLIGVTKSLYGPKK |
| Ga0211707_10016087 | 3300020246 | Marine | MGLIDFFNDPNSAIIFGCGIAVSAVFLIGVTKSLYGPKK |
| Ga0211707_10121164 | 3300020246 | Marine | MGLIDFFNDPNSAIIFGCGVIVSAIFIIGVTKSLYGPKK |
| Ga0211707_10221003 | 3300020246 | Marine | MGLIDFFNDPNSAVIFVCGIGVSAIFLIGVTKSLYGPKK |
| Ga0211586_10279243 | 3300020255 | Marine | MGLIDFFNDPNSAVIFGCGVGVSIVFLIGVSKSLYGPKK |
| Ga0211586_10572432 | 3300020255 | Marine | MGLIEFFNDPNSAIIFGCGIGVSAIFLIGVSKSLYGPKK |
| Ga0211484_10200153 | 3300020269 | Marine | MGLIDFFNDPNSAIIFGFGIGVSAIFLIGVTKSLYGPKK |
| Ga0211474_10171683 | 3300020296 | Marine | MGLIDFFNDPNSAIIFLLGIGVSAIFLIGVSKSLYGPKK |
| Ga0211517_10163795 | 3300020319 | Marine | MGLTDFFNDPNSAIIFLLGIGVSAIFLIGVSKSLYGPKK |
| Ga0211500_11306702 | 3300020371 | Marine | MGLIEFFNDPNSAIIFSCGIGVSAIFLIGVSKSLYGPKK |
| Ga0211652_101630073 | 3300020379 | Marine | MGLIDFFNDPNSAVIFGCGIGVTAIFLIGVTKSLYGPKK |
| Ga0211498_100813904 | 3300020380 | Marine | MGLIDFFNDPNSAIIFGCGIIVSAIFLIGVTKSLYGPKK |
| Ga0211498_101762492 | 3300020380 | Marine | MGLIDFFNDPNSAVIFGFGVGVSAIFLIGVTKTLYGPKK |
| Ga0211497_100077461 | 3300020394 | Marine | GERRMGLIEFFNDPNSAIIFGCGIGVSAIFLIGVSKSLYGPKK |
| Ga0211497_103060333 | 3300020394 | Marine | MLLIDFFNDPNSAIIFGFGIGVSAIFLIGVTKSLYGPKK |
| Ga0211497_103794812 | 3300020394 | Marine | MGLIDFFNDPNSAVIFACGIGVSAIFLIGVTKSLYGPKK |
| Ga0211705_100444045 | 3300020395 | Marine | MGLTDFFNDPNSAIIFVFGIGVSAIFLIGVTKSLYGPKK |
| Ga0211699_102864043 | 3300020410 | Marine | MGLIDFFNDPNSAVIFGFGVGVSAIFLIGVTKSLYGPKK |
| Ga0211587_100709482 | 3300020411 | Marine | MGLIDFFNDPNSAVIFGCGIGVSVIFLIGVTHSMYGPKK |
| Ga0211516_101161595 | 3300020413 | Marine | MGLIDFFNDPNSAIIFGCGIIVSAIFLIGVTQSLYGPKK |
| Ga0211516_104388181 | 3300020413 | Marine | LKQVEKMVLSEFFNDPNSAVIFVCGIGVSAIFLIGVTKSLYGPKK |
| Ga0211512_102392723 | 3300020419 | Marine | MGLIDFFNDPNSAIIFGCGIGVSAIFLIGVTKSMYGPKK |
| Ga0211521_100264743 | 3300020428 | Marine | MGLSDFFNDPNSAIIFGCGIVVSAVFIIGVTKSLYGPNK |
| Ga0211565_100941183 | 3300020433 | Marine | MGLIDFFNDPNSAVIFGFGVGVSAVFLIGVTKTLYGPKK |
| Ga0211565_105095302 | 3300020433 | Marine | MGLIEFFNDPNSAIIFGCGIGVSAIFLIGVSKTLYGPKK |
| Ga0211708_1000695110 | 3300020436 | Marine | MGLIDFFNDPNSAVIFGCGIGVSIIFLIGVTHSMYGPKK |
| Ga0211708_100115025 | 3300020436 | Marine | MGLIDFFNDPNSAIIFVFGIGVSAVFLIGVTKSLYGPKK |
| Ga0211708_100404317 | 3300020436 | Marine | MGLIDFFNDPNSAIIFCFGIGVSAIFLIGVTKSLYGPKK |
