Basic Information | |
---|---|
Family ID | F097424 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 104 |
Average Sequence Length | 45 residues |
Representative Sequence | VSLEQALDALIGSEAFERLLLERARPLVARADAGEDALVAAL |
Number of Associated Samples | 97 |
Number of Associated Scaffolds | 104 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 99.02 % |
% of genes near scaffold ends (potentially truncated) | 97.12 % |
% of genes from short scaffolds (< 2000 bps) | 90.38 % |
Associated GOLD sequencing projects | 95 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.43 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (91.346 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (16.346 % of family members) |
Environment Ontology (ENVO) | Unclassified (31.731 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (37.500 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 25.71% β-sheet: 5.71% Coil/Unstructured: 68.57% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.43 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 104 Family Scaffolds |
---|---|---|
PF01195 | Pept_tRNA_hydro | 41.35 |
PF00563 | EAL | 18.27 |
PF01636 | APH | 6.73 |
PF08281 | Sigma70_r4_2 | 2.88 |
PF00990 | GGDEF | 2.88 |
PF14693 | Ribosomal_TL5_C | 2.88 |
PF00144 | Beta-lactamase | 2.88 |
PF13404 | HTH_AsnC-type | 1.92 |
PF02780 | Transketolase_C | 1.92 |
PF00398 | RrnaAD | 0.96 |
PF08240 | ADH_N | 0.96 |
PF01494 | FAD_binding_3 | 0.96 |
PF10003 | DUF2244 | 0.96 |
PF02021 | UPF0102 | 0.96 |
PF01053 | Cys_Met_Meta_PP | 0.96 |
PF13173 | AAA_14 | 0.96 |
COG ID | Name | Functional Category | % Frequency in 104 Family Scaffolds |
---|---|---|---|
COG0193 | Peptidyl-tRNA hydrolase | Translation, ribosomal structure and biogenesis [J] | 41.35 |
COG2200 | EAL domain, c-di-GMP-specific phosphodiesterase class I (or its enzymatically inactive variant) | Signal transduction mechanisms [T] | 18.27 |
COG3434 | c-di-GMP phosphodiesterase YuxH/PdeH, contains EAL and HDOD domains | Signal transduction mechanisms [T] | 18.27 |
COG4943 | Redox-sensing c-di-GMP phosphodiesterase, contains CSS-motif and EAL domains | Signal transduction mechanisms [T] | 18.27 |
COG5001 | Cyclic di-GMP metabolism protein, combines GGDEF and EAL domains with a 6TM membrane domain | Signal transduction mechanisms [T] | 18.27 |
COG1680 | CubicO group peptidase, beta-lactamase class C family | Defense mechanisms [V] | 2.88 |
COG1686 | D-alanyl-D-alanine carboxypeptidase | Cell wall/membrane/envelope biogenesis [M] | 2.88 |
COG2367 | Beta-lactamase class A | Defense mechanisms [V] | 2.88 |
COG0654 | 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases | Energy production and conversion [C] | 1.92 |
COG0075 | Archaeal aspartate aminotransferase or a related aminotransferase, includes purine catabolism protein PucG | Amino acid transport and metabolism [E] | 0.96 |
COG0156 | 7-keto-8-aminopelargonate synthetase or related enzyme | Coenzyme transport and metabolism [H] | 0.96 |
COG0399 | dTDP-4-amino-4,6-dideoxygalactose transaminase | Cell wall/membrane/envelope biogenesis [M] | 0.96 |
COG0436 | Aspartate/methionine/tyrosine aminotransferase | Amino acid transport and metabolism [E] | 0.96 |
COG0520 | Selenocysteine lyase/Cysteine desulfurase | Amino acid transport and metabolism [E] | 0.96 |
COG0578 | Glycerol-3-phosphate dehydrogenase | Energy production and conversion [C] | 0.96 |
COG0626 | Cystathionine beta-lyase/cystathionine gamma-synthase | Amino acid transport and metabolism [E] | 0.96 |
COG0644 | Dehydrogenase (flavoprotein) | Energy production and conversion [C] | 0.96 |
COG0665 | Glycine/D-amino acid oxidase (deaminating) | Amino acid transport and metabolism [E] | 0.96 |
COG0792 | Predicted endonuclease distantly related to archaeal Holliday junction resolvase, YraN/UPF0102 family | Replication, recombination and repair [L] | 0.96 |
COG1921 | Seryl-tRNA(Sec) selenium transferase | Translation, ribosomal structure and biogenesis [J] | 0.96 |
COG1982 | Arginine/lysine/ornithine decarboxylase | Amino acid transport and metabolism [E] | 0.96 |
COG2008 | Threonine aldolase | Amino acid transport and metabolism [E] | 0.96 |
COG2873 | O-acetylhomoserine/O-acetylserine sulfhydrylase, pyridoxal phosphate-dependent | Amino acid transport and metabolism [E] | 0.96 |
COG4100 | Cystathionine beta-lyase family protein involved in aluminum resistance | Inorganic ion transport and metabolism [P] | 0.96 |
COG0030 | 16S rRNA A1518 and A1519 N6-dimethyltransferase RsmA/KsgA/DIM1 (may also have DNA glycosylase/AP lyase activity) | Translation, ribosomal structure and biogenesis [J] | 0.96 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 91.35 % |
