Basic Information | |
---|---|
Family ID | F097091 |
Family Type | Metagenome |
Number of Sequences | 104 |
Average Sequence Length | 42 residues |
Representative Sequence | MFRDKASILMEAKSKRKPISATSVVGIGLVSVKQKKDKASL |
Number of Associated Samples | 92 |
Number of Associated Scaffolds | 104 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | No |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 35.29 % |
% of genes near scaffold ends (potentially truncated) | 36.54 % |
% of genes from short scaffolds (< 2000 bps) | 83.65 % |
Associated GOLD sequencing projects | 88 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.29 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (50.962 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil (17.308 % of family members) |
Environment Ontology (ENVO) | Unclassified (25.000 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (19.231 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 44.93% β-sheet: 0.00% Coil/Unstructured: 55.07% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.29 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 104 Family Scaffolds |
---|---|---|
PF00682 | HMGL-like | 42.31 |
PF00310 | GATase_2 | 11.54 |
PF04898 | Glu_syn_central | 5.77 |
PF00988 | CPSase_sm_chain | 2.88 |
PF00106 | adh_short | 1.92 |
PF01037 | AsnC_trans_reg | 1.92 |
PF02782 | FGGY_C | 0.96 |
PF00324 | AA_permease | 0.96 |
PF01041 | DegT_DnrJ_EryC1 | 0.96 |
PF00330 | Aconitase | 0.96 |
PF00797 | Acetyltransf_2 | 0.96 |
PF08443 | RimK | 0.96 |
PF13185 | GAF_2 | 0.96 |
PF06821 | Ser_hydrolase | 0.96 |
PF00160 | Pro_isomerase | 0.96 |
PF06983 | 3-dmu-9_3-mt | 0.96 |
PF00909 | Ammonium_transp | 0.96 |
COG ID | Name | Functional Category | % Frequency in 104 Family Scaffolds |
---|---|---|---|
COG0505 | Carbamoylphosphate synthase small subunit | Amino acid transport and metabolism [E] | 5.77 |
COG0004 | Ammonia channel protein AmtB | Inorganic ion transport and metabolism [P] | 0.96 |
COG0399 | dTDP-4-amino-4,6-dideoxygalactose transaminase | Cell wall/membrane/envelope biogenesis [M] | 0.96 |
COG0436 | Aspartate/methionine/tyrosine aminotransferase | Amino acid transport and metabolism [E] | 0.96 |
COG0520 | Selenocysteine lyase/Cysteine desulfurase | Amino acid transport and metabolism [E] | 0.96 |
COG0531 | Serine transporter YbeC, amino acid:H+ symporter family | Amino acid transport and metabolism [E] | 0.96 |
COG0626 | Cystathionine beta-lyase/cystathionine gamma-synthase | Amino acid transport and metabolism [E] | 0.96 |
COG0652 | Peptidyl-prolyl cis-trans isomerase (rotamase) - cyclophilin family | Posttranslational modification, protein turnover, chaperones [O] | 0.96 |
COG0833 | Amino acid permease | Amino acid transport and metabolism [E] | 0.96 |
COG1104 | Cysteine desulfurase/Cysteine sulfinate desulfinase IscS or related enzyme, NifS family | Amino acid transport and metabolism [E] | 0.96 |
COG1113 | L-asparagine transporter or related permease | Amino acid transport and metabolism [E] | 0.96 |
COG1115 | Na+/alanine symporter | Amino acid transport and metabolism [E] | 0.96 |
COG2162 | Arylamine N-acetyltransferase | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.96 |
COG2764 | Zn-dependent glyoxalase, PhnB family | Energy production and conversion [C] | 0.96 |
COG2873 | O-acetylhomoserine/O-acetylserine sulfhydrylase, pyridoxal phosphate-dependent | Amino acid transport and metabolism [E] | 0.96 |
COG3545 | Predicted esterase of the alpha/beta hydrolase fold | General function prediction only [R] | 0.96 |
COG3865 | Glyoxalase superfamily enzyme, possible 3-demethylubiquinone-9 3-methyltransferase | General function prediction only [R] | 0.96 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 77.88 % |
Unclassified | root | N/A | 22.12 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300000956|JGI10216J12902_100472447 | All Organisms → cellular organisms → Bacteria | 3973 | Open in IMG/M |
3300003203|JGI25406J46586_10136075 | All Organisms → cellular organisms → Archaea → DPANN group → Nanoarchaeota → unclassified Nanoarchaeota → Nanoarchaeota archaeon | 719 | Open in IMG/M |
3300003319|soilL2_10002940 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1125 | Open in IMG/M |
3300003432|JGI20214J51088_10798884 | Not Available | 612 | Open in IMG/M |
3300003432|JGI20214J51088_10830981 | Not Available | 601 | Open in IMG/M |
3300003541|JGI20214J51650_10405240 | Not Available | 952 | Open in IMG/M |
3300003541|JGI20214J51650_11163604 | All Organisms → cellular organisms → Bacteria | 536 | Open in IMG/M |
3300003998|Ga0055472_10133479 | All Organisms → cellular organisms → Archaea → DPANN group → Nanoarchaeota → unclassified Nanoarchaeota → Nanoarchaeota archaeon | 725 | Open in IMG/M |
3300004006|Ga0055453_10310653 | Not Available | 508 | Open in IMG/M |
3300004013|Ga0055465_10228866 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 620 | Open in IMG/M |