| Ga0211695_104205492 | 3300020441 | Marine | DFFNDPNSAIIFGCGIVVSAVFIIGVTKSLYGPKK |
| Ga0211559_100392735 | 3300020442 | Marine | LIEFFNDPNSAIIFGCGIGVSAIFLIGVSKSLYGPKK |
| Ga0211559_101079827 | 3300020442 | Marine | MKMGLIDFFNDPNSAVIFACGIGVSAIFLIGVTKSLYGPKK |
| Ga0211559_105195181 | 3300020442 | Marine | KKMGLIDFFNDPNSAIIFGCGIGVSAIFLIGVSKSLYGPKK |
| Ga0211640_100265868 | 3300020465 | Marine | MGLSDFFNDPNSAIIFGCGIVVSAVFIIGVTKSLYGPKK |
| Ga0211713_100363811 | 3300020467 | Marine | LKQDVKKMGLIDFFNDPNSAIIFGFGIGISAIFLIGVSKSLYGPKK |
| Ga0211475_100894393 | 3300020468 | Marine | MGLIDFFNDADSAIIFGCGIIVSAIFLIGVTKSIYGPKK |
| Ga0211475_104590165 | 3300020468 | Marine | LIDFFNDPNSAIIFGCGIIVSAIFLIGVTQSLYGPKK |
| Ga0211614_101503771 | 3300020471 | Marine | SDFFNDPNSAVIFFCGIGVSAIFLIGVTKSLYGPKK |
| Ga0211547_101694501 | 3300020474 | Marine | LSEFFNDPNSAVIFVCGIGVSAIFLIGVTKSLYGPKK |
| Ga0213858_105394603 | 3300021356 | Seawater | DFFNDPNSAVIFGCGIGVSAIFLIGVTKSLYGPKK |
| Ga0213859_101593095 | 3300021364 | Seawater | LIDFFNDPNSAVIFGCGIAVSAIFIIGITKSLYGPKK |
| Ga0255781_104650421 | 3300022934 | Salt Marsh | MGLIDFFNDPNSAVIFGCGIGVSVIFLIGVTKSLYGPK |
| Ga0255751_1007577110 | 3300023116 | Salt Marsh | MGLIDFFNDPNSAIIFGCGIIVSAIFIIGVSKSLY |
| Ga0255772_101907111 | 3300023176 | Salt Marsh | RKMGLIDFFNDPNSAVIFGCGIGVSAIFIIGITKALYGPK |
| Ga0255768_104062991 | 3300023180 | Salt Marsh | GLIDFFNDPNSAVIFGCGIGVSIIFIIGITKALYGPK |
| Ga0209645_10201517 | 3300025151 | Marine | MGLIDFFNDPNSAVIFGCGIGVSVVFLIGVSKSLYGPKK |
| Ga0209645_10381735 | 3300025151 | Marine | MGLIDFFNDPNSAVIFACGIGVSAIFLIGVSKSLYGPKK |
| Ga0209645_11466614 | 3300025151 | Marine | MELIEFFNDPNSAIIFGCGIGVSAIFLIGVTKSLYGPKK |
| Ga0208425_11152111 | 3300025803 | Aqueous | LKQGERTMGLIDFFNDPNSAIIFGCGIIVSAIFIIGVSKSLYGPKK |
| Ga0208880_10093474 | 3300026085 | Marine | MTLLDFFNDPNSAVIFGCGIGISAIFLVAVTHALYGPKKKK |
| Ga0209359_100468261 | 3300027830 | Marine | KKMGLIDFFNDPNSAIIFAFGIGVSAVFLIGVTKSLYGPKK |
| Ga0183748_10174684 | 3300029319 | Marine | MLLIDFFNDPNSAVIFGCGIGVSAIFLIGVTKSLYGPKK |
| Ga0183748_10819522 | 3300029319 | Marine | MGLIDFFNDPNSAVIFGCGIGVSVIFLIGVTKSLYGPKK |
| Ga0315331_103253993 | 3300031774 | Seawater | MGLIDFFNDPNSAVIFACGIGVSVIFLIGVTKSMYGPKK |
| Ga0310344_103463153 | 3300032006 | Seawater | MGLIEFFNDPNSAIIFGCGIVVSIVFLIGVTQSMYGPKK |
| ⦗Top⦘ |