NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F097091

Metagenome Family F097091

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F097091
Family Type Metagenome
Number of Sequences 104
Average Sequence Length 42 residues
Representative Sequence MFRDKASILMEAKSKRKPISATSVVGIGLVSVKQKKDKASL
Number of Associated Samples 92
Number of Associated Scaffolds 104

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 35.29 %
% of genes near scaffold ends (potentially truncated) 36.54 %
% of genes from short scaffolds (< 2000 bps) 83.65 %
Associated GOLD sequencing projects 88
AlphaFold2 3D model prediction Yes
3D model pTM-score0.29

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (50.962 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil
(17.308 % of family members)
Environment Ontology (ENVO) Unclassified
(25.000 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(19.231 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 44.93%    β-sheet: 0.00%    Coil/Unstructured: 55.07%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.29
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 104 Family Scaffolds
PF00682HMGL-like 42.31
PF00310GATase_2 11.54
PF04898Glu_syn_central 5.77
PF00988CPSase_sm_chain 2.88
PF00106adh_short 1.92
PF01037AsnC_trans_reg 1.92
PF02782FGGY_C 0.96
PF00324AA_permease 0.96
PF01041DegT_DnrJ_EryC1 0.96
PF00330Aconitase 0.96
PF00797Acetyltransf_2 0.96
PF08443RimK 0.96
PF13185GAF_2 0.96
PF06821Ser_hydrolase 0.96
PF00160Pro_isomerase 0.96
PF069833-dmu-9_3-mt 0.96
PF00909Ammonium_transp 0.96

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 104 Family Scaffolds
COG0505Carbamoylphosphate synthase small subunitAmino acid transport and metabolism [E] 5.77
COG0004Ammonia channel protein AmtBInorganic ion transport and metabolism [P] 0.96
COG0399dTDP-4-amino-4,6-dideoxygalactose transaminaseCell wall/membrane/envelope biogenesis [M] 0.96
COG0436Aspartate/methionine/tyrosine aminotransferaseAmino acid transport and metabolism [E] 0.96
COG0520Selenocysteine lyase/Cysteine desulfuraseAmino acid transport and metabolism [E] 0.96
COG0531Serine transporter YbeC, amino acid:H+ symporter familyAmino acid transport and metabolism [E] 0.96
COG0626Cystathionine beta-lyase/cystathionine gamma-synthaseAmino acid transport and metabolism [E] 0.96
COG0652Peptidyl-prolyl cis-trans isomerase (rotamase) - cyclophilin familyPosttranslational modification, protein turnover, chaperones [O] 0.96
COG0833Amino acid permeaseAmino acid transport and metabolism [E] 0.96
COG1104Cysteine desulfurase/Cysteine sulfinate desulfinase IscS or related enzyme, NifS familyAmino acid transport and metabolism [E] 0.96
COG1113L-asparagine transporter or related permeaseAmino acid transport and metabolism [E] 0.96
COG1115Na+/alanine symporterAmino acid transport and metabolism [E] 0.96
COG2162Arylamine N-acetyltransferaseSecondary metabolites biosynthesis, transport and catabolism [Q] 0.96
COG2764Zn-dependent glyoxalase, PhnB familyEnergy production and conversion [C] 0.96
COG2873O-acetylhomoserine/O-acetylserine sulfhydrylase, pyridoxal phosphate-dependentAmino acid transport and metabolism [E] 0.96
COG3545Predicted esterase of the alpha/beta hydrolase foldGeneral function prediction only [R] 0.96
COG3865Glyoxalase superfamily enzyme, possible 3-demethylubiquinone-9 3-methyltransferaseGeneral function prediction only [R] 0.96


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms77.88 %
UnclassifiedrootN/A22.12 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000956|JGI10216J12902_100472447All Organisms → cellular organisms → Bacteria3973Open in IMG/M
3300003203|JGI25406J46586_10136075All Organisms → cellular organisms → Archaea → DPANN group → Nanoarchaeota → unclassified Nanoarchaeota → Nanoarchaeota archaeon719Open in IMG/M
3300003319|soilL2_10002940All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi1125Open in IMG/M
3300003432|JGI20214J51088_10798884Not Available612Open in IMG/M
3300003432|JGI20214J51088_10830981Not Available601Open in IMG/M
3300003541|JGI20214J51650_10405240Not Available952Open in IMG/M
3300003541|JGI20214J51650_11163604All Organisms → cellular organisms → Bacteria536Open in IMG/M
3300003998|Ga0055472_10133479All Organisms → cellular organisms → Archaea → DPANN group → Nanoarchaeota → unclassified Nanoarchaeota → Nanoarchaeota archaeon725Open in IMG/M