Unclassified | root | N/A | 8.65 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2088090009|LWAnN_F624WLL02GOFYN | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 509 | Open in IMG/M |
3300000364|INPhiseqgaiiFebDRAFT_105371599 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 560 | Open in IMG/M |
3300000858|JGI10213J12805_10501858 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 529 | Open in IMG/M |
3300000890|JGI11643J12802_11985619 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1016 | Open in IMG/M |
3300000955|JGI1027J12803_101083537 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 521 | Open in IMG/M |
3300000956|JGI10216J12902_102339354 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 3257 | Open in IMG/M |
3300002120|C687J26616_10038756 | All Organisms → cellular organisms → Bacteria | 1711 | Open in IMG/M |
3300002120|C687J26616_10103443 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 916 | Open in IMG/M |
3300004114|Ga0062593_102334153 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 602 | Open in IMG/M |
3300004153|Ga0063455_100146335 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1076 | Open in IMG/M |
3300004157|Ga0062590_100870378 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 839 | Open in IMG/M |
3300004157|Ga0062590_102274784 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 569 | Open in IMG/M |
3300004480|Ga0062592_101384775 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 669 | Open in IMG/M |
3300005343|Ga0070687_100718404 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 700 | Open in IMG/M |
3300005354|Ga0070675_100687236 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 931 | Open in IMG/M |
3300005444|Ga0070694_101689265 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 538 | Open in IMG/M |
3300005455|Ga0070663_101700741 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 564 | Open in IMG/M |
3300005466|Ga0070685_10919647 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 652 | Open in IMG/M |
3300005543|Ga0070672_100804117 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 827 | Open in IMG/M |
3300005546|Ga0070696_101850231 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 522 | Open in IMG/M |
3300005548|Ga0070665_101254080 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 752 | Open in IMG/M |
3300005598|Ga0066706_11233908 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 567 | Open in IMG/M |
3300006034|Ga0066656_10920298 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 560 | Open in IMG/M |
3300006358|Ga0068871_101561710 | Not Available | 624 | Open in IMG/M |
3300006580|Ga0074049_13171067 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 874 | Open in IMG/M |
3300006581|Ga0074048_13231981 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 808 | Open in IMG/M |
3300006918|Ga0079216_11024704 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 641 | Open in IMG/M |
3300007004|Ga0079218_11827387 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 682 | Open in IMG/M |
3300009098|Ga0105245_12216837 | Not Available | 603 | Open in IMG/M |
3300009156|Ga0111538_11464049 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 861 | Open in IMG/M |
3300009157|Ga0105092_10869060 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 531 | Open in IMG/M |
3300009777|Ga0105164_10656137 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 517 | Open in IMG/M |
3300009836|Ga0105068_1071384 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 649 | Open in IMG/M |
3300010039|Ga0126309_10336281 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 884 | Open in IMG/M |
3300010399|Ga0134127_11598378 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 726 | Open in IMG/M |
3300010938|Ga0137716_10315374 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 817 | Open in IMG/M |
3300011440|Ga0137433_1171876 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 703 | Open in IMG/M |
3300012198|Ga0137364_10592703 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 835 | Open in IMG/M |
3300012198|Ga0137364_11430310 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 511 | Open in IMG/M |
3300012939|Ga0162650_100051651 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 674 | Open in IMG/M |
3300014324|Ga0075352_1126194 | Not Available | 697 | Open in IMG/M |
3300014876|Ga0180064_1082585 | Not Available | 670 | Open in IMG/M |
3300015372|Ga0132256_100288394 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1722 | Open in IMG/M |
3300015372|Ga0132256_100991309 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 956 | Open in IMG/M |
3300015373|Ga0132257_101698804 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 809 | Open in IMG/M |
3300017789|Ga0136617_10222002 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1584 | Open in IMG/M |
3300017997|Ga0184610_1014912 | All Organisms → cellular organisms → Bacteria | 2017 | Open in IMG/M |
3300018029|Ga0187787_10056842 | All Organisms → cellular organisms → Bacteria | 1169 | Open in IMG/M |
3300018032|Ga0187788_10481524 | Not Available | 534 | Open in IMG/M |
3300018073|Ga0184624_10445104 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 569 | Open in IMG/M |
3300018081|Ga0184625_10042178 | All Organisms → cellular organisms → Bacteria | 2269 | Open in IMG/M |
3300018082|Ga0184639_10079621 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1720 | Open in IMG/M |
3300018469|Ga0190270_10286527 | All Organisms → cellular organisms → Bacteria | 1458 | Open in IMG/M |
3300020020|Ga0193738_1108966 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 784 | Open in IMG/M |
3300021344|Ga0193719_10364644 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 599 | Open in IMG/M |
3300021510|Ga0222621_1076921 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 704 | Open in IMG/M |
3300021972|Ga0193737_1026347 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 825 | Open in IMG/M |
3300022554|Ga0212093_1012847 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 7546 | Open in IMG/M |
3300022694|Ga0222623_10095215 | All Organisms → cellular organisms → Bacteria | 1156 | Open in IMG/M |
3300022756|Ga0222622_10938280 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 635 | Open in IMG/M |
3300025001|Ga0209618_1044946 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 699 | Open in IMG/M |
3300025164|Ga0209521_10011464 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia | 6620 | Open in IMG/M |
3300025322|Ga0209641_10313366 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1151 | Open in IMG/M |
3300025322|Ga0209641_10847547 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 610 | Open in IMG/M |
3300025327|Ga0209751_11030762 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 620 | Open in IMG/M |
3300025904|Ga0207647_10186191 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1204 | Open in IMG/M |
3300025936|Ga0207670_10953750 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 720 | Open in IMG/M |
3300026095|Ga0207676_12599326 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 503 | Open in IMG/M |
3300027006|Ga0209896_1018082 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 787 | Open in IMG/M |
3300027650|Ga0256866_1078366 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 886 | Open in IMG/M |
(restricted) 3300027799|Ga0233416_10092628 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium | 1031 | Open in IMG/M |
3300027961|Ga0209853_1087650 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 805 | Open in IMG/M |
3300028587|Ga0247828_10308621 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 876 | Open in IMG/M |
3300028590|Ga0247823_11222312 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 563 | Open in IMG/M |
3300028592|Ga0247822_11189227 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 636 | Open in IMG/M |
3300028596|Ga0247821_10694652 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 663 | Open in IMG/M |
3300028597|Ga0247820_11075894 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 577 | Open in IMG/M |
3300028719|Ga0307301_10203292 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 643 | Open in IMG/M |
3300028771|Ga0307320_10176607 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 831 | Open in IMG/M |
3300028791|Ga0307290_10091108 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1111 | Open in IMG/M |
3300028791|Ga0307290_10160470 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 823 | Open in IMG/M |
3300028793|Ga0307299_10029240 | All Organisms → cellular organisms → Bacteria | 1997 | Open in IMG/M |
3300028796|Ga0307287_10147612 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 893 | Open in IMG/M |
3300028814|Ga0307302_10007064 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 5011 | Open in IMG/M |
3300028814|Ga0307302_10667798 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 517 | Open in IMG/M |
3300028824|Ga0307310_10394744 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 686 | Open in IMG/M |
3300029977|Ga0272449_1201153 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium | 571 | Open in IMG/M |
3300030006|Ga0299907_10212533 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1594 | Open in IMG/M |
3300031226|Ga0307497_10192879 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 877 | Open in IMG/M |
3300031228|Ga0299914_10436156 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1139 | Open in IMG/M |
3300031548|Ga0307408_101706692 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 600 | Open in IMG/M |
3300031820|Ga0307473_11430767 | Not Available | 522 | Open in IMG/M |
3300031854|Ga0310904_10047878 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2115 | Open in IMG/M |
3300031997|Ga0315278_10467257 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1300 | Open in IMG/M |
3300032012|Ga0310902_10979165 | Not Available | 586 | Open in IMG/M |
3300032053|Ga0315284_10000732 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 45247 | Open in IMG/M |
3300032126|Ga0307415_100720806 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 902 | Open in IMG/M |
3300032516|Ga0315273_11824934 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 730 | Open in IMG/M |
3300033551|Ga0247830_11713474 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 504 | Open in IMG/M |
3300034090|Ga0326723_0227955 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 828 | Open in IMG/M |
3300034151|Ga0364935_0083962 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 964 | Open in IMG/M |
3300034819|Ga0373958_0079009 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 742 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 16.35% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 7.69% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 7.69% |
Soil | Environmental → Terrestrial → Soil → Loam → Unclassified → Soil | 4.81% |
Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 3.85% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 3.85% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.85% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 3.85% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 2.88% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 2.88% |
Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 2.88% |
Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 1.92% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 1.92% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.92% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.92% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.92% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 1.92% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 1.92% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 1.92% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 0.96% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Sediment | 0.96% |
Wastewater | Environmental → Aquatic → Freshwater → Drinking Water → Unchlorinated → Wastewater | 0.96% |
Polar Desert Sand | Environmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand | 0.96% |
Sediment | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Sediment → Sediment | 0.96% |
Hot Spring Fe-Si Sediment | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Neutral → Hot Spring Fe-Si Sediment | 0.96% |
Hot Spring Sediment | Environmental → Aquatic → Thermal Springs → Sediment → Unclassified → Hot Spring Sediment | 0.96% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.96% |
Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 0.96% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.96% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil | 0.96% |
Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 0.96% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.96% |
Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.96% |
Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 0.96% |
Soil | Environmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil | 0.96% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.96% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.96% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.96% |
Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.96% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.96% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.96% |
Rhizosphere Soil | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere Soil | 0.96% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.96% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.96% |
Visualization |
---|
Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2088090009 | Freshwater sediment microbial communities from Lake Washington, Seattle, for methane and nitrogen Cycles - SIP 13C-methane anaerobic+nitrate | Environmental | Open in IMG/M |
3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
3300000858 | Soil microbial communities from Great Prairies - Wisconsin Native Prairie soil | Environmental | Open in IMG/M |
3300000890 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
3300002120 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 13_2 | Environmental | Open in IMG/M |
3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
3300004153 | Grasslands soil microbial communities from Hopland, California, USA (version 2) | Environmental | Open in IMG/M |
3300004157 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2 | Environmental | Open in IMG/M |
3300004480 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4 | Environmental | Open in IMG/M |
3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Environmental | Open in IMG/M |
3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Host-Associated | Open in IMG/M |
3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Environmental | Open in IMG/M |
3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Host-Associated | Open in IMG/M |
3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Environmental | Open in IMG/M |
3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Host-Associated | Open in IMG/M |
3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Host-Associated | Open in IMG/M |
3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
3300006034 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105 | Environmental | Open in IMG/M |
3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Host-Associated | Open in IMG/M |
3300006580 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLPC (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300006581 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLPB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300006918 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS100 | Environmental | Open in IMG/M |
3300007004 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost | Environmental | Open in IMG/M |
3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
3300009157 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm March2015 | Environmental | Open in IMG/M |
3300009777 | Wastewater microbial communities from Netherlands to study Microbial Dark Matter (Phase II) - VDW unchlorinated drinking water | Environmental | Open in IMG/M |
3300009836 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_10_20 | Environmental | Open in IMG/M |
3300010039 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot56 | Environmental | Open in IMG/M |
3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
3300010938 | Sediment microbial community from Chocolate Pots hot springs, Yellowstone National Park, Wyoming, USA. Combined Assembly of Gp0156111, Gp0156114, Gp0156117 | Environmental | Open in IMG/M |
3300011440 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT840_2 | Environmental | Open in IMG/M |
3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
3300012939 | Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t1i015 | Environmental | Open in IMG/M |
3300014324 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_TuleA_D1 | Environmental | Open in IMG/M |
3300014876 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT200_16_10D | Environmental | Open in IMG/M |
3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
3300017789 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ322 (21.06) | Environmental | Open in IMG/M |
3300017997 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_coex | Environmental | Open in IMG/M |
3300018029 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_BV01_MP06_20_MG | Environmental | Open in IMG/M |
3300018032 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_BV01_MP10_20_MG | Environmental | Open in IMG/M |
3300018073 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_b1 | Environmental | Open in IMG/M |
3300018081 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b1 | Environmental | Open in IMG/M |
3300018082 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b2 | Environmental | Open in IMG/M |
3300018469 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T | Environmental | Open in IMG/M |
3300020020 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2a1 | Environmental | Open in IMG/M |
3300021344 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2a2 | Environmental | Open in IMG/M |
3300021510 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_coex | Environmental | Open in IMG/M |
3300021972 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2m2 | Environmental | Open in IMG/M |
3300022554 | Dewar_combined assembly | Environmental | Open in IMG/M |
3300022694 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_coex | Environmental | Open in IMG/M |
3300022756 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1 | Environmental | Open in IMG/M |
3300025001 | Soil microbial communities from Rifle, Colorado, USA - sediment 13ft 3 (SPAdes) | Environmental | Open in IMG/M |
3300025164 | Soil microbial communities from Rifle, Colorado, USA - sediment 19ft 4 | Environmental | Open in IMG/M |
3300025322 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 16_1 (SPAdes) | Environmental | Open in IMG/M |
3300025327 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 13_1 (SPAdes) | Environmental | Open in IMG/M |
3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) | Environmental | Open in IMG/M |
3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026547 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 (SPAdes) | Environmental | Open in IMG/M |
3300027006 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S2_20_30 (SPAdes) | Environmental | Open in IMG/M |
3300027650 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT152D67 HiSeq | Environmental | Open in IMG/M |
3300027799 (restricted) | Sediment microbial communities from Lake Towuti, South Sulawesi, Indonesia - Sediment_Towuti_2014_0_MG | Environmental | Open in IMG/M |
3300027961 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_30_40 (SPAdes) | Environmental | Open in IMG/M |
3300028587 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day3 | Environmental | Open in IMG/M |
3300028590 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_PalmiticAcid_Day30 | Environmental | Open in IMG/M |
3300028592 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Cellulose_Day30 | Environmental | Open in IMG/M |
3300028596 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Glycerol_Day14 | Environmental | Open in IMG/M |
3300028597 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Glucose_Day14 | Environmental | Open in IMG/M |
3300028719 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_182 | Environmental | Open in IMG/M |
3300028771 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_369 | Environmental | Open in IMG/M |
3300028791 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_144 | Environmental | Open in IMG/M |
3300028793 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_159 | Environmental | Open in IMG/M |
3300028796 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_141 | Environmental | Open in IMG/M |
3300028814 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_183 | Environmental | Open in IMG/M |
3300028824 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_197 | Environmental | Open in IMG/M |
3300029977 | Hot spring sediment microbial communities from Yellowstone National Park, WY, United States - YNP-CB-024-1 | Environmental | Open in IMG/M |
3300030006 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT152D67 | Environmental | Open in IMG/M |
3300031226 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 10_S | Environmental | Open in IMG/M |
3300031228 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT153D57 | Environmental | Open in IMG/M |
3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Host-Associated | Open in IMG/M |
3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
3300031854 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D1 | Environmental | Open in IMG/M |
3300031965 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT100D185 | Environmental | Open in IMG/M |
3300031997 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G06_0 | Environmental | Open in IMG/M |
3300032012 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D3 | Environmental | Open in IMG/M |
3300032053 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_16 | Environmental | Open in IMG/M |
3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Host-Associated | Open in IMG/M |
3300032516 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_0 | Environmental | Open in IMG/M |
3300033551 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day5 | Environmental | Open in IMG/M |
3300034090 | Peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF00N | Environmental | Open in IMG/M |
3300034151 | Sediment microbial communities from East River floodplain, Colorado, United States - 2_s17 | Environmental | Open in IMG/M |
3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Host-Associated | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Protein ID | Sample Taxon ID | Habitat | Sequence |
LWAnN_06869220 | 2088090009 | Freshwater Sediment | VSLEQGLDALIESEPFERLLLERARPIVAHADAGADAVVAGLARALDT |
INPhiseqgaiiFebDRAFT_1053715991 | 3300000364 | Soil | VSLEQALDALIGSEAFERLLLDRARPVVARAEAGEDALVA |
JGI10213J12805_105018581 | 3300000858 | Soil | VSLEQALEALIGSEAFERLLLERARPVVARADAGEDALVAALARALGAPVLL |
JGI11643J12802_119856191 | 3300000890 | Soil | VSLDQALDALIGSEAFERLLLERARPLVARADAGEDALVAALARSLGAPVLLVAPGPH |
JGI1027J12803_1010835371 | 3300000955 | Soil | VSLEQALDALIGSEAFERLLLDRARPVVARAEAGEDALVAALARALGAPV |
JGI10216J12902_1023393544 | 3300000956 | Soil | MSLQEILGDLVASEPFERMLLERARPIVARAEAGQDFVIA |
C687J26616_100387563 | 3300002120 | Soil | MCVLELVLDEVVASEPFGRLLLERARPITARLDAGWELVVAALA |
C687J26616_101034432 | 3300002120 | Soil | VLERLLDVLVGSEAFESLLLERARPILARADAGEDYLVAALARA |
Ga0062593_1023341531 | 3300004114 | Soil | VSLREALEAFVASEPFERLLLARERPVEARLETGESFAIAG |
Ga0063455_1001463352 | 3300004153 | Soil | VLERLLDTLIGSDAFERLLTERARPIEARADAGEDAVVAALAKALDTTVMVVAPGRRE |
Ga0062590_1008703781 | 3300004157 | Soil | VSLEQALDALIGSEAFERLLLERARPLVARADAGEDALVAALARSLGAPVLLVTPGP |
Ga0062590_1022747842 | 3300004157 | Soil | VLSEPPGKGVETEQLLDAMISSPPFERLLLERARPVVAHAEAGHDFVVASLARGLDAPVL |
Ga0062592_1013847751 | 3300004480 | Soil | MTLREVLDTLVTSEPFERLLLERARPIVARAEAGQDFLLAGL |
Ga0070687_1007184041 | 3300005343 | Switchgrass Rhizosphere | VALEYLLDSLIGSDAFERLLTERARPILARADAGEDAVVAALARAL |
Ga0070675_1006872362 | 3300005354 | Miscanthus Rhizosphere | VSLEQALDALIGSEAFERLLLERARPLVARADAGEDALVAALARSLGAPVLL |
Ga0070694_1016892652 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | LGLEQALEALIASEPFERLLLERARPIEAHASAGQDAVIAGLARAMD |
Ga0070663_1017007411 | 3300005455 | Corn Rhizosphere | LGLEEALGALIASEPFERLLLERARPIEAHAEAGVDAVIAGLARA |
Ga0070685_109196471 | 3300005466 | Switchgrass Rhizosphere | VTLEYLLDTLIGSDAFERLLTERARPILARADAGEDAVVAALARALDSPVLVVAPG |
Ga0070672_1008041171 | 3300005543 | Miscanthus Rhizosphere | LGLEEALEALIASEPFEGLLLERARPIEAYAGAGQDAVIAG |
Ga0070696_1018502312 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | VGLEPLLEVLIASEPFEHLLLERARPVLARADAGEDFVIAGLARALDAPILAVTP |
Ga0070665_1012540802 | 3300005548 | Switchgrass Rhizosphere | MSLQEILGDLVASEPFERMLLERARPIVARAEAGQDFVIAGVATAL |
Ga0066706_112339082 | 3300005598 | Soil | MLEEILDALIGSEPFERLLASRDRPLVARAPAGADFVVA |
Ga0066656_109202981 | 3300006034 | Soil | VLEEVLDALISSESFERLLAPRERPLVARAPAGADFVVAA |
Ga0068871_1015617101 | 3300006358 | Miscanthus Rhizosphere | LGLEEALEALIASEPFEGLLLERARPIEAHAGAGQDAVIAG |
Ga0074049_131710671 | 3300006580 | Soil | VSLEQALDALIGSEAFERLLLERARPLVARADAGEDALVAA |
Ga0074048_132319811 | 3300006581 | Soil | VSLEQALEALIGSEAFERLLLERARPVVAHADAGEDALVAA |
Ga0079216_110247041 | 3300006918 | Agricultural Soil | VDLRDTIETLVASELFEQLLLARARPIVAHADTGEDFVVAGVATA |
Ga0079218_118273871 | 3300007004 | Agricultural Soil | MSLREVLQALVTSEPFERLLLERARPIVARADAGHDFLLA |
Ga0105245_122168371 | 3300009098 | Miscanthus Rhizosphere | LEEALEALIASEPFEGLLLERARPIEAHAGAGQDAVIAGLARAMDTSILA |
Ga0111538_114640492 | 3300009156 | Populus Rhizosphere | VSLEQALDALIGSEAFERLLLDRARPVVARADAGEDALVAALARSLG |
Ga0105092_108690602 | 3300009157 | Freshwater Sediment | VSLERALDALIGSEPFERLLLERARPILARAEAAEDFLVAAL |
Ga0105164_106561372 | 3300009777 | Wastewater | VLERLLDTLIASEPFERLLVERARPILARADAGQD |
Ga0105068_10713842 | 3300009836 | Groundwater Sand | VLEKALDALIGSEAFERLLLDRARPLLARADAGEDFLVAALARA |
Ga0126309_103362812 | 3300010039 | Serpentine Soil | VESILDALIASEPFERLLTDRAPSVVARADAGQDFVVAALARALDA |
Ga0134127_115983782 | 3300010399 | Terrestrial Soil | VSLQQALDALIGSEAFERLLLERARPLVARADAGEDALVAALARSLGAPVLLVTP |
Ga0137716_103153742 | 3300010938 | Hot Spring Fe-Si Sediment | VVLEELLDTLIGSEPFERLLLERARPIVARAEAGPDFVVAGLARALDSPV |
Ga0137433_11718762 | 3300011440 | Soil | LDEALDALIGSEAFERLLLDRARPLLARADAGEDFLVAAL |
Ga0137364_105927032 | 3300012198 | Vadose Zone Soil | VGLRGTLDALIESAAFERLLLERARPVLASAETAEDAVIAAVAVAL |
Ga0137364_114303101 | 3300012198 | Vadose Zone Soil | MLEEILDALIGSEPFERLLASRERPLVARAPAGADFVL |
Ga0162650_1000516511 | 3300012939 | Soil | MTLREVLDTLVISEPFERLLLERARPIVARADAGQDFLLAGV |
Ga0075352_11261942 | 3300014324 | Natural And Restored Wetlands | VSVEQALEALIASEPFERLLVERARPVTAHADAGVE |
Ga0180064_10825852 | 3300014876 | Soil | VVVLDEALDALIGSEAFERLLLERARPLLARADAGEDFLVA |
Ga0132256_1002883944 | 3300015372 | Arabidopsis Rhizosphere | MEGAVLLEAALDTLIGSEAFERMLLDRSRPVLARADAGQDFLVAALARAIDAP |
Ga0132256_1009913093 | 3300015372 | Arabidopsis Rhizosphere | VSLEQALDALIGSEAFERLLLERARPLVARADAGEDALVAALARSLGA |
Ga0132257_1016988041 | 3300015373 | Arabidopsis Rhizosphere | LEEALEALIASEPFEGLLLERARPIEAYAGAGQDAVIAGL |
Ga0136617_102220021 | 3300017789 | Polar Desert Sand | MGLGDTLDVLVRSEPFERLLLERARPIVAHADAGEDFVVAGV |
Ga0184610_10149121 | 3300017997 | Groundwater Sediment | VLEKALDALIGSEAFERLLLERARPLLARADAGEDFLVAALARALGAPVLV |
Ga0187787_100568422 | 3300018029 | Tropical Peatland | VSLEQVLEALVTSEPFERLLLERARPILARADAGEDAVVAGLA |
Ga0187788_104815241 | 3300018032 | Tropical Peatland | VSLEQVLEALIASEPFERLLLERACPILARADAGEDAVV |
Ga0184624_104451041 | 3300018073 | Groundwater Sediment | VSLEQALDALIGSEAFERLLLERARPLLARADAGEDALVAALARSLGAPVLLVAP |
Ga0184625_100421783 | 3300018081 | Groundwater Sediment | VLEKALDALIGSEAFERLLLERARPLLARADAGEDFLVAALARALG |
Ga0184639_100796211 | 3300018082 | Groundwater Sediment | VTLDRLLDDLVRSEPFERLLLERARPVLARAAAGGDFVVAALAQALDAPILAV |
Ga0190270_102865273 | 3300018469 | Soil | LALREALDVLVRSEPFERLLLERARPIVARAEAGEDFVVAGVAT |
Ga0193738_11089662 | 3300020020 | Soil | VLEKALDALIGSEAFEHLLLERARPLLARADAGEDFLVAALARALGAPVLVVAPGP |
Ga0193719_103646442 | 3300021344 | Soil | VSLDLALDALLNSEPFERLLLERARPILAHTDAGEDALIAGLARAL |
Ga0222621_10769211 | 3300021510 | Groundwater Sediment | VSLDQALDALIGSEAFERLLLDRARPVVARAEAGEDALVAALARAL |
Ga0193737_10263471 | 3300021972 | Soil | MLDKALDALIGSEAFERLLLDRARPLVARADAGEDFLVAALARALGAPVLVI |
Ga0212093_10128471 | 3300022554 | Hot Spring Sediment | MLGDVLDAVIGSEPFERLLLSRARPIVARAAAGHDLVAA |
Ga0222623_100952153 | 3300022694 | Groundwater Sediment | VSLEQALDALIGSEAFERLLLDRARPVVARAEAGEDAL |
Ga0222622_109382801 | 3300022756 | Groundwater Sediment | VLEKALDALIGSEAFERLLLDRARPLLARADAGEDFLVA |
Ga0209618_10449462 | 3300025001 | Soil | VLERLLDVLIGSEAFERLLLERARPILARADAGEDFLIAALARAL |
Ga0209521_100114641 | 3300025164 | Soil | MYVLELVLDEVVASEPFGRLLLERARPITARLDAGWELVVAALARALDAP |
Ga0209641_103133662 | 3300025322 | Soil | VLERLLDVLIGSEAFEGLLLERARPILARADAGEDFLVAALARALETPVLVV |
Ga0209641_108475472 | 3300025322 | Soil | VLSEGGAVSLVRALDALIGSEPFERLLLERARPIQARAEAGADFL |
Ga0209751_110307622 | 3300025327 | Soil | VLERLLDVLVDSEAFEGLLLERARPILARADAGEDFLVA |
Ga0207647_101861912 | 3300025904 | Corn Rhizosphere | VSLEQALDALIGSEAFERLLLERARPLVARADAGEDALVAAVQSAALA |
Ga0207670_109537501 | 3300025936 | Switchgrass Rhizosphere | LGLEEALEALIASEPFEGLLLERARPIEAYAGAGQDAVIAGLARAMDTSI |
Ga0207676_125993262 | 3300026095 | Switchgrass Rhizosphere | MSLQEILGDLVASEPFERMLLERARPIVARAEAGQDFVIAGVATALESPV |
Ga0209156_102935152 | 3300026547 | Soil | VGLRGTLDALIESAAFERLLLERARPVLASAETAEDAVIAAVAVALDSPVMAIAAGPREAES |
Ga0209896_10180821 | 3300027006 | Groundwater Sand | VSLEQALDALIGSEAFERLLLERARPVVARADAGEDALVAALARALGAPVLLVAP |
Ga0256866_10783661 | 3300027650 | Soil | VLERLLDTLIGSDAFERLLTERARPVLARADAGEDFVVAAL |
(restricted) Ga0233416_100926282 | 3300027799 | Sediment | VSLERALDALIGSEPFERLLLERTRPILAHLEAGED |
Ga0209853_10876502 | 3300027961 | Groundwater Sand | VSLEQALDALIGSEAFERLLLERARPLVARADAGEDALVAAL |
Ga0247828_103086212 | 3300028587 | Soil | LALRDALDVLVRSEPFERLLLDRARPIVARAEAGEDFVVAGVATALE |
Ga0247823_112223122 | 3300028590 | Soil | VSLEQALDALIGSEAFERLLLERARPLVARADAGE |
Ga0247822_111892271 | 3300028592 | Soil | VSLDQALDALIGSEAFERLLLDRARPVLARAEAGEDALVAALARALGAPVLLVAP |
Ga0247821_106946521 | 3300028596 | Soil | VSLEQALDALIGSEAFERLLLERARPVVAHADAGEDALVAALARALGAPR |
Ga0247820_110758941 | 3300028597 | Soil | VSLEQALDALIGSEAFERLLLERARPLLARADAGEDALVAALARSLGAPVLLVA |
Ga0307301_102032921 | 3300028719 | Soil | VSLEQALDALIGSEAFERLLLDRARPVVARAEAGEDA |
Ga0307320_101766071 | 3300028771 | Soil | MTLREVLDTLVISEPFERLLLERARPIVARADAGQDFLLAG |
Ga0307290_100911081 | 3300028791 | Soil | VSLEQALDALIGSEAFERLLLERARPLVARADAGEDALVAALARSLDAPVL |
Ga0307290_101604701 | 3300028791 | Soil | VSLEQALEALIGSEAFERLLLERARPVVAHADAGEDALVAALARALGAPVLLVAPGP |
Ga0307299_100292404 | 3300028793 | Soil | VSLEQALDALIGSEAFERLLLERARPLVARADAGEDAL |
Ga0307287_101476122 | 3300028796 | Soil | VSLEQALEALIGSEAFERLLLERARPVVAHADAGEDALVAALARALGAPVLLVAP |
Ga0307302_100070647 | 3300028814 | Soil | VSLEQALDALIGSEAFERLLLERARPLLARADAGEDALVAALARSL |
Ga0307302_106677981 | 3300028814 | Soil | MTLREVLDTLVISEPFERLLLERARPIVARADAGQDFL |
Ga0307310_103947442 | 3300028824 | Soil | VSLEPLLEVLIASEPFERLLLERVRPVLARADAGEDFVIAGLARALDAPI |
Ga0272449_12011532 | 3300029977 | Sediment | VSLERALDALVSSEPVERLLLERARPILARAEAGEDAL |
Ga0299907_102125332 | 3300030006 | Soil | MSLRDVLDVLVGSAPFERLLLERARPIVAKVDAGQDAV |
Ga0307497_101928791 | 3300031226 | Soil | LGLEEALEALIASEPFEGLLLERARPIEAHAGAGQDAVIAGLARAMDTSI |
Ga0299914_104361562 | 3300031228 | Soil | MPLTRVLDEVIGSQPFERLLLERARPVVAHTETGVDLVCAALAR |
Ga0307408_1017066922 | 3300031548 | Rhizosphere | VGLRDTLDVLIGSEPFERLLLERARPIVARAEAGEDFVVAAL |
Ga0307473_114307672 | 3300031820 | Hardwood Forest Soil | VQLREALETFVASEPFERLLLARERPVQAQAEAGEAFV |
Ga0310904_100478784 | 3300031854 | Soil | VSLEQALDALIGSEAFERHLLERARPLVARADAGEDAQVAAHAPSLGAP |
Ga0326597_100986801 | 3300031965 | Soil | MLERLLDTLIGSDAFERLLTERARPVLARADAAEDFVVSALARALDAPVMVVAAG |
Ga0315278_104672571 | 3300031997 | Sediment | MLERLLDTMIGSEPFERLLLERARPVVARAEAGRDFVLAALARALDSP |
Ga0310902_109791652 | 3300032012 | Soil | LGLEEALEALIASEPFERLLLERARPIEAHAGAGQDAVIA |
Ga0315284_1000073245 | 3300032053 | Sediment | MLERLLDTMIGSEPFERLLLERARPVVARAEAGRDFVLAALARALDSPI |
Ga0307415_1007208061 | 3300032126 | Rhizosphere | VSLEQALDALIGSEAFEHLLLGRARPLVAHADAGED |
Ga0315273_118249343 | 3300032516 | Sediment | VSLEGALDALVASEPFERLLLERARPILAHAEAGQDALLAGLARA |
Ga0247830_117134741 | 3300033551 | Soil | MSLQEILGDLVASEPFERMLLERARPILARAEAAQDFVIAGVATALESSV |
Ga0326723_0227955_3_116 | 3300034090 | Peat Soil | VSLEQALETLVASEPFERLLLERARPILARTEAGEDAV |
Ga0364935_0083962_1_117 | 3300034151 | Sediment | VLEKALDSLIGSEAFERLLLDRARPLLARADAGEDFLVA |
Ga0373958_0079009_2_154 | 3300034819 | Rhizosphere Soil | VSLEQALDALIGSEAFERLLLERARPLVARADAGEDALVAALARSLGAPVL |
⦗Top⦘ |