3300004019|Ga0055439_10216637 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 617 | Open in IMG/M |
3300004156|Ga0062589_100175541 | All Organisms → cellular organisms → Bacteria | 1510 | Open in IMG/M |
3300004480|Ga0062592_101192540 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 711 | Open in IMG/M |
3300004643|Ga0062591_102893605 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 509 | Open in IMG/M |
3300005204|Ga0068997_10104556 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 615 | Open in IMG/M |
3300005337|Ga0070682_101817651 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 532 | Open in IMG/M |
3300005518|Ga0070699_100002275 | All Organisms → cellular organisms → Bacteria | 17279 | Open in IMG/M |
3300005656|Ga0073902_10035370 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 2446 | Open in IMG/M |
3300005829|Ga0074479_10278055 | All Organisms → cellular organisms → Archaea → DPANN group → Nanoarchaeota → unclassified Nanoarchaeota → Nanoarchaeota archaeon | 734 | Open in IMG/M |
3300005829|Ga0074479_11039440 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae | 2876 | Open in IMG/M |
3300005831|Ga0074471_10822030 | All Organisms → cellular organisms → Archaea → DPANN group → Nanoarchaeota → unclassified Nanoarchaeota → Nanoarchaeota archaeon | 782 | Open in IMG/M |
3300005836|Ga0074470_11441591 | All Organisms → cellular organisms → Archaea → DPANN group → Nanoarchaeota → unclassified Nanoarchaeota → Nanoarchaeota archaeon | 642 | Open in IMG/M |
3300005836|Ga0074470_11717088 | All Organisms → cellular organisms → Archaea → DPANN group → Nanoarchaeota → unclassified Nanoarchaeota → Nanoarchaeota archaeon | 501 | Open in IMG/M |
3300005893|Ga0075278_1047373 | Not Available | 642 | Open in IMG/M |
3300005901|Ga0075274_1064799 | Not Available | 579 | Open in IMG/M |
3300005982|Ga0075156_10016989 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 4299 | Open in IMG/M |
3300006755|Ga0079222_10545620 | All Organisms → cellular organisms → Archaea → DPANN group → Nanoarchaeota → unclassified Nanoarchaeota → Nanoarchaeota archaeon | 866 | Open in IMG/M |
3300006845|Ga0075421_100243145 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → Anaerolineales → Anaerolineaceae → Anaerolinea → Anaerolinea thermophila | 2210 | Open in IMG/M |
3300006846|Ga0075430_101266504 | All Organisms → cellular organisms → Archaea → DPANN group → Nanoarchaeota → unclassified Nanoarchaeota → Nanoarchaeota archaeon | 607 | Open in IMG/M |
3300006852|Ga0075433_10023559 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae | 5184 | Open in IMG/M |
3300006865|Ga0073934_10000075 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → Anaerolineales | 281996 | Open in IMG/M |
3300006865|Ga0073934_10536216 | Not Available | 694 | Open in IMG/M |
3300006880|Ga0075429_101147361 | All Organisms → cellular organisms → Archaea → DPANN group → Nanoarchaeota → unclassified Nanoarchaeota → Nanoarchaeota archaeon | 679 | Open in IMG/M |
3300006904|Ga0075424_101374231 | Not Available | 750 | Open in IMG/M |
3300007004|Ga0079218_11219663 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 782 | Open in IMG/M |
3300009078|Ga0105106_10993119 | All Organisms → cellular organisms → Archaea → DPANN group → Nanoarchaeota → unclassified Nanoarchaeota → Nanoarchaeota archaeon | 597 | Open in IMG/M |
3300009167|Ga0113563_13720060 | Not Available | 516 | Open in IMG/M |
3300009168|Ga0105104_10333319 | Not Available | 837 | Open in IMG/M |
3300009609|Ga0105347_1140305 | Not Available | 939 | Open in IMG/M |
3300009678|Ga0105252_10327925 | All Organisms → cellular organisms → Archaea → DPANN group → Nanoarchaeota → unclassified Nanoarchaeota → Nanoarchaeota archaeon | 689 | Open in IMG/M |
3300009873|Ga0131077_10003912 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → Anaerolineales → Anaerolineaceae | 35128 | Open in IMG/M |
3300010037|Ga0126304_10592439 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 747 | Open in IMG/M |
3300010037|Ga0126304_10875933 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 610 | Open in IMG/M |
3300010037|Ga0126304_10958078 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 583 | Open in IMG/M |
3300010038|Ga0126315_10032230 | All Organisms → cellular organisms → Bacteria | 2734 | Open in IMG/M |
3300010042|Ga0126314_10544461 | All Organisms → cellular organisms → Archaea → DPANN group → Nanoarchaeota → unclassified Nanoarchaeota → Nanoarchaeota archaeon | 844 | Open in IMG/M |
3300010166|Ga0126306_10129124 | All Organisms → cellular organisms → Archaea → DPANN group → Nanoarchaeota → unclassified Nanoarchaeota → Nanoarchaeota archaeon | 1858 | Open in IMG/M |
3300010362|Ga0126377_10032867 | All Organisms → cellular organisms → Bacteria | 4400 | Open in IMG/M |
3300010375|Ga0105239_13443353 | All Organisms → cellular organisms → Archaea → DPANN group → Nanoarchaeota → unclassified Nanoarchaeota → Nanoarchaeota archaeon | 514 | Open in IMG/M |
3300010399|Ga0134127_11726382 | All Organisms → cellular organisms → Archaea → DPANN group → Nanoarchaeota → unclassified Nanoarchaeota → Nanoarchaeota archaeon | 701 | Open in IMG/M |
3300010413|Ga0136851_10767147 | Not Available | 946 | Open in IMG/M |
3300011397|Ga0137444_1027311 | All Organisms → cellular organisms → Archaea → DPANN group → Nanoarchaeota → unclassified Nanoarchaeota → Nanoarchaeota archaeon | 828 | Open in IMG/M |
3300011402|Ga0137356_1111762 | All Organisms → cellular organisms → Archaea → DPANN group → Nanoarchaeota → unclassified Nanoarchaeota → Nanoarchaeota archaeon | 515 | Open in IMG/M |
3300011405|Ga0137340_1100147 | All Organisms → cellular organisms → Archaea → DPANN group → Nanoarchaeota → unclassified Nanoarchaeota → Nanoarchaeota archaeon | 558 | Open in IMG/M |
3300011410|Ga0137440_1134648 | All Organisms → cellular organisms → Archaea → DPANN group → Nanoarchaeota → unclassified Nanoarchaeota → Nanoarchaeota archaeon | 509 | Open in IMG/M |
3300011422|Ga0137425_1152951 | Not Available | 574 | Open in IMG/M |
3300011424|Ga0137439_1138805 | All Organisms → cellular organisms → Archaea → DPANN group → Nanoarchaeota → unclassified Nanoarchaeota → Nanoarchaeota archaeon | 559 | Open in IMG/M |
3300011431|Ga0137438_1028782 | All Organisms → cellular organisms → Archaea → DPANN group → Nanoarchaeota → unclassified Nanoarchaeota → Nanoarchaeota archaeon | 1616 | Open in IMG/M |
3300012018|Ga0119867_1042766 | All Organisms → cellular organisms → Bacteria | 1281 | Open in IMG/M |
3300012157|Ga0137353_1001378 | All Organisms → cellular organisms → Bacteria | 3471 | Open in IMG/M |
3300012157|Ga0137353_1005245 | All Organisms → cellular organisms → Bacteria | 1903 | Open in IMG/M |
3300012163|Ga0137355_1017145 | All Organisms → cellular organisms → Bacteria | 1294 | Open in IMG/M |
3300012168|Ga0137357_1053314 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 817 | Open in IMG/M |
3300012204|Ga0137374_10314058 | All Organisms → cellular organisms → Archaea → DPANN group → Nanoarchaeota → unclassified Nanoarchaeota → Nanoarchaeota archaeon | 1280 | Open in IMG/M |
3300012225|Ga0137434_1043354 | Not Available | 670 | Open in IMG/M |
3300012948|Ga0126375_10230431 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → Anaerolineales → Anaerolineaceae → Anaerolinea → Anaerolinea thermophila | 1239 | Open in IMG/M |
3300012971|Ga0126369_12508907 | All Organisms → cellular organisms → Archaea → DPANN group → Nanoarchaeota → unclassified Nanoarchaeota → Nanoarchaeota archaeon | 601 | Open in IMG/M |
3300014254|Ga0075312_1072303 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 684 | Open in IMG/M |
3300014262|Ga0075301_1133527 | Not Available | 565 | Open in IMG/M |
3300014862|Ga0180096_1013942 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 687 | Open in IMG/M |
3300014874|Ga0180084_1125176 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 538 | Open in IMG/M |
3300014881|Ga0180094_1078031 | All Organisms → cellular organisms → Archaea → DPANN group → Nanoarchaeota → unclassified Nanoarchaeota → Nanoarchaeota archaeon | 740 | Open in IMG/M |
3300014882|Ga0180069_1034489 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1106 | Open in IMG/M |
3300015371|Ga0132258_13627200 | Not Available | 1055 | Open in IMG/M |
3300018465|Ga0190269_10678005 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 715 | Open in IMG/M |
3300018481|Ga0190271_10372706 | All Organisms → cellular organisms → Bacteria | 1514 | Open in IMG/M |
3300021090|Ga0210377_10098743 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → Anaerolineales → Anaerolineaceae → Anaerolinea → Anaerolinea thermophila | 1953 | Open in IMG/M |
3300021090|Ga0210377_10519904 | All Organisms → cellular organisms → Archaea → DPANN group → Nanoarchaeota → unclassified Nanoarchaeota → Nanoarchaeota archaeon | 684 | Open in IMG/M |
3300023211|Ga0255842_1005246 | Not Available | 816 | Open in IMG/M |
3300025310|Ga0209172_10000023 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 452837 | Open in IMG/M |
3300025558|Ga0210139_1063285 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 752 | Open in IMG/M |
3300025927|Ga0207687_10857828 | All Organisms → cellular organisms → Archaea → DPANN group → Nanoarchaeota → unclassified Nanoarchaeota → Nanoarchaeota archaeon | 776 | Open in IMG/M |
3300025936|Ga0207670_11238001 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 632 | Open in IMG/M |
3300025961|Ga0207712_12106595 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 505 | Open in IMG/M |
3300026373|Ga0256817_1033690 | All Organisms → cellular organisms → Archaea → DPANN group → Nanoarchaeota → unclassified Nanoarchaeota → Nanoarchaeota archaeon | 521 | Open in IMG/M |
3300027739|Ga0209575_10049269 | All Organisms → cellular organisms → Bacteria | 1534 | Open in IMG/M |
3300027776|Ga0209277_10000787 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 15869 | Open in IMG/M |
3300027818|Ga0209706_10541523 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 528 | Open in IMG/M |
3300027831|Ga0209797_10382201 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 575 | Open in IMG/M |
3300027887|Ga0208980_10440348 | Not Available | 750 | Open in IMG/M |
3300030000|Ga0311337_11425635 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 607 | Open in IMG/M |
3300030943|Ga0311366_11521012 | All Organisms → cellular organisms → Archaea → DPANN group → Nanoarchaeota → unclassified Nanoarchaeota → Nanoarchaeota archaeon | 574 | Open in IMG/M |
3300031726|Ga0302321_101954653 | All Organisms → cellular organisms → Bacteria | 681 | Open in IMG/M |
3300031726|Ga0302321_102422561 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 612 | Open in IMG/M |
3300032144|Ga0315910_10403343 | Not Available | 1047 | Open in IMG/M |
3300033412|Ga0310810_10717778 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 925 | Open in IMG/M |
3300034123|Ga0370479_0035171 | All Organisms → cellular organisms → Bacteria | 1218 | Open in IMG/M |
3300034128|Ga0370490_0024250 | All Organisms → cellular organisms → Bacteria | 2028 | Open in IMG/M |
3300034128|Ga0370490_0036008 | Not Available | 1637 | Open in IMG/M |
3300034157|Ga0370506_056530 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 835 | Open in IMG/M |
3300034194|Ga0370499_0054148 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 959 | Open in IMG/M |
3300034194|Ga0370499_0235187 | Not Available | 502 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 17.31% |
Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 5.77% |
Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 5.77% |
Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 5.77% |
Wetland | Environmental → Aquatic → Marine → Wetlands → Sediment → Wetland | 4.81% |
Sediment (Intertidal) | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal) | 4.81% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 4.81% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.85% |
Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 3.85% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 2.88% |
Hot Spring Sediment | Environmental → Aquatic → Thermal Springs → Sediment → Unclassified → Hot Spring Sediment | 2.88% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 2.88% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 2.88% |
Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 1.92% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.92% |
Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 1.92% |
Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 1.92% |
Wastewater Effluent | Engineered → Wastewater → Nutrient Removal → Unclassified → Unclassified → Wastewater Effluent | 1.92% |
Wetland Sediment | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment | 0.96% |
Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 0.96% |
Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Sediment | 0.96% |
Freshwater | Environmental → Aquatic → Freshwater → Pond → Sediment → Freshwater | 0.96% |
Mangrove Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Mangrove Sediment | 0.96% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 0.96% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.96% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.96% |
Sugarcane Root And Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil | 0.96% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 0.96% |
Fen | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Fen | 0.96% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 0.96% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.96% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.96% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.96% |
Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.96% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.96% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.96% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.96% |
Activated Sludge | Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Activated Sludge | 0.96% |
Activated Sludge | Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Activated Sludge | 0.96% |
Wastewater | Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Wastewater | 0.96% |
Activated Sludge | Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Activated Sludge | 0.96% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Host-Associated | Open in IMG/M |
3300003319 | Sugarcane bulk soil Sample L2 | Environmental | Open in IMG/M |
3300003432 | Wetland sediment microbial communities from Twitchell Island in the Sacramento Delta, sample from surface sediment Aug2011 Site B2 Bulk | Environmental | Open in IMG/M |
3300003541 | Wetland sediment microbial communities from Twitchell Island in the Sacramento Delta, sample from surface sediment Aug2011 Site B2 Bulk | Environmental | Open in IMG/M |
3300003998 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleC_D2 | Environmental | Open in IMG/M |
3300004006 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Goodyear_PhragA_D2 | Environmental | Open in IMG/M |
3300004013 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailA_D2 | Environmental | Open in IMG/M |
3300004019 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleB_D2 | Environmental | Open in IMG/M |
3300004156 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1 | Environmental | Open in IMG/M |
3300004480 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4 | Environmental | Open in IMG/M |
3300004643 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3 | Environmental | Open in IMG/M |
3300005204 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_TuleA_D2 | Environmental | Open in IMG/M |
3300005294 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk Soil | Environmental | Open in IMG/M |
3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Environmental | Open in IMG/M |
3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
3300005656 | Active sludge microbial communities from Klosterneuburg, Austria, studying microevolution and ecology of nitrifiers - Klosterneuburg WWTP active sludge metagenome KNB19-Kit | Engineered | Open in IMG/M |
3300005829 | Microbial communities from Cathlamet Bay sediment, Columbia River estuary, Oregon - S.190_CBC | Environmental | Open in IMG/M |
3300005831 | Microbial communities from Youngs Bay mouth sediment, Columbia River estuary, Oregon - S.43_YBM | Environmental | Open in IMG/M |
3300005836 | Microbial communities from Youngs Bay mouth sediment, Columbia River estuary, Oregon - S.42_YBB | Environmental | Open in IMG/M |
3300005893 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_10C_0N_202 | Environmental | Open in IMG/M |
3300005901 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_5C_80N_201 | Environmental | Open in IMG/M |
3300005982 | Wastewater effluent complex algal communities from Wisconsin, to seasonally profile nutrient transformation and Carbon sequestration - JI 8/11/14 A brown DNA | Engineered | Open in IMG/M |
3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
3300006846 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Host-Associated | Open in IMG/M |
3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
3300006865 | Hot spring sediment bacterial and archeal communities from British Columbia, Canada, to study Microbial Dark Matter (Phase II) - Larsen N4 metaG | Environmental | Open in IMG/M |
3300006880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Host-Associated | Open in IMG/M |
3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
3300007004 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost | Environmental | Open in IMG/M |
3300009078 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 10-12cm September2015 | Environmental | Open in IMG/M |
3300009167 | Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG - Illumina Assembly (version 2) | Environmental | Open in IMG/M |
3300009168 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 19-21cm September2015 | Environmental | Open in IMG/M |
3300009609 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT890 | Environmental | Open in IMG/M |
3300009678 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT100 | Environmental | Open in IMG/M |
3300009873 | Activated sludge microbial diversity in wastewater treatment plant from Taiwan - Wenshan plant | Engineered | Open in IMG/M |
3300010037 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot25 | Environmental | Open in IMG/M |
3300010038 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot106 | Environmental | Open in IMG/M |
3300010042 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105B | Environmental | Open in IMG/M |
3300010166 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot27 | Environmental | Open in IMG/M |
3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
3300010413 | Mangrove sediment microbial communities from Mai Po Nature Reserve Marshes in Hong Kong, China - Maipo_9 | Environmental | Open in IMG/M |
3300011397 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT319_2 | Environmental | Open in IMG/M |
3300011402 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT830_2 | Environmental | Open in IMG/M |
3300011405 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT400_2 | Environmental | Open in IMG/M |
3300011410 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT222_2 | Environmental | Open in IMG/M |
3300011422 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT640_2 | Environmental | Open in IMG/M |
3300011424 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT200_2 | Environmental | Open in IMG/M |
3300011431 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT157_2 | Environmental | Open in IMG/M |
3300012018 | Activated sludge microbial communities from Shanghai, China - membrane bioreactor - Activated sludge (MBR) | Engineered | Open in IMG/M |
3300012157 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT760_2 | Environmental | Open in IMG/M |
3300012163 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT800_2 | Environmental | Open in IMG/M |
3300012168 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT860_2 | Environmental | Open in IMG/M |
3300012204 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG | Environmental | Open in IMG/M |
3300012225 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT860_2 | Environmental | Open in IMG/M |
3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
3300014254 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_CattailB_D2 | Environmental | Open in IMG/M |
3300014262 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleA_D1 | Environmental | Open in IMG/M |
3300014839 | Permafrost microbial communities from Stordalen Mire, Sweden - 712E1D metaG (Illumina Assembly) | Environmental | Open in IMG/M |
3300014862 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT293_16_1Da | Environmental | Open in IMG/M |
3300014874 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT660_2_16_10D | Environmental | Open in IMG/M |
3300014881 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLIBT47_16_1Da | Environmental | Open in IMG/M |
3300014882 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT231B'_16_10D | Environmental | Open in IMG/M |
3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
3300018465 | Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 IS | Environmental | Open in IMG/M |
3300018481 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 T | Environmental | Open in IMG/M |
3300021090 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_65_b1 redo | Environmental | Open in IMG/M |
3300023211 | Activated sludge enriched bacterial communities from WWTP in Fort Collins, Colorado, USA ? CA | Engineered | Open in IMG/M |
3300025310 | Hot spring sediment bacterial and archeal communities from British Columbia, Canada, to study Microbial Dark Matter (Phase II) - Larsen N4 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025558 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleB_D2 (SPAdes) | Environmental | Open in IMG/M |
3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) | Environmental | Open in IMG/M |
3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026373 | Sediment microbial communities from tidal freshwater marsh on Altamaha River, Georgia, United States - 7-17 F6 | Environmental | Open in IMG/M |
3300027739 | Freshwater pond sediment microbial communities from the University of Edinburgh, under environmental carbon perturbations - Medium cellulose week 11 (SPAdes) | Environmental | Open in IMG/M |
3300027776 | Wastewater effluent complex algal communities from Wisconsin, to seasonally profile nutrient transformation and Carbon sequestration - JI 8/11/14 A brown DNA (SPAdes) | Engineered | Open in IMG/M |
3300027818 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 19-21cm September2015 (SPAdes) | Environmental | Open in IMG/M |
3300027831 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T0Bare3Fresh (SPAdes) | Environmental | Open in IMG/M |
3300027887 | Wetland microbial communities from Twitchell Island in the Sacramento Delta, sample from surface sediment Aug2011 Site A1 Bulk | Environmental | Open in IMG/M |
3300030000 | I_Fen_N3 coassembly | Environmental | Open in IMG/M |
3300030943 | III_Fen_N2 coassembly | Environmental | Open in IMG/M |
3300031726 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_1 | Environmental | Open in IMG/M |
3300032144 | Garden soil microbial communities collected in Santa Monica, California, United States - Edamame soil | Environmental | Open in IMG/M |
3300033412 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC | Environmental | Open in IMG/M |
3300034123 | Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_01D_15 | Environmental | Open in IMG/M |
3300034128 | Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_06D_16 | Environmental | Open in IMG/M |
3300034157 | Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_05D_18 | Environmental | Open in IMG/M |
3300034194 | Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_06D_17 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
JGI10216J12902_1004724472 | 3300000956 | Soil | MFRDKASILMEANAKRKPISTTSVVGIGLVSVDQKKDNLSL* |
JGI25406J46586_101360751 | 3300003203 | Tabebuia Heterophylla Rhizosphere | MFRXKAXILMEAKSKRKPSSATSVVGFGLVLIKQVKDKELL* |
soilL2_100029401 | 3300003319 | Sugarcane Root And Bulk Soil | MFRDRASILMEAKAKRKPISATMVVGIGLLSVKQKKDKVSL* |
JGI20214J51088_107988842 | 3300003432 | Wetland | MYRDQAGILMEAKSKRKPISATSVVGTGLALAKQKKDYLSL* |
JGI20214J51088_108309812 | 3300003432 | Wetland | MFRAQALFLMEAKAKRKPISATSVAGTGPASVKQEKDCLSL* |
JGI20214J51650_104052401 | 3300003541 | Wetland | SNMYRDQAGILMEAKSKRKPISATSVVGTGLALAKQKKDYLSL* |
JGI20214J51650_111636041 | 3300003541 | Wetland | SNMYRDQAGILMEAKSKRKPISATSVVGTGLALVKQKKDNLSL* |
Ga0055472_101334792 | 3300003998 | Natural And Restored Wetlands | QPNMFRDKASILMEAKSKRKPSSATSVVGLGLVLVKQEIDKILS* |
Ga0055453_103106531 | 3300004006 | Natural And Restored Wetlands | MFGDKTSILMEAKSKRKPNSATSVVGFGLVLLEQEKDKESL* |
Ga0055465_102288661 | 3300004013 | Natural And Restored Wetlands | MFRDQASILMEAKSKRKPSPATSVVGPGLVLVKQEIDKILS* |
Ga0055439_102166372 | 3300004019 | Natural And Restored Wetlands | MRSRIPPNMFRDKASILMEAKAKRKPVSATSVVGIGLVSVQQKMDKDLL* |
Ga0062589_1001755412 | 3300004156 | Soil | MFRDKASILMEAKSKRKPVSATFVVEIGLVSAEQKKDHLSL* |
Ga0062592_1011925402 | 3300004480 | Soil | MFRDKASILMEANAKRKPISTTSVVGIGLVSVQQKKDKELP* |
Ga0062591_1028936051 | 3300004643 | Soil | MFRDKASILMEAKSKRKPISATSVVGTGLVSVQQKKDNLSL* |
Ga0068997_101045562 | 3300005204 | Natural And Restored Wetlands | MEGRIPSNMFRDKASILMEAKSKRKPISATSVVGIGLVSVKQKKDNVSL* |
Ga0065705_107808801 | 3300005294 | Switchgrass Rhizosphere | LPIGSTIQPNMFRDQASILVEVKSKRKPSSATPVVGFGLVLVNQEIDKTLS* |
Ga0070682_1018176512 | 3300005337 | Corn Rhizosphere | MFRDRASILMEAKAKRKPTSTTSVVGFGHVSVDQEIRKIK* |
Ga0070699_1000022758 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | MFRDHASILMEAKSKRKPTFTTSVVGFGHVSVNQEKGKD* |
Ga0073902_100353702 | 3300005656 | Activated Sludge | MFRDKASILMEAKSKRKPVSTTSVVGIGLASVEQNQEKDSP* |
Ga0074479_102780552 | 3300005829 | Sediment (Intertidal) | MFRDKASILMEAKSKREPISATSVVGIGLVSVKQKKDKVSL* |
Ga0074479_110394402 | 3300005829 | Sediment (Intertidal) | MFRDKASILMEAKSKRKPISATQVVGIGLASVEQKKDKDLL* |
Ga0074471_108220301 | 3300005831 | Sediment (Intertidal) | MFRDKASILMEAKSKRKPISATSVVGIGLVSVKQKKDNVSL* |
Ga0074470_114415912 | 3300005836 | Sediment (Intertidal) | KASILMEAKSKRKPISATVVVGIGLISVNQKKDNVRP* |
Ga0074470_117170882 | 3300005836 | Sediment (Intertidal) | RVEYRSTMYRDKASILMEAKSKREPVSATSVVGVGLASVKQKKDNVSL* |
Ga0075278_10473731 | 3300005893 | Rice Paddy Soil | MKSRIPFNMFRDKASILMEAKAKRKPISATSVVGIGLVSVKQNKNKTSL* |
Ga0075274_10647992 | 3300005901 | Rice Paddy Soil | MFRDKASILMEAKSKRKPNSATSVVGFGLVSVKQKRDK* |
Ga0075156_100169892 | 3300005982 | Wastewater Effluent | MFRDQASILMEAKTKRKPMSTTAVVGSGHVSVKQEMGKTLL* |
Ga0079222_105456201 | 3300006755 | Agricultural Soil | ILMEAKSKRKPISATSVVGIGLVSVKQKKDKLPL* |
Ga0075421_1002431453 | 3300006845 | Populus Rhizosphere | RSRIPPNMYRDRASILMEAKSKRKPISATSVVGIGLVSVKQKKDSLFL* |
Ga0075430_1012665042 | 3300006846 | Populus Rhizosphere | MFRDQASILMEAKSKRKPSSTTPVVGFGLVLVNQDIDKSVS* |
Ga0075433_100235592 | 3300006852 | Populus Rhizosphere | MFRDKASILMEAKSKRKPISATSVVGTGLVSVKQKIDKGLL* |
Ga0073934_10000075117 | 3300006865 | Hot Spring Sediment | MFRDKASILMEAKSKRKPISATSVVGIGLVPVEQKKDNALV* |
Ga0073934_105362162 | 3300006865 | Hot Spring Sediment | MFRDRASILMEAKAKRAPSSATSVVGFGHVSVPQGMSR |
Ga0075429_1011473612 | 3300006880 | Populus Rhizosphere | ASILMEAKSKRKPISATSVVGIGLVSVKQKKDKLPL* |
Ga0075424_1013742311 | 3300006904 | Populus Rhizosphere | MRSRIPPNMFRDKASILMEAKSKRKPISAPSVVGIGLVSVKQKK |
Ga0079218_112196631 | 3300007004 | Agricultural Soil | MYRDRASILMEAKSKRKPISATLVVGIGLVAVKQKKDNLSI* |
Ga0105106_109931192 | 3300009078 | Freshwater Sediment | DRASILMEAKSKRKPISATLVVGIGLVSVKQKKDKVSL* |
Ga0113563_137200602 | 3300009167 | Freshwater Wetlands | MLQDQAAFLMEAKSKRKPISATSVVGTGLVLVKQKRGHLSL* |
Ga0105104_103333191 | 3300009168 | Freshwater Sediment | MSSIFCFETKAKRKPISATPVVGFGLDLVKQEIDK |
Ga0105347_11403051 | 3300009609 | Soil | MESRIPSNMFRDKASILMEAKSKRKPISATPVVGIGLVSVKQKKDKTSL* |
Ga0105252_103279251 | 3300009678 | Soil | ASILMEAKSKRKPTFTTTVVGSGHVSVDQEKGKDLL* |
Ga0131077_100039121 | 3300009873 | Wastewater | MFRDKASILMEAKSKRKPISATSVVGIGLVSVEQNQKKDLL* |
Ga0126304_105924392 | 3300010037 | Serpentine Soil | MRGRIPPNMFRDKASILMEANAKRKPISTTSVVGIGLVSVDQKKDNVSL* |
Ga0126304_108759332 | 3300010037 | Serpentine Soil | MLPNMFRDHASILMEAKSKRKPTFTTAVVGSGHVSVNQEKGKDLP* |
Ga0126304_109580782 | 3300010037 | Serpentine Soil | MFRDRASILMEAKAKRKPTSATSVVGFGLVSVDQEIKKIK* |
Ga0126315_100322302 | 3300010038 | Serpentine Soil | MFRDKASILMEAKSKRKPSPAAPVVGFGLVLVYQEEERLSL* |
Ga0126314_105444611 | 3300010042 | Serpentine Soil | SRIPPNMFRDKASILMEANAKRKPISATSVVGTGLASVDQKTDNVSL* |
Ga0126306_101291242 | 3300010166 | Serpentine Soil | MYGDRASILMEAKSKRKPISATSVVGIGLVSVYQKKDNLSL* |
Ga0126377_100328673 | 3300010362 | Tropical Forest Soil | MFRDKASILMEVKSKRKPISATAVVGIGLVSVKQKTDNVSL* |
Ga0105239_134433532 | 3300010375 | Corn Rhizosphere | RIPPNMFRDKASILMEAKSKRKPISATSVVGTGLVSVKQKSDKLPL* |
Ga0134127_117263821 | 3300010399 | Terrestrial Soil | SRIPPNMYRDKASILMEAKSKRKPISATSVVGTGLVSVKQKSDKLPL* |
Ga0136851_107671472 | 3300010413 | Mangrove Sediment | MESRIPPNMFRDKASILMEAKSKREPISATSVVGIGLVLVKQKKDIVSS* |
Ga0137444_10273112 | 3300011397 | Soil | RIPPNMFRDKASILMEANAKRKPISATSVVGIGLVSVQQKKAKVSL* |
Ga0137356_11117621 | 3300011402 | Soil | DKASILMEAKSKRKPVFATSVVEIGLVSVDQKKDNLSL* |
Ga0137340_11001472 | 3300011405 | Soil | PSNMFRDKASILMEAKSKREPISATSVVGIGLVSVKQKKDKVSL* |
Ga0137440_11346481 | 3300011410 | Soil | SILMEAKSKRKPMFTTSVVGFGHVLVNQEMGKDSL* |
Ga0137425_11529511 | 3300011422 | Soil | MFRDEASILMEAKAKRKPTSTTSVVGTGLVSVDQKKDNVSL* |
Ga0137439_11388051 | 3300011424 | Soil | MEGRIPSNMFRDKASILMEAKSKRKPISATSVVGIGLVSIKQKKDKTSL* |
Ga0137438_10287822 | 3300011431 | Soil | MEGRIPSNMFRDKANILMEAKSKREPISATSVVGIGLVSVKQKKDKVSL* |
Ga0119867_10427661 | 3300012018 | Activated Sludge | MFRDKASILMEAKSKRKPISTTSVVGIGLASVEQNQKKDLP* |
Ga0137353_10013782 | 3300012157 | Soil | MFRDHASILMEAKSKRKPTFTTSVVGFGHVLVNQEKGKGLL* |
Ga0137353_10052452 | 3300012157 | Soil | MKSRIPSNMFRDKASILMEAKSKREPISATSVVGIGLVSVKQKKDNVSL* |
Ga0137355_10171452 | 3300012163 | Soil | MFRDHASILMEAKSKRKPTFTTSVVGFGHVSVNQEKGKDLL* |
Ga0137357_10533142 | 3300012168 | Soil | MFRDHASILMEAKSKRKPTFTTSVVGFGHVSVHQEKGKDLL* |
Ga0137374_103140582 | 3300012204 | Vadose Zone Soil | MRGKIPPNMFRDKASILMEANAKRKPTSATSVVGTGLGSVDQKKDNLSL* |
Ga0137434_10433541 | 3300012225 | Soil | MFRDKASILMEAKSKRKPISATSVVGIGLVSVKQKKDKASL* |
Ga0126375_102304312 | 3300012948 | Tropical Forest Soil | MFRDKASILMEAKSKRKPVSATQVVGIGLISVKQIQAKVLV* |
Ga0126369_125089071 | 3300012971 | Tropical Forest Soil | NMFRDKASILMEAKSKRKPVSATQVVEIGLISVKQIQAKVLV* |
Ga0075312_10723032 | 3300014254 | Natural And Restored Wetlands | MFRDQASILMEAKSKRKPSPATSVVGLGLVLVKQEIDKILS* |
Ga0075301_11335271 | 3300014262 | Natural And Restored Wetlands | MFRDKASILMEAKAKRKPVSATSVVGIGLVSVQQKMDNDLL* |
Ga0182027_107364442 | 3300014839 | Fen | DTFHNRSRIPPNMFRDKASILMEARSKRMPNFATMVVGFGLVLVNKK* |
Ga0180096_10139422 | 3300014862 | Soil | MKSRIPFNMFRDKASILMEAKSKRKPISATSVVGIGLVSIKQKKDKISL* |
Ga0180084_11251761 | 3300014874 | Soil | MFRDRASILMEAKSKRKPTFTTTVVGSGHVSVDQEKGKDLL |
Ga0180094_10780311 | 3300014881 | Soil | IPSNMFRDKASILMEAKSKREPISATSVVGIGLVSVKQKKDNVSL* |
Ga0180069_10344891 | 3300014882 | Soil | MFRDKASILMEANAKRKPISATSVVGIGLVSVKQKKDKASL* |
Ga0132258_136272001 | 3300015371 | Arabidopsis Rhizosphere | PKMYRDKASILMEAKSKRKPISATPVVESGLVSVKQEKDKMSL* |
Ga0190269_106780051 | 3300018465 | Soil | MFRDQANILLEAKSKRKPSSATSVVGLGLVLVKQETDKILS |
Ga0190271_103727062 | 3300018481 | Soil | MFRDRASILMEAKAKRKPTSATSVVGFGLVSVDQEIKKIK |
Ga0210377_100987431 | 3300021090 | Groundwater Sediment | VLRSRIPPNMFRDKASILMEANTKRRPISATSVVGIGLLSVDQKMDNLSL |
Ga0210377_105199042 | 3300021090 | Groundwater Sediment | NMFRDHASILMEAKSKRKPMFTTSVVGSGHVSVDQEKGKDLL |
Ga0255842_10052462 | 3300023211 | Activated Sludge | FRDRASILMEAKAKRKPFSTTPVVGNGHVSVEQVIKKNSE |
Ga0209172_10000023257 | 3300025310 | Hot Spring Sediment | MFRDKASILMEAKSKRKPISATSVVGIGLVPVEQKKDNALV |
Ga0210139_10632851 | 3300025558 | Natural And Restored Wetlands | MFRDKASILMEAKAKRKPVSATSVVGIGLVSVQQKMDK |
Ga0207687_108578282 | 3300025927 | Miscanthus Rhizosphere | ASILMEAKSKRKPISATSVVGTGLVSVKQKSDKLPL |
Ga0207670_112380012 | 3300025936 | Switchgrass Rhizosphere | MFRDRASILMEAKAKCKPLSATTVVGIGLVSVKQKKDKVSL |
Ga0207712_121065951 | 3300025961 | Switchgrass Rhizosphere | MFRDRASILMEAKAKRKPISATTVVGIGLVSVKQKKDKVS |
Ga0256817_10336901 | 3300026373 | Sediment | SRIPSNMFRDKASILMEAKSKRKPVSTTSVVGIGLVSVQQKNR |
Ga0209575_100492692 | 3300027739 | Freshwater | MFRDRASILMQAKAKRMPISATMVVGFGLVSVQQKIGENKALL |
Ga0209277_1000078710 | 3300027776 | Wastewater Effluent | MFRDQASILMEAKTKRKPMSTTAVVGSGHVSVKQEMGKTLL |
Ga0209706_105415232 | 3300027818 | Freshwater Sediment | MSSRILPNMYRDQASILMEAKSKRKPISATLVVGIGLVSVKQKK |
Ga0209797_103822011 | 3300027831 | Wetland Sediment | ILHSRIPPNMFRDEASILMDANAKRKPVSTTSVVGIGLVSVDQKKDSLSL |
Ga0208980_104403482 | 3300027887 | Wetland | MLRDQAGIPMEAKSKRKPISATSVVGTGLVSVKQEKDRLSL |
Ga0311337_114256351 | 3300030000 | Fen | MFRDKASILMEAKAKRQPISATTVVGIGLVSVKQKKDKVSL |
Ga0311366_115210122 | 3300030943 | Fen | ASILMEAKAKRQPISATTVVGFGLVSVKQKKDKVSL |
Ga0302321_1019546532 | 3300031726 | Fen | MFRDRASILMQAKAKRMPTSATTVVGVGLVSVKQKMDKNK |
Ga0302321_1024225612 | 3300031726 | Fen | MFRDKASILMEAKAKRKPISTTLVVGIGHVSVKQDSTKNAA |
Ga0315910_104033432 | 3300032144 | Soil | DQASILMEAKAKRKPISATQVVGIGLVSVQQKKAKDLL |
Ga0310810_107177782 | 3300033412 | Soil | MFRDQASILMEANSKRKPISATSVVGIGLVSVYQMKEKVSL |
Ga0370479_0035171_2_109 | 3300034123 | Untreated Peat Soil | MFRAKASILMEAKAKRKPISATSVVGTGLVSVYQKK |
Ga0370490_0024250_631_756 | 3300034128 | Untreated Peat Soil | MFRDKASILMEAKAKRKPISTTSVVGTGLVSVDQKKDNLSL |
Ga0370490_0036008_1357_1482 | 3300034128 | Untreated Peat Soil | MFRDKASILMEAKSKRKPSSATSVVGLGLVLVKQEIDKILS |
Ga0370506_056530_431_556 | 3300034157 | Untreated Peat Soil | MFRDKASILMEAKSKLKPTGTTSVVGTGLVSVDQKKDNLSL |
Ga0370499_0054148_119_244 | 3300034194 | Untreated Peat Soil | MFRDKASILMEAKSKRKPSSATSVVGLGLVLDKQEIDKILS |
Ga0370499_0235187_194_313 | 3300034194 | Untreated Peat Soil | MFRDRASILMQAKAKRMPISAASVVGFGLVSVKQKMDKK |
⦗Top⦘ |