3300004006|Ga0055453_10310653Not Available508Open in IMG/M
3300004013|Ga0055465_10228866All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium620Open in IMG/M
3300004019|Ga0055439_10216637All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi617Open in IMG/M
3300004156|Ga0062589_100175541All Organisms → cellular organisms → Bacteria1510Open in IMG/M
3300004480|Ga0062592_101192540All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi711Open in IMG/M
3300004643|Ga0062591_102893605All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi509Open in IMG/M
3300005204|Ga0068997_10104556All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi615Open in IMG/M
3300005337|Ga0070682_101817651All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi532Open in IMG/M
3300005518|Ga0070699_100002275All Organisms → cellular organisms → Bacteria17279Open in IMG/M
3300005656|Ga0073902_10035370All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi2446Open in IMG/M
3300005829|Ga0074479_10278055All Organisms → cellular organisms → Archaea → DPANN group → Nanoarchaeota → unclassified Nanoarchaeota → Nanoarchaeota archaeon734Open in IMG/M
3300005829|Ga0074479_11039440All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae2876Open in IMG/M
3300005831|Ga0074471_10822030All Organisms → cellular organisms → Archaea → DPANN group → Nanoarchaeota → unclassified Nanoarchaeota → Nanoarchaeota archaeon782Open in IMG/M
3300005836|Ga0074470_11441591All Organisms → cellular organisms → Archaea → DPANN group → Nanoarchaeota → unclassified Nanoarchaeota → Nanoarchaeota archaeon642Open in IMG/M
3300005836|Ga0074470_11717088All Organisms → cellular organisms → Archaea → DPANN group → Nanoarchaeota → unclassified Nanoarchaeota → Nanoarchaeota archaeon501Open in IMG/M
3300005893|Ga0075278_1047373Not Available642Open in IMG/M
3300005901|Ga0075274_1064799Not Available579Open in IMG/M
3300005982|Ga0075156_10016989All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi4299Open in IMG/M
3300006755|Ga0079222_10545620All Organisms → cellular organisms → Archaea → DPANN group → Nanoarchaeota → unclassified Nanoarchaeota → Nanoarchaeota archaeon866Open in IMG/M
3300006845|Ga0075421_100243145All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → Anaerolineales → Anaerolineaceae → Anaerolinea → Anaerolinea thermophila2210Open in IMG/M
3300006846|Ga0075430_101266504All Organisms → cellular organisms → Archaea → DPANN group → Nanoarchaeota → unclassified Nanoarchaeota → Nanoarchaeota archaeon607Open in IMG/M
3300006852|Ga0075433_10023559All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae5184Open in IMG/M
3300006865|Ga0073934_10000075All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → Anaerolineales281996Open in IMG/M
3300006865|Ga0073934_10536216Not Available694Open in IMG/M
3300006880|Ga0075429_101147361All Organisms → cellular organisms → Archaea → DPANN group → Nanoarchaeota → unclassified Nanoarchaeota → Nanoarchaeota archaeon679Open in IMG/M
3300006904|Ga0075424_101374231Not Available750Open in IMG/M
3300007004|Ga0079218_11219663All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi782Open in IMG/M
3300009078|Ga0105106_10993119All Organisms → cellular organisms → Archaea → DPANN group → Nanoarchaeota → unclassified Nanoarchaeota → Nanoarchaeota archaeon597Open in IMG/M
3300009167|Ga0113563_13720060Not Available516Open in IMG/M
3300009168|Ga0105104_10333319Not Available837Open in IMG/M
3300009609|Ga0105347_1140305Not Available939Open in IMG/M
3300009678|Ga0105252_10327925All Organisms → cellular organisms → Archaea → DPANN group → Nanoarchaeota → unclassified Nanoarchaeota → Nanoarchaeota archaeon689Open in IMG/M
3300009873|Ga0131077_10003912All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → Anaerolineales → Anaerolineaceae35128Open in IMG/M
3300010037|Ga0126304_10592439All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi747Open in IMG/M
3300010037|Ga0126304_10875933All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi610Open in IMG/M
3300010037|Ga0126304_10958078All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi583Open in IMG/M
3300010038|Ga0126315_10032230All Organisms → cellular organisms → Bacteria2734Open in IMG/M
3300010042|Ga0126314_10544461All Organisms → cellular organisms → Archaea → DPANN group → Nanoarchaeota → unclassified Nanoarchaeota → Nanoarchaeota archaeon844Open in IMG/M
3300010166|Ga0126306_10129124All Organisms → cellular organisms → Archaea → DPANN group → Nanoarchaeota → unclassified Nanoarchaeota → Nanoarchaeota archaeon1858Open in IMG/M
3300010362|Ga0126377_10032867All Organisms → cellular organisms → Bacteria4400Open in IMG/M
3300010375|Ga0105239_13443353All Organisms → cellular organisms → Archaea → DPANN group → Nanoarchaeota → unclassified Nanoarchaeota → Nanoarchaeota archaeon514Open in IMG/M
3300010399|Ga0134127_11726382All Organisms → cellular organisms → Archaea → DPANN group → Nanoarchaeota → unclassified Nanoarchaeota → Nanoarchaeota archaeon701Open in IMG/M
3300010413|Ga0136851_10767147Not Available946Open in IMG/M
3300011397|Ga0137444_1027311All Organisms → cellular organisms → Archaea → DPANN group → Nanoarchaeota → unclassified Nanoarchaeota → Nanoarchaeota archaeon828Open in IMG/M
3300011402|Ga0137356_1111762All Organisms → cellular organisms → Archaea → DPANN group → Nanoarchaeota → unclassified Nanoarchaeota → Nanoarchaeota archaeon515Open in IMG/M
3300011405|Ga0137340_1100147All Organisms → cellular organisms → Archaea → DPANN group → Nanoarchaeota → unclassified Nanoarchaeota → Nanoarchaeota archaeon558Open in IMG/M
3300011410|Ga0137440_1134648All Organisms → cellular organisms → Archaea → DPANN group → Nanoarchaeota → unclassified Nanoarchaeota → Nanoarchaeota archaeon509Open in IMG/M
3300011422|Ga0137425_1152951Not Available574Open in IMG/M
3300011424|Ga0137439_1138805All Organisms → cellular organisms → Archaea → DPANN group → Nanoarchaeota → unclassified Nanoarchaeota → Nanoarchaeota archaeon559Open in IMG/M
3300011431|Ga0137438_1028782All Organisms → cellular organisms → Archaea → DPANN group → Nanoarchaeota → unclassified Nanoarchaeota → Nanoarchaeota archaeon1616Open in IMG/M
3300012018|Ga0119867_1042766All Organisms → cellular organisms → Bacteria1281Open in IMG/M
3300012157|Ga0137353_1001378All Organisms → cellular organisms → Bacteria3471Open in IMG/M
3300012157|Ga0137353_1005245All Organisms → cellular organisms → Bacteria1903Open in IMG/M
3300012163|Ga0137355_1017145All Organisms → cellular organisms → Bacteria1294Open in IMG/M
3300012168|Ga0137357_1053314All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi817Open in IMG/M
3300012204|Ga0137374_10314058All Organisms → cellular organisms → Archaea → DPANN group → Nanoarchaeota → unclassified Nanoarchaeota → Nanoarchaeota archaeon1280Open in IMG/M
3300012225|Ga0137434_1043354Not Available670Open in IMG/M
3300012948|Ga0126375_10230431All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → Anaerolineales → Anaerolineaceae → Anaerolinea → Anaerolinea thermophila1239Open in IMG/M
3300012971|Ga0126369_12508907All Organisms → cellular organisms → Archaea → DPANN group → Nanoarchaeota → unclassified Nanoarchaeota → Nanoarchaeota archaeon601Open in IMG/M
3300014254|Ga0075312_1072303All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi684Open in IMG/M
3300014262|Ga0075301_1133527Not Available565Open in IMG/M
3300014862|Ga0180096_1013942All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi687Open in IMG/M
3300014874|Ga0180084_1125176All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi538Open in IMG/M
3300014881|Ga0180094_1078031All Organisms → cellular organisms → Archaea → DPANN group → Nanoarchaeota → unclassified Nanoarchaeota → Nanoarchaeota archaeon740Open in IMG/M
3300014882|Ga0180069_1034489All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1106Open in IMG/M
3300015371|Ga0132258_13627200Not Available1055Open in IMG/M
3300018465|Ga0190269_10678005All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium715Open in IMG/M
3300018481|Ga0190271_10372706All Organisms → cellular organisms → Bacteria1514Open in IMG/M
3300021090|Ga0210377_10098743All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → Anaerolineales → Anaerolineaceae → Anaerolinea → Anaerolinea thermophila1953Open in IMG/M
3300021090|Ga0210377_10519904All Organisms → cellular organisms → Archaea → DPANN group → Nanoarchaeota → unclassified Nanoarchaeota → Nanoarchaeota archaeon684Open in IMG/M
3300023211|Ga0255842_1005246Not Available816Open in IMG/M
3300025310|Ga0209172_10000023All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi452837Open in IMG/M
3300025558|Ga0210139_1063285All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi752Open in IMG/M
3300025927|Ga0207687_10857828All Organisms → cellular organisms → Archaea → DPANN group → Nanoarchaeota → unclassified Nanoarchaeota → Nanoarchaeota archaeon776Open in IMG/M
3300025936|Ga0207670_11238001All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi632Open in IMG/M
3300025961|Ga0207712_12106595All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi505Open in IMG/M
3300026373|Ga0256817_1033690All Organisms → cellular organisms → Archaea → DPANN group → Nanoarchaeota → unclassified Nanoarchaeota → Nanoarchaeota archaeon521Open in IMG/M
3300027739|Ga0209575_10049269All Organisms → cellular organisms → Bacteria1534Open in IMG/M
3300027776|Ga0209277_10000787All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi15869Open in IMG/M
3300027818|Ga0209706_10541523All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi528Open in IMG/M
3300027831|Ga0209797_10382201All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi575Open in IMG/M
3300027887|Ga0208980_10440348Not Available750Open in IMG/M
3300030000|Ga0311337_11425635All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi607Open in IMG/M
3300030943|Ga0311366_11521012All Organisms → cellular organisms → Archaea → DPANN group → Nanoarchaeota → unclassified Nanoarchaeota → Nanoarchaeota archaeon574Open in IMG/M
3300031726|Ga0302321_101954653All Organisms → cellular organisms → Bacteria681Open in IMG/M
3300031726|Ga0302321_102422561All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi612Open in IMG/M
3300032144|Ga0315910_10403343Not Available1047Open in IMG/M
3300033412|Ga0310810_10717778All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi925Open in IMG/M
3300034123|Ga0370479_0035171All Organisms → cellular organisms → Bacteria1218Open in IMG/M
3300034128|Ga0370490_0024250All Organisms → cellular organisms → Bacteria2028Open in IMG/M
3300034128|Ga0370490_0036008Not Available1637Open in IMG/M
3300034157|Ga0370506_056530All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi835Open in IMG/M
3300034194|Ga0370499_0054148All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium959Open in IMG/M
3300034194|Ga0370499_0235187Not Available502Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil17.31%
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands5.77%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil5.77%
Untreated Peat SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil5.77%
WetlandEnvironmental → Aquatic → Marine → Wetlands → Sediment → Wetland4.81%
Sediment (Intertidal)Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal)4.81%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere4.81%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil3.85%
FenEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Fen3.85%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment2.88%
Hot Spring SedimentEnvironmental → Aquatic → Thermal Springs → Sediment → Unclassified → Hot Spring Sediment2.88%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil2.88%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil2.88%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment1.92%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil1.92%
Natural And Restored WetlandsEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands1.92%
Rice Paddy SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil1.92%
Wastewater EffluentEngineered → Wastewater → Nutrient Removal → Unclassified → Unclassified → Wastewater Effluent1.92%
Wetland SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment0.96%
Freshwater WetlandsEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands0.96%
SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Sediment0.96%
FreshwaterEnvironmental → Aquatic → Freshwater → Pond → Sediment → Freshwater0.96%
Mangrove SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Mangrove Sediment0.96%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil0.96%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil0.96%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere0.96%
Sugarcane Root And Bulk SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil0.96%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil0.96%
FenEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Fen0.96%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere0.96%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere0.96%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere0.96%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.96%
Tabebuia Heterophylla RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere0.96%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.96%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.96%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.96%
Activated SludgeEngineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Activated Sludge0.96%
Activated SludgeEngineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Activated Sludge0.96%
WastewaterEngineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Wastewater0.96%
Activated SludgeEngineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Activated Sludge0.96%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000956Soil microbial communities from Great Prairies - Kansas, Native Prairie soilEnvironmentalOpen in IMG/M
3300003203Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2Host-AssociatedOpen in IMG/M
3300003319Sugarcane bulk soil Sample L2EnvironmentalOpen in IMG/M
3300003432Wetland sediment microbial communities from Twitchell Island in the Sacramento Delta, sample from surface sediment Aug2011 Site B2 BulkEnvironmentalOpen in IMG/M
3300003541Wetland sediment microbial communities from Twitchell Island in the Sacramento Delta, sample from surface sediment Aug2011 Site B2 BulkEnvironmentalOpen in IMG/M
3300003998Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleC_D2EnvironmentalOpen in IMG/M
3300004006Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Goodyear_PhragA_D2EnvironmentalOpen in IMG/M
3300004013Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailA_D2EnvironmentalOpen in IMG/M
3300004019Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleB_D2EnvironmentalOpen in IMG/M
3300004156Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1EnvironmentalOpen in IMG/M
3300004480Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4EnvironmentalOpen in IMG/M
3300004643Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3EnvironmentalOpen in IMG/M
3300005204Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_TuleA_D2EnvironmentalOpen in IMG/M
3300005294Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk SoilEnvironmentalOpen in IMG/M
3300005337Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaGEnvironmentalOpen in IMG/M
3300005518Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaGEnvironmentalOpen in IMG/M
3300005656Active sludge microbial communities from Klosterneuburg, Austria, studying microevolution and ecology of nitrifiers - Klosterneuburg WWTP active sludge metagenome KNB19-KitEngineeredOpen in IMG/M
3300005829Microbial communities from Cathlamet Bay sediment, Columbia River estuary, Oregon - S.190_CBCEnvironmentalOpen in IMG/M
3300005831Microbial communities from Youngs Bay mouth sediment, Columbia River estuary, Oregon - S.43_YBMEnvironmentalOpen in IMG/M
3300005836Microbial communities from Youngs Bay mouth sediment, Columbia River estuary, Oregon - S.42_YBBEnvironmentalOpen in IMG/M
3300005893Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_10C_0N_202EnvironmentalOpen in IMG/M
3300005901Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_5C_80N_201EnvironmentalOpen in IMG/M
3300005982Wastewater effluent complex algal communities from Wisconsin, to seasonally profile nutrient transformation and Carbon sequestration - JI 8/11/14 A brown DNAEngineeredOpen in IMG/M
3300006755Agricultural soil microbial communities from Georgia to study Nitrogen management - GA PlitterEnvironmentalOpen in IMG/M
3300006845Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5Host-AssociatedOpen in IMG/M
3300006846Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4Host-AssociatedOpen in IMG/M
3300006852Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2Host-AssociatedOpen in IMG/M
3300006865Hot spring sediment bacterial and archeal communities from British Columbia, Canada, to study Microbial Dark Matter (Phase II) - Larsen N4 metaGEnvironmentalOpen in IMG/M
3300006880Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3Host-AssociatedOpen in IMG/M
3300006904Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3Host-AssociatedOpen in IMG/M
3300007004Agricultural soil microbial communities from Utah to study Nitrogen management - NC CompostEnvironmentalOpen in IMG/M
3300009078Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 10-12cm September2015EnvironmentalOpen in IMG/M
3300009167Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG - Illumina Assembly (version 2)EnvironmentalOpen in IMG/M
3300009168Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 19-21cm September2015EnvironmentalOpen in IMG/M
3300009609Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT890EnvironmentalOpen in IMG/M
3300009678Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT100EnvironmentalOpen in IMG/M
3300009873Activated sludge microbial diversity in wastewater treatment plant from Taiwan - Wenshan plantEngineeredOpen in IMG/M
3300010037Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot25EnvironmentalOpen in IMG/M
3300010038Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot106EnvironmentalOpen in IMG/M
3300010042Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105BEnvironmentalOpen in IMG/M
3300010166Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot27EnvironmentalOpen in IMG/M
3300010362Tropical forest soil microbial communities from Panama - MetaG Plot_22EnvironmentalOpen in IMG/M
3300010375Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaGHost-AssociatedOpen in IMG/M
3300010399Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3EnvironmentalOpen in IMG/M
3300010413Mangrove sediment microbial communities from Mai Po Nature Reserve Marshes in Hong Kong, China - Maipo_9EnvironmentalOpen in IMG/M
3300011397Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT319_2EnvironmentalOpen in IMG/M
3300011402Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT830_2EnvironmentalOpen in IMG/M
3300011405Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT400_2EnvironmentalOpen in IMG/M
3300011410Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT222_2EnvironmentalOpen in IMG/M
3300011422Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT640_2EnvironmentalOpen in IMG/M
3300011424Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT200_2EnvironmentalOpen in IMG/M
3300011431Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT157_2EnvironmentalOpen in IMG/M
3300012018Activated sludge microbial communities from Shanghai, China - membrane bioreactor - Activated sludge (MBR)EngineeredOpen in IMG/M
3300012157Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT760_2EnvironmentalOpen in IMG/M
3300012163Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT800_2EnvironmentalOpen in IMG/M
3300012168Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT860_2EnvironmentalOpen in IMG/M
3300012204Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaGEnvironmentalOpen in IMG/M
3300012225Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT860_2EnvironmentalOpen in IMG/M
3300012948Tropical forest soil microbial communities from Panama - MetaG Plot_14EnvironmentalOpen in IMG/M
3300012971Tropical forest soil microbial communities from Panama - MetaG Plot_1EnvironmentalOpen in IMG/M
3300014254Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_CattailB_D2EnvironmentalOpen in IMG/M
3300014262Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleA_D1EnvironmentalOpen in IMG/M
3300014839Permafrost microbial communities from Stordalen Mire, Sweden - 712E1D metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300014862Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT293_16_1DaEnvironmentalOpen in IMG/M
3300014874Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT660_2_16_10DEnvironmentalOpen in IMG/M
3300014881Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLIBT47_16_1DaEnvironmentalOpen in IMG/M
3300014882Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT231B'_16_10DEnvironmentalOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300018465Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 ISEnvironmentalOpen in IMG/M
3300018481Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 TEnvironmentalOpen in IMG/M
3300021090Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_65_b1 redoEnvironmentalOpen in IMG/M
3300023211Activated sludge enriched bacterial communities from WWTP in Fort Collins, Colorado, USA ? CAEngineeredOpen in IMG/M
3300025310Hot spring sediment bacterial and archeal communities from British Columbia, Canada, to study Microbial Dark Matter (Phase II) - Larsen N4 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025558Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleB_D2 (SPAdes)EnvironmentalOpen in IMG/M
3300025927Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025936Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025961Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026373Sediment microbial communities from tidal freshwater marsh on Altamaha River, Georgia, United States - 7-17 F6EnvironmentalOpen in IMG/M
3300027739Freshwater pond sediment microbial communities from the University of Edinburgh, under environmental carbon perturbations - Medium cellulose week 11 (SPAdes)EnvironmentalOpen in IMG/M
3300027776Wastewater effluent complex algal communities from Wisconsin, to seasonally profile nutrient transformation and Carbon sequestration - JI 8/11/14 A brown DNA (SPAdes)EngineeredOpen in IMG/M
3300027818Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 19-21cm September2015 (SPAdes)EnvironmentalOpen in IMG/M
3300027831Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T0Bare3Fresh (SPAdes)EnvironmentalOpen in IMG/M
3300027887Wetland microbial communities from Twitchell Island in the Sacramento Delta, sample from surface sediment Aug2011 Site A1 BulkEnvironmentalOpen in IMG/M
3300030000I_Fen_N3 coassemblyEnvironmentalOpen in IMG/M
3300030943III_Fen_N2 coassemblyEnvironmentalOpen in IMG/M
3300031726Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_1EnvironmentalOpen in IMG/M
3300032144Garden soil microbial communities collected in Santa Monica, California, United States - Edamame soilEnvironmentalOpen in IMG/M
3300033412Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NCEnvironmentalOpen in IMG/M
3300034123Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_01D_15EnvironmentalOpen in IMG/M
3300034128Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_06D_16EnvironmentalOpen in IMG/M
3300034157Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_05D_18EnvironmentalOpen in IMG/M
3300034194Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_06D_17EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI10216J12902_10047244723300000956SoilMFRDKASILMEANAKRKPISTTSVVGIGLVSVDQKKDNLSL*
JGI25406J46586_1013607513300003203Tabebuia Heterophylla RhizosphereMFRXKAXILMEAKSKRKPSSATSVVGFGLVLIKQVKDKELL*
soilL2_1000294013300003319Sugarcane Root And Bulk SoilMFRDRASILMEAKAKRKPISATMVVGIGLLSVKQKKDKVSL*
JGI20214J51088_1079888423300003432WetlandMYRDQAGILMEAKSKRKPISATSVVGTGLALAKQKKDYLSL*
JGI20214J51088_1083098123300003432WetlandMFRAQALFLMEAKAKRKPISATSVAGTGPASVKQEKDCLSL*
JGI20214J51650_1040524013300003541WetlandSNMYRDQAGILMEAKSKRKPISATSVVGTGLALAKQKKDYLSL*
JGI20214J51650_1116360413300003541WetlandSNMYRDQAGILMEAKSKRKPISATSVVGTGLALVKQKKDNLSL*
Ga0055472_1013347923300003998Natural And Restored WetlandsQPNMFRDKASILMEAKSKRKPSSATSVVGLGLVLVKQEIDKILS*
Ga0055453_1031065313300004006Natural And Restored WetlandsMFGDKTSILMEAKSKRKPNSATSVVGFGLVLLEQEKDKESL*
Ga0055465_1022886613300004013Natural And Restored WetlandsMFRDQASILMEAKSKRKPSPATSVVGPGLVLVKQEIDKILS*
Ga0055439_1021663723300004019Natural And Restored WetlandsMRSRIPPNMFRDKASILMEAKAKRKPVSATSVVGIGLVSVQQKMDKDLL*
Ga0062589_10017554123300004156SoilMFRDKASILMEAKSKRKPVSATFVVEIGLVSAEQKKDHLSL*
Ga0062592_10119254023300004480SoilMFRDKASILMEANAKRKPISTTSVVGIGLVSVQQKKDKELP*
Ga0062591_10289360513300004643SoilMFRDKASILMEAKSKRKPISATSVVGTGLVSVQQKKDNLSL*
Ga0068997_1010455623300005204Natural And Restored WetlandsMEGRIPSNMFRDKASILMEAKSKRKPISATSVVGIGLVSVKQKKDNVSL*
Ga0065705_1078088013300005294Switchgrass RhizosphereLPIGSTIQPNMFRDQASILVEVKSKRKPSSATPVVGFGLVLVNQEIDKTLS*
Ga0070682_10181765123300005337Corn RhizosphereMFRDRASILMEAKAKRKPTSTTSVVGFGHVSVDQEIRKIK*
Ga0070699_10000227583300005518Corn, Switchgrass And Miscanthus RhizosphereMFRDHASILMEAKSKRKPTFTTSVVGFGHVSVNQEKGKD*
Ga0073902_1003537023300005656Activated SludgeMFRDKASILMEAKSKRKPVSTTSVVGIGLASVEQNQEKDSP*
Ga0074479_1027805523300005829Sediment (Intertidal)MFRDKASILMEAKSKREPISATSVVGIGLVSVKQKKDKVSL*
Ga0074479_1103944023300005829Sediment (Intertidal)MFRDKASILMEAKSKRKPISATQVVGIGLASVEQKKDKDLL*
Ga0074471_1082203013300005831Sediment (Intertidal)MFRDKASILMEAKSKRKPISATSVVGIGLVSVKQKKDNVSL*
Ga0074470_1144159123300005836Sediment (Intertidal)KASILMEAKSKRKPISATVVVGIGLISVNQKKDNVRP*
Ga0074470_1171708823300005836Sediment (Intertidal)RVEYRSTMYRDKASILMEAKSKREPVSATSVVGVGLASVKQKKDNVSL*
Ga0075278_104737313300005893Rice Paddy SoilMKSRIPFNMFRDKASILMEAKAKRKPISATSVVGIGLVSVKQNKNKTSL*
Ga0075274_106479923300005901Rice Paddy SoilMFRDKASILMEAKSKRKPNSATSVVGFGLVSVKQKRDK*
Ga0075156_1001698923300005982Wastewater EffluentMFRDQASILMEAKTKRKPMSTTAVVGSGHVSVKQEMGKTLL*
Ga0079222_1054562013300006755Agricultural SoilILMEAKSKRKPISATSVVGIGLVSVKQKKDKLPL*
Ga0075421_10024314533300006845Populus RhizosphereRSRIPPNMYRDRASILMEAKSKRKPISATSVVGIGLVSVKQKKDSLFL*
Ga0075430_10126650423300006846Populus RhizosphereMFRDQASILMEAKSKRKPSSTTPVVGFGLVLVNQDIDKSVS*
Ga0075433_1002355923300006852Populus RhizosphereMFRDKASILMEAKSKRKPISATSVVGTGLVSVKQKIDKGLL*
Ga0073934_100000751173300006865Hot Spring SedimentMFRDKASILMEAKSKRKPISATSVVGIGLVPVEQKKDNALV*
Ga0073934_1053621623300006865Hot Spring SedimentMFRDRASILMEAKAKRAPSSATSVVGFGHVSVPQGMSR
Ga0075429_10114736123300006880Populus RhizosphereASILMEAKSKRKPISATSVVGIGLVSVKQKKDKLPL*
Ga0075424_10137423113300006904Populus RhizosphereMRSRIPPNMFRDKASILMEAKSKRKPISAPSVVGIGLVSVKQKK
Ga0079218_1121966313300007004Agricultural SoilMYRDRASILMEAKSKRKPISATLVVGIGLVAVKQKKDNLSI*
Ga0105106_1099311923300009078Freshwater SedimentDRASILMEAKSKRKPISATLVVGIGLVSVKQKKDKVSL*
Ga0113563_1372006023300009167Freshwater WetlandsMLQDQAAFLMEAKSKRKPISATSVVGTGLVLVKQKRGHLSL*
Ga0105104_1033331913300009168Freshwater SedimentMSSIFCFETKAKRKPISATPVVGFGLDLVKQEIDK
Ga0105347_114030513300009609SoilMESRIPSNMFRDKASILMEAKSKRKPISATPVVGIGLVSVKQKKDKTSL*
Ga0105252_1032792513300009678SoilASILMEAKSKRKPTFTTTVVGSGHVSVDQEKGKDLL*
Ga0131077_1000391213300009873WastewaterMFRDKASILMEAKSKRKPISATSVVGIGLVSVEQNQKKDLL*
Ga0126304_1059243923300010037Serpentine SoilMRGRIPPNMFRDKASILMEANAKRKPISTTSVVGIGLVSVDQKKDNVSL*
Ga0126304_1087593323300010037Serpentine SoilMLPNMFRDHASILMEAKSKRKPTFTTAVVGSGHVSVNQEKGKDLP*
Ga0126304_1095807823300010037Serpentine SoilMFRDRASILMEAKAKRKPTSATSVVGFGLVSVDQEIKKIK*
Ga0126315_1003223023300010038Serpentine SoilMFRDKASILMEAKSKRKPSPAAPVVGFGLVLVYQEEERLSL*
Ga0126314_1054446113300010042Serpentine SoilSRIPPNMFRDKASILMEANAKRKPISATSVVGTGLASVDQKTDNVSL*
Ga0126306_1012912423300010166Serpentine SoilMYGDRASILMEAKSKRKPISATSVVGIGLVSVYQKKDNLSL*
Ga0126377_1003286733300010362Tropical Forest SoilMFRDKASILMEVKSKRKPISATAVVGIGLVSVKQKTDNVSL*
Ga0105239_1344335323300010375Corn RhizosphereRIPPNMFRDKASILMEAKSKRKPISATSVVGTGLVSVKQKSDKLPL*
Ga0134127_1172638213300010399Terrestrial SoilSRIPPNMYRDKASILMEAKSKRKPISATSVVGTGLVSVKQKSDKLPL*
Ga0136851_1076714723300010413Mangrove SedimentMESRIPPNMFRDKASILMEAKSKREPISATSVVGIGLVLVKQKKDIVSS*
Ga0137444_102731123300011397SoilRIPPNMFRDKASILMEANAKRKPISATSVVGIGLVSVQQKKAKVSL*
Ga0137356_111176213300011402SoilDKASILMEAKSKRKPVFATSVVEIGLVSVDQKKDNLSL*
Ga0137340_110014723300011405SoilPSNMFRDKASILMEAKSKREPISATSVVGIGLVSVKQKKDKVSL*
Ga0137440_113464813300011410SoilSILMEAKSKRKPMFTTSVVGFGHVLVNQEMGKDSL*
Ga0137425_115295113300011422SoilMFRDEASILMEAKAKRKPTSTTSVVGTGLVSVDQKKDNVSL*
Ga0137439_113880513300011424SoilMEGRIPSNMFRDKASILMEAKSKRKPISATSVVGIGLVSIKQKKDKTSL*
Ga0137438_102878223300011431SoilMEGRIPSNMFRDKANILMEAKSKREPISATSVVGIGLVSVKQKKDKVSL*
Ga0119867_104276613300012018Activated SludgeMFRDKASILMEAKSKRKPISTTSVVGIGLASVEQNQKKDLP*
Ga0137353_100137823300012157SoilMFRDHASILMEAKSKRKPTFTTSVVGFGHVLVNQEKGKGLL*
Ga0137353_100524523300012157SoilMKSRIPSNMFRDKASILMEAKSKREPISATSVVGIGLVSVKQKKDNVSL*
Ga0137355_101714523300012163SoilMFRDHASILMEAKSKRKPTFTTSVVGFGHVSVNQEKGKDLL*
Ga0137357_105331423300012168SoilMFRDHASILMEAKSKRKPTFTTSVVGFGHVSVHQEKGKDLL*
Ga0137374_1031405823300012204Vadose Zone SoilMRGKIPPNMFRDKASILMEANAKRKPTSATSVVGTGLGSVDQKKDNLSL*
Ga0137434_104335413300012225SoilMFRDKASILMEAKSKRKPISATSVVGIGLVSVKQKKDKASL*
Ga0126375_1023043123300012948Tropical Forest SoilMFRDKASILMEAKSKRKPVSATQVVGIGLISVKQIQAKVLV*
Ga0126369_1250890713300012971Tropical Forest SoilNMFRDKASILMEAKSKRKPVSATQVVEIGLISVKQIQAKVLV*
Ga0075312_107230323300014254Natural And Restored WetlandsMFRDQASILMEAKSKRKPSPATSVVGLGLVLVKQEIDKILS*
Ga0075301_113352713300014262Natural And Restored WetlandsMFRDKASILMEAKAKRKPVSATSVVGIGLVSVQQKMDNDLL*
Ga0182027_1073644423300014839FenDTFHNRSRIPPNMFRDKASILMEARSKRMPNFATMVVGFGLVLVNKK*
Ga0180096_101394223300014862SoilMKSRIPFNMFRDKASILMEAKSKRKPISATSVVGIGLVSIKQKKDKISL*
Ga0180084_112517613300014874SoilMFRDRASILMEAKSKRKPTFTTTVVGSGHVSVDQEKGKDLL
Ga0180094_107803113300014881SoilIPSNMFRDKASILMEAKSKREPISATSVVGIGLVSVKQKKDNVSL*
Ga0180069_103448913300014882SoilMFRDKASILMEANAKRKPISATSVVGIGLVSVKQKKDKASL*
Ga0132258_1362720013300015371Arabidopsis RhizospherePKMYRDKASILMEAKSKRKPISATPVVESGLVSVKQEKDKMSL*
Ga0190269_1067800513300018465SoilMFRDQANILLEAKSKRKPSSATSVVGLGLVLVKