NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F097306

Metagenome / Metatranscriptome Family F097306

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F097306
Family Type Metagenome / Metatranscriptome
Number of Sequences 104
Average Sequence Length 47 residues
Representative Sequence YLTGTPPEIVDKLRARMAIGVEYLILHTLEPSTAQLDLWAEHVLPHLGL
Number of Associated Samples 92
Number of Associated Scaffolds 104

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.00 %
% of genes near scaffold ends (potentially truncated) 100.00 %
% of genes from short scaffolds (< 2000 bps) 95.19 %
Associated GOLD sequencing projects 88
AlphaFold2 3D model prediction Yes
3D model pTM-score0.52

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (88.462 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(36.538 % of family members)
Environment Ontology (ENVO) Unclassified
(46.154 % of family members)
Earth Microbiome Project Ontology (EMPO) Unclassified
(38.462 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 48.05%    β-sheet: 0.00%    Coil/Unstructured: 51.95%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.52
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 104 Family Scaffolds
PF02056Glyco_hydro_4 57.69
PF11975Glyco_hydro_4C 38.46
PF02633Creatininase 0.96
PF13416SBP_bac_8 0.96
PF02446Glyco_hydro_77 0.96
PF00528BPD_transp_1 0.96

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 104 Family Scaffolds
COG1486Alpha-galactosidase/6-phospho-beta-glucosidase, family 4 of glycosyl hydrolaseCarbohydrate transport and metabolism [G] 57.69
COG1402Creatinine amidohydrolase/Fe(II)-dependent FAPy formamide hydrolase (riboflavin and F420 biosynthesis)Coenzyme transport and metabolism [H] 0.96
COG16404-alpha-glucanotransferaseCarbohydrate transport and metabolism [G] 0.96


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms88.46 %
UnclassifiedrootN/A11.54 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300005335|Ga0070666_11089178All Organisms → cellular organisms → Bacteria → Terrabacteria group594Open in IMG/M
3300005363|Ga0008090_15238721All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria561Open in IMG/M
3300005434|Ga0070709_11011713All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria661Open in IMG/M
3300005435|Ga0070714_101162631All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria752Open in IMG/M
3300005445|Ga0070708_101267448All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria689Open in IMG/M
3300005471|Ga0070698_100529734All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1117Open in IMG/M
3300005518|Ga0070699_101175760All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria704Open in IMG/M
3300005539|Ga0068853_101641547All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria623Open in IMG/M
3300005547|Ga0070693_100294935All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1091Open in IMG/M
3300005713|Ga0066905_100122453All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales1818Open in IMG/M
3300005713|Ga0066905_100274676Not Available1309Open in IMG/M
3300005764|Ga0066903_102992848All Organisms → cellular organisms → Bacteria → Terrabacteria group916Open in IMG/M
3300005937|Ga0081455_10888493Not Available555Open in IMG/M
3300006028|Ga0070717_10159244All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1958Open in IMG/M
3300006572|Ga0074051_10013299All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria851Open in IMG/M
3300006573|Ga0074055_11839017All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1026Open in IMG/M
3300006603|Ga0074064_11587688All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria526Open in IMG/M
3300006806|Ga0079220_10423439All Organisms → cellular organisms → Bacteria → Terrabacteria group879Open in IMG/M
3300006903|Ga0075426_10171617Not Available1568Open in IMG/M
3300006904|Ga0075424_100262826All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1835Open in IMG/M
3300010046|Ga0126384_12173013All Organisms → cellular organisms → Bacteria534Open in IMG/M
3300010322|Ga0134084_10356934All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria559Open in IMG/M
3300010360|Ga0126372_11811557All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria654Open in IMG/M
3300010366|Ga0126379_10412652Not Available1401Open in IMG/M
3300010375|Ga0105239_10619452All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1235Open in IMG/M
3300010376|Ga0126381_102101387All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria813Open in IMG/M
3300012207|Ga0137381_11499743All Organisms → cellular organisms → Bacteria → Terrabacteria group566Open in IMG/M
3300012354|Ga0137366_10215786Not Available1429Open in IMG/M
3300012355|Ga0137369_10585056All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria778Open in IMG/M
3300012960|Ga0164301_10187319Not Available1306Open in IMG/M
3300012961|Ga0164302_11776554All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria520Open in IMG/M
3300012984|Ga0164309_10230691Not Available1293Open in IMG/M
3300013104|Ga0157370_10219759All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales1760Open in IMG/M
3300014968|Ga0157379_11232066All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria721Open in IMG/M
3300016270|Ga0182036_10981024All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria696Open in IMG/M
3300016294|Ga0182041_10265268Not Available1406Open in IMG/M
3300016319|Ga0182033_11763091All Organisms → cellular organisms → Bacteria561Open in IMG/M
3300016357|Ga0182032_10965064All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria727Open in IMG/M
3300016357|Ga0182032_11431582All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria599Open in IMG/M
3300016404|Ga0182037_10855328All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria787Open in IMG/M
3300016422|Ga0182039_10543969All Organisms → cellular organisms → Bacteria → Terrabacteria group1008Open in IMG/M
3300016445|Ga0182038_11987756All Organisms → cellular organisms → Bacteria526Open in IMG/M
3300017947|Ga0187785_10454876All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria628Open in IMG/M
3300017966|Ga0187776_11029186All Organisms → cellular organisms → Bacteria607Open in IMG/M
3300017973|Ga0187780_10958052All Organisms → cellular organisms → Bacteria → Terrabacteria group623Open in IMG/M
3300018060|Ga0187765_10016790All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia3413Open in IMG/M
3300021407|Ga0210383_10379314All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1219Open in IMG/M
3300021478|Ga0210402_10078296All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura2936Open in IMG/M
3300021560|Ga0126371_13066829All Organisms → cellular organisms → Bacteria565Open in IMG/M
3300025903|Ga0207680_11003833All Organisms → cellular organisms → Bacteria → Terrabacteria group598Open in IMG/M
3300025906|Ga0207699_11292388All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria540Open in IMG/M
3300025910|Ga0207684_11002556All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria699Open in IMG/M
3300025917|Ga0207660_11261402All Organisms → cellular organisms → Bacteria → Terrabacteria group601Open in IMG/M
3300025928|Ga0207700_10272469Not Available1453Open in IMG/M
3300025972|Ga0207668_11093881All Organisms → cellular organisms → Bacteria714Open in IMG/M
3300026023|Ga0207677_11171594All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria703Open in IMG/M
3300027855|Ga0209693_10203887All Organisms → cellular organisms → Bacteria → Terrabacteria group973Open in IMG/M
3300027882|Ga0209590_10472426All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria810Open in IMG/M
3300028768|Ga0307280_10075602All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1090Open in IMG/M
3300028819|Ga0307296_10079121All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura1752Open in IMG/M
3300031170|Ga0307498_10103103All Organisms → cellular organisms → Bacteria → Terrabacteria group881Open in IMG/M
3300031226|Ga0307497_10171997All Organisms → cellular organisms → Bacteria → Terrabacteria group917Open in IMG/M
3300031545|Ga0318541_10338314All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria840Open in IMG/M
3300031573|Ga0310915_10020857All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura3980Open in IMG/M
3300031573|Ga0310915_11234677All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria516Open in IMG/M
3300031640|Ga0318555_10600315All Organisms → cellular organisms → Bacteria596Open in IMG/M
3300031668|Ga0318542_10215129All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria972Open in IMG/M
3300031720|Ga0307469_11056573All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria761Open in IMG/M
3300031723|Ga0318493_10528289All Organisms → cellular organisms → Bacteria → Terrabacteria group654Open in IMG/M
3300031736|Ga0318501_10414120All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria729Open in IMG/M
3300031736|Ga0318501_10579977Not Available615Open in IMG/M
3300031744|Ga0306918_10421091All Organisms → cellular organisms → Bacteria → Terrabacteria group1042Open in IMG/M
3300031744|Ga0306918_11498902All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria515Open in IMG/M
3300031747|Ga0318502_10455232All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria764Open in IMG/M
3300031763|Ga0318537_10183127All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria780Open in IMG/M
3300031763|Ga0318537_10386455All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria516Open in IMG/M
3300031764|Ga0318535_10109356All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1215Open in IMG/M
3300031768|Ga0318509_10296103All Organisms → cellular organisms → Bacteria → Terrabacteria group905Open in IMG/M
3300031770|Ga0318521_10712701All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria609Open in IMG/M
3300031777|Ga0318543_10433362Not Available589Open in IMG/M
3300031778|Ga0318498_10152419All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1052Open in IMG/M
3300031781|Ga0318547_10836828All Organisms → cellular organisms → Bacteria → Terrabacteria group574Open in IMG/M
3300031781|Ga0318547_10856234All Organisms → cellular organisms → Bacteria567Open in IMG/M
3300031781|Ga0318547_10968337All Organisms → cellular organisms → Bacteria → Terrabacteria group531Open in IMG/M
3300031782|Ga0318552_10017537All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura3118Open in IMG/M
3300031782|Ga0318552_10419495All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria682Open in IMG/M
3300031797|Ga0318550_10264983All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria834Open in IMG/M
3300031799|Ga0318565_10400349All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria665Open in IMG/M
3300031819|Ga0318568_10030006All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium3027Open in IMG/M
3300031833|Ga0310917_10755656All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria657Open in IMG/M
3300031896|Ga0318551_10061842All Organisms → cellular organisms → Bacteria1917Open in IMG/M
3300031945|Ga0310913_11131391All Organisms → cellular organisms → Bacteria546Open in IMG/M
3300031954|Ga0306926_11372028All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria821Open in IMG/M
3300031954|Ga0306926_12067001All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria638Open in IMG/M
3300031981|Ga0318531_10111669All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1209Open in IMG/M
3300031981|Ga0318531_10364828All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria653Open in IMG/M
3300031981|Ga0318531_10443958All Organisms → cellular organisms → Bacteria587Open in IMG/M
3300032009|Ga0318563_10664170All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria560Open in IMG/M
3300032035|Ga0310911_10890744All Organisms → cellular organisms → Bacteria → Terrabacteria group513Open in IMG/M
3300032041|Ga0318549_10576409All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria505Open in IMG/M
3300032043|Ga0318556_10261823All Organisms → cellular organisms → Bacteria → Terrabacteria group903Open in IMG/M
3300032054|Ga0318570_10481052All Organisms → cellular organisms → Bacteria566Open in IMG/M
3300032066|Ga0318514_10639874All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria566Open in IMG/M
3300032805|Ga0335078_10668987Not Available1294Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil36.54%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil11.54%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere8.65%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil6.73%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil4.81%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil3.85%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland3.85%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil2.88%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil2.88%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere2.88%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere1.92%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil0.96%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil0.96%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil0.96%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil0.96%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil0.96%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere0.96%
Agricultural SoilEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil0.96%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere0.96%
Tabebuia Heterophylla RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere0.96%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere0.96%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.96%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.96%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.96%
Tropical Rainforest SoilEnvironmental → Terrestrial → Soil → Unclassified → Tropical Rainforest → Tropical Rainforest Soil0.96%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300005335Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaGHost-AssociatedOpen in IMG/M
3300005363Tropical rainforest soil microbial communities from the Amazon Forest, Brazil, analyzing deforestation - Metatranscriptome F II A100 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300005434Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaGEnvironmentalOpen in IMG/M
3300005435Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaGEnvironmentalOpen in IMG/M
3300005445Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaGEnvironmentalOpen in IMG/M
3300005471Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaGEnvironmentalOpen in IMG/M
3300005518Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaGEnvironmentalOpen in IMG/M
3300005539Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2Host-AssociatedOpen in IMG/M
3300005547Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaGEnvironmentalOpen in IMG/M
3300005713Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2)EnvironmentalOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300005937Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1Host-AssociatedOpen in IMG/M
3300006028Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaGEnvironmentalOpen in IMG/M
3300006572Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHPB (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006573Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLAC (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006603Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMC (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006806Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100EnvironmentalOpen in IMG/M
3300006903Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5Host-AssociatedOpen in IMG/M
3300006904Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3Host-AssociatedOpen in IMG/M
3300010046Tropical forest soil microbial communities from Panama - MetaG Plot_36EnvironmentalOpen in IMG/M
3300010322Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300010360Tropical forest soil microbial communities from Panama - MetaG Plot_6EnvironmentalOpen in IMG/M
3300010366Tropical forest soil microbial communities from Panama - MetaG Plot_24EnvironmentalOpen in IMG/M
3300010375Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaGHost-AssociatedOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300012207Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaGEnvironmentalOpen in IMG/M
3300012354Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaGEnvironmentalOpen in IMG/M
3300012355Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaGEnvironmentalOpen in IMG/M
3300012960Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MGEnvironmentalOpen in IMG/M
3300012961Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MGEnvironmentalOpen in IMG/M
3300012984Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MGEnvironmentalOpen in IMG/M
3300013104Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaGHost-AssociatedOpen in IMG/M
3300014968Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaGHost-AssociatedOpen in IMG/M
3300016270Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080EnvironmentalOpen in IMG/M
3300016294Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178EnvironmentalOpen in IMG/M
3300016319Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00HEnvironmentalOpen in IMG/M
3300016357Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000EnvironmentalOpen in IMG/M
3300016404Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082EnvironmentalOpen in IMG/M
3300016422Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111EnvironmentalOpen in IMG/M
3300016445Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108EnvironmentalOpen in IMG/M
3300017947Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_4_20_MGEnvironmentalOpen in IMG/M
3300017966Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MGEnvironmentalOpen in IMG/M
3300017973Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MGEnvironmentalOpen in IMG/M
3300018060Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MGEnvironmentalOpen in IMG/M
3300021407Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-OEnvironmentalOpen in IMG/M
3300021478Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-MEnvironmentalOpen in IMG/M
3300021560Tropical forest soil microbial communities from Panama - MetaG Plot_4EnvironmentalOpen in IMG/M
3300025903Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025906Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025910Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025917Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025928Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025972Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026023Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300027855Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 (SPAdes)EnvironmentalOpen in IMG/M
3300027882Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300028768Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_119EnvironmentalOpen in IMG/M
3300028819Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_153EnvironmentalOpen in IMG/M
3300031170Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 12_SEnvironmentalOpen in IMG/M
3300031226Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 10_SEnvironmentalOpen in IMG/M
3300031545Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26EnvironmentalOpen in IMG/M
3300031573Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111EnvironmentalOpen in IMG/M
3300031640Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23EnvironmentalOpen in IMG/M
3300031668Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23EnvironmentalOpen in IMG/M
3300031720Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515EnvironmentalOpen in IMG/M
3300031723Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23EnvironmentalOpen in IMG/M
3300031736Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21EnvironmentalOpen in IMG/M
3300031744Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2)EnvironmentalOpen in IMG/M
3300031747Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22EnvironmentalOpen in IMG/M
3300031763Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f29EnvironmentalOpen in IMG/M
3300031764Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f27EnvironmentalOpen in IMG/M
3300031768Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22EnvironmentalOpen in IMG/M
3300031770Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17EnvironmentalOpen in IMG/M
3300031777Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f24EnvironmentalOpen in IMG/M
3300031778Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f24EnvironmentalOpen in IMG/M
3300031781Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20EnvironmentalOpen in IMG/M
3300031782Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f20EnvironmentalOpen in IMG/M
3300031797Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f23EnvironmentalOpen in IMG/M
3300031799Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f21EnvironmentalOpen in IMG/M
3300031819Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21EnvironmentalOpen in IMG/M
3300031833Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178EnvironmentalOpen in IMG/M
3300031896Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19EnvironmentalOpen in IMG/M
3300031945Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082EnvironmentalOpen in IMG/M
3300031954Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2)EnvironmentalOpen in IMG/M
3300031981Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f25EnvironmentalOpen in IMG/M
3300032009Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f19EnvironmentalOpen in IMG/M
3300032035Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170EnvironmentalOpen in IMG/M
3300032041Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f22EnvironmentalOpen in IMG/M
3300032043Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f24EnvironmentalOpen in IMG/M
3300032054Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f23EnvironmentalOpen in IMG/M
3300032066Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f18EnvironmentalOpen in IMG/M
3300032805Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
Ga0070666_1108917813300005335Switchgrass RhizosphereLTGTPPEIVDKLRARMATGIEYLILHTLEPSAAQLDLWAEHVLPHLEA*
Ga0008090_1523872123300005363Tropical Rainforest SoilPFEYFEQVYLTGTPAEIVEKLRARMAIGIEYLILHTLEPSTAQLDLWAEHVLPGLEV*
Ga0070709_1101171313300005434Corn, Switchgrass And Miscanthus RhizosphereEIVEKLQARMAIGVEYLILHTLEPSTAQLELWAEHVLPHLAA*
Ga0070714_10116263113300005435Agricultural SoilFEQVYLTGTPAEIVEKLRARMAIGVEYLILHTLEPSTAQLDLWAEHVLPHLHLGD*
Ga0070708_10126744813300005445Corn, Switchgrass And Miscanthus RhizosphereVYLTGTPSEILDKLRARVAIGIEYLILHTLQPSTAQLDLWAEHLLPHLGVS*
Ga0070698_10052973413300005471Corn, Switchgrass And Miscanthus RhizosphereGGRPFEYFEHVNLTGTPSEIVAKLRARIAIGIEYLILHTLQPSTVQLDLWAEHLLPHLDV
Ga0070699_10117576023300005518Corn, Switchgrass And Miscanthus RhizosphereEQVYLTGTPPEIVDKLRARMATGIEYLILHTLEPSAAQLDLWAEHVLPHLEA*
Ga0068853_10164154713300005539Corn RhizosphereGTPAEIVDKLRARIAIGIEYLILHTLQPSASQLDLWAEHVLPYLEL*
Ga0070693_10029493513300005547Corn, Switchgrass And Miscanthus RhizosphereYLTGTPPEIVDKLRARMATGIEYLILHTLEPSAAQLDLWAEHVLPHLET*
Ga0066905_10012245333300005713Tropical Forest SoilEIVEKLRARMAIGVDYLILHTLEPRAAQLDLWAEHVLPHLEV*
Ga0066905_10027467613300005713Tropical Forest SoilFEYFEQVYLTGTPSEIVDKLRARIAIGVEYLILHTLEPSPAQLDLWAEHVLPQLAA*
Ga0066903_10299284823300005764Tropical Forest SoilRMAIGVEYLILHTLEPSTAQLNLWAEHVLPKLAV*
Ga0081455_1088849313300005937Tabebuia Heterophylla RhizosphereIRARLATGVTHLMLHTLEPSVRQLELWAEQLLPGLVTV*
Ga0070717_1015924413300006028Corn, Switchgrass And Miscanthus RhizosphereFEYFEQVYLTGTPAEIVDKLRARIAIGIEYLILHTLQPSASQLDLWAEHVLPYLEL*
Ga0074051_1001329913300006572SoilEYFEQVYLTGTPSEIVEKLRARIAIGVEYLILHTLQPSTAQLDLWAEHVLPHLEV*
Ga0074055_1183901723300006573SoilIVEKLRARIAIGVEYLILHTLQPSTAQLDLWAEHVLPHLEV*
Ga0074064_1158768823300006603SoilVEKLRARAAVGIEYLILHTLEPSADQLDLWAEHVLPHLEA*
Ga0079220_1042343913300006806Agricultural SoilSEIVEKLRARVAIGVEYLMLHTLQPSPAQLDLWAEHVLPHLEV*
Ga0075426_1017161723300006903Populus RhizosphereRPFEYFEQVYMTGTPAEIVDKLRARIAIGIEYLILHTLEPSVSQLDLWAEHVLPYLEL*
Ga0075424_10026282633300006904Populus RhizosphereGGGRPFEYFEQVYLTGTPSEVVEKLQARIAIGVEYLILHTLHPSAAQLDLWAEHVLPHLEL*
Ga0126384_1217301323300010046Tropical Forest SoilVEKLRARMAIGVEYLILHTLEPQVAQLDLWAEHVLPRLAA*
Ga0134084_1035693423300010322Grasslands SoilPFEYFEQVYLTGTLSEIVGKLRARRAIGIEYLILHTLQPSTEQLDLWAKHLLPHLEVW*
Ga0126372_1181155723300010360Tropical Forest SoilYLTGTPSEIVEKLRARIAIGVEYLILHTLQPSAAQLDLWAEHVLPHLEA*
Ga0126379_1041265213300010366Tropical Forest SoilLQARIAIGVEYLILHTLQPSAAQLDLWAEYVLPHLEA*
Ga0105239_1061945213300010375Corn RhizosphereEILEKLRARMAIGIEYLILHTLEPSTAQLDLWAEHLLPHLAV*
Ga0126381_10210138723300010376Tropical Forest SoilGDGRPFEYFEQVYLTGTPAEIVEKLRARIAIGVEYLILHTLQPSAAQLDLWAEHVLPCLEA*
Ga0137381_1149974313300012207Vadose Zone SoilPFEYFEQVYLTGTPAEIVDKLRARIAIGIEYLILHTLRPSTSQLDLWAEHVLPHLEI*
Ga0137366_1021578623300012354Vadose Zone SoilTGTPSEIVAKLRARMAIGVDYLILHTLEPSTAQLDLWAEHVLPHLGA*
Ga0137369_1058505613300012355Vadose Zone SoilARIAIGIEYLILHTLQPSTAQLELWAEHLLPHLEI*
Ga0164301_1018731913300012960SoilEIVDKLRARIDIGIEYLILHTLQPSASQLDLWAEHVLPYLEA*
Ga0164302_1177655413300012961SoilPSEIVEKLRARMATGIEYLILHTLEPSAAQLDLWAEHVLSHLEA*
Ga0164309_1023069123300012984SoilTGTPPEIVDKLRARMATGIEYLILHTLEPSAAQLDLWAEHVLPHLET*
Ga0157370_1021975933300013104Corn RhizosphereAEIVDKLRARIAIGIEYLILHTLQPSASQLDLWAEHVLPYLEL*
Ga0157379_1123206623300014968Switchgrass RhizosphereRMAIGVEYLILHTLEPSTAQLELWAEHVLPHLAA*
Ga0182036_1098102413300016270SoilEIVEKLRARMAIGVEYLILHTLQPSTAQLDLWAEHVLPHLEV
Ga0182041_1026526823300016294SoilLRARMAIGVEYLILHTLQPSTAQLDLWAEHVLPHLEV
Ga0182033_1176309123300016319SoilGRMAIGVEYLILHTLEPSTAQLNLWAEHVLPQLAV
Ga0182032_1096506413300016357SoilKLRARLAVGIEYLILHTLEPSTKQLDLWAEHGLPHLGL
Ga0182032_1143158213300016357SoilGRTFEYFEQVYLTGTPSEIVEKLRARMVMGVEYLILHTLEPSTAQLDLWAEHVLPHLEL
Ga0182037_1085532813300016404SoilTGTPSEIVDKLRARMAIGVEYLILHTLEPSVKQLDLWAEHVLPHLGL
Ga0182039_1054396923300016422SoilEQVYLTGTPSEIVDKLRARMAIGVEYLILHTLEPSTKQLDLWAEYGLPHLGL
Ga0182038_1198775613300016445SoilIVDKLRARLAVGIEYLILHTLEPSPAQLDLWAEHVLPHLEA
Ga0187785_1045487613300017947Tropical PeatlandKLRARLAIGVEYLILHTLEPSTAQLDLWAEHVLPHLGL
Ga0187776_1102918613300017966Tropical PeatlandTPSEIVEKLRARMAIGVEYLILHTLEPSPAQLDLWAEHVLPHLAA
Ga0187780_1095805213300017973Tropical PeatlandGTPPEIVEKIRARMAIGVEYLILHTLEPSPAQLDLWAQHVLPHLELR
Ga0187765_1001679013300018060Tropical PeatlandEIVEKIRARMAIGVEYLILHTLEPSTAQLDLWAQHVLPHLGL
Ga0210383_1037931423300021407SoilYLTGTPVEIVEKLQARMAIGVEYLILHTLEPSTAQLDLWAEHVLPHLAV
Ga0210402_1007829613300021478SoilAEIVEKLRARMAIGVEYLILHTLEPSTAQLDLWAEHVLPHLGV
Ga0126371_1306682923300021560Tropical Forest SoilGTPAEIVEKLRARIAIGVEYLILHTLQPSVAQLDLWAEHVLPQLEA
Ga0207680_1100383323300025903Switchgrass RhizosphereVYLTGTPAEIVDKLRARIAIGIEYLILHTLQPSASQLDLWAEHVLPYLEL
Ga0207699_1129238823300025906Corn, Switchgrass And Miscanthus RhizosphereEYFEQVYLTGTPAEIVDKLRARIDIGIEYLILHTLQPSASQLDLWAEHVLPYLEA
Ga0207684_1100255613300025910Corn, Switchgrass And Miscanthus RhizospherePSEILDKLRARVAIGIEYLILHTLQPSTAQLDLWAEHLLPHLGVS
Ga0207660_1126140213300025917Corn RhizosphereYFEQVYLTGTPPEIVDKLRARMATGIEYLILHTLEPSAAQLDLWAEHVLPHLEA
Ga0207700_1027246913300025928Corn, Switchgrass And Miscanthus RhizosphereYMTGTPAEIVDKLRARIAIGIEYLILHTLEPSVSQLDLWAEHVLPYLEL
Ga0207668_1109388123300025972Switchgrass RhizosphereKLRARMAIGIEYLILHTLEPSTAQLDLWAEHLLPHLAV
Ga0207677_1117159413300026023Miscanthus RhizosphereSRPFEYFEQVYLTGTPAEIVDKLRARIAIGIEYLILHTLQPSASQLDLWAEHVLPYLEL
Ga0209693_1020388713300027855SoilYFEQVYLTGTPSEIVEKLQARMAIGVEYLILHTLEPSTAQLDLWAEHVLPHLVA
Ga0209590_1047242613300027882Vadose Zone SoilARTAIGIEYLILHTLQPSTAQLELWAEHLLPHLEIW
Ga0307280_1007560223300028768SoilLEKLRARMAIGIEYLILHTLEPSTAQLDLWAEHLLPHLAV
Ga0307296_1007912133300028819SoilLTGTPSEIVEKLRARIAIGVEYLVLHTLQPSTAQLDLWAEHVLPHLAV
Ga0307498_1010310313300031170SoilFEQVYLTGTPSEVVDKLRARMAIGVEYLILHTLEPSTAQLDLWAEHVLPHLGD
Ga0307497_1017199713300031226SoilGTPSEVVDKLRARIAVGIEYLILHTLEPSAAQLDLWAEHVLPHLGD
Ga0318541_1033831423300031545SoilYLTGTPQEIVDKLRARMAIGVEYLILHTLEPSTAQLDLWAEHVLPHLVA
Ga0310915_1002085753300031573SoilTPSEIVEKLRARMAMGVGYLILHTLEPSTAQLDLWAEHVLPHLEL
Ga0310915_1123467713300031573SoilVEKLRARMAIGVEYLILHTLEPSTAQLDLWAEHILPDLEA
Ga0318555_1060031523300031640SoilVYLTGTPSQIVDKLRARMAIGVEYLILHTLEPSVKQLDLWAEHVLPHLGL
Ga0318542_1021512923300031668SoilGRPFEYFEQVYLTGTPSEIVEKLRARMAIGVEYLILHTLQPATAQLDLWAEHVLPHLEV
Ga0307469_1105657323300031720Hardwood Forest SoilYLTGTPAEIVDKLRARIAIGIEYLILHTLQPSASQLDLWAEHVLPYLEL
Ga0318493_1052828913300031723SoilYFEQVYLTGTPAEIVEKLRARMAIGVEYLILHTLEPSTAQLDLWAEHVLPHLEA
Ga0318501_1041412013300031736SoilVYLTGTPSEIVDKLRARMAIGVEYLILHTLEPSTKQLDLWAEHGLPHLGL
Ga0318501_1057997723300031736SoilTPQEILDKLRARMAIGVEYLILHTLEPSTAQLDLWAEHVLPHLVA
Ga0306918_1042109113300031744SoilGGGRPFEYFEQVYLTGTPAEIVDKLRARMAIGAEYLILHTLEPSTRQLDLWAEHVLPHLG
Ga0306918_1149890223300031744SoilYLTGTPPEIVDKLRARMAIGVEYLILHTLEPSTAQLDLWAEHVLPHLGL
Ga0318502_1045523213300031747SoilLRARLAIGAEYLILHTLEPSTRQLDLWAEHVLPHLGL
Ga0318537_1018312723300031763SoilVYLTGTPSEIVEKLRARMAIGVEYLILHTLQPSTAQLDLWAEHVLPHLEV
Ga0318537_1038645513300031763SoilEKLRARMAMGVEYLILHTLEPSTAQLDLWAEHVLPHLEL
Ga0318535_1010935623300031764SoilLTGTPSQIVDKLRARMAIGVEYLILHTLEPSVKQLDLWAEHVLPHLGL
Ga0318509_1029610323300031768SoilYLTGTPSQIVDKLRARMAIGVEYLILHTLEPSTKQLDLWAEYGLPHLGL
Ga0318521_1071270113300031770SoilEYFEQVYLTGTPSEIVEKLRARMAIGVEYLILHTLQPATAQLDLWAEHVLPHLEV
Ga0318543_1043336213300031777SoilVYLTGTPSEIVDKLRARMAIGVEYLILHTLEPSTKQLDLWAEYGLPHLGL
Ga0318498_1015241913300031778SoilSEIVDKLRARLAIGIEYLILHTLEPSPAQLDLWAEHVLPHLEA
Ga0318547_1083682823300031781SoilGRPFEYFEQVYLTGTPSEIVDKLRARMAIGVEYLILHTLEPSVKQLDLWAEHVLPHLGL
Ga0318547_1085623413300031781SoilYFEQVYLTGTPTEIVAKLRARMAIGVEYLILHTLEPSTAQLNLWAEHVLPQLAV
Ga0318547_1096833723300031781SoilVDKLRARLAIGIEYLILHTLEPSPAQLDLWAEHVLPHLEA
Ga0318552_1001753743300031782SoilGTPAEIVEKLRARMAIGVEYLILHTLEPSTAQLDLWAEHILPDLEA
Ga0318552_1041949513300031782SoilYFEQVYLTGTPSEIVEKLRARVAIGVEYLILHTLQPSTAQLDLWAEHVLPHLEV
Ga0318550_1026498313300031797SoilEIVEKLRARMAIGVEYLILHTLEPSTAQLDLWAEHILPDLEA
Ga0318565_1040034913300031799SoilVYLTGTPSEIVEQLRARMAIGVEYLILHTLQPSTAQLDLWAEHVLPHLEV
Ga0318568_1003000643300031819SoilLTGTPPEIVDKLRARMAIGVEYLILHTLEPSTAQLDLWAEHVLPHLVA
Ga0310917_1075565613300031833SoilVYLPGTPSEIVEKLRARMAIGVEYLILHTLQPSTAQLDLWAEHVLPHLEV
Ga0318551_1006184233300031896SoilKLRGRMAIGVEYLILHTLEPSTAQLNLWAEHVLPQLAV
Ga0310913_1113139113300031945SoilAEIVEKLRARMAIGVEYLILHTLEPSTAQLNLWAEHVLPQLAV
Ga0306926_1137202813300031954SoilEIVDKLRARMAIGVEYLILHTLEPSTAQLDLWAEHVLPHLVA
Ga0306926_1206700123300031954SoilRARMVMGVEYLILHTLEPSTAQLDLWAEHVLPHLEL
Ga0318531_1011166923300031981SoilEQVYLTGTPSEIVAKLQARMAIGVEYLILHTLQPSTAQLDLWAEHVLPHLGL
Ga0318531_1036482813300031981SoilVYLTGTPSEIVDKLRARLAIGIEYLILHTLEPSPAQLDLWAEHVLPHLEA
Ga0318531_1044395823300031981SoilVYLTGTPQEIVDKLRARMAIGVEYLILHTLEPSTAQLDLWAEHVLPHLVA
Ga0318563_1066417023300032009SoilPFEYFEQVYLTGTPSEIVEKLRARMAIGVEYLILHTLQPSTAQLDLWAEHVLPHLEV
Ga0310911_1089074413300032035SoilSEIVGKLRARMAIGVEYLILHTLQASTAQLDLWAEHVLPHLAA
Ga0318549_1057640913300032041SoilLTGTPSEIVDKLRARLAVGIEYLILHTLEPSPAQLDLWAEHVLPHLEA
Ga0318556_1026182313300032043SoilVDKLRARMAIGVEYLILHTLEPSVKQLDLWAEHVLPHLGL
Ga0318570_1048105213300032054SoilYLTGTPAEIVDKLRARMAIGAEYLILHTLEPSTRQLDLWAEHVLPHLGI
Ga0318514_1063987413300032066SoilPSEIVEKLRARMAIGVEYLILHTLQPATAQLDLWAEHVLPHLEV
Ga0335078_1066898723300032805SoilYFEQVYLTGTPPEIVDKLRARIATGIEYLILHTLEPGAAQLDLWAEHVLPQLGA


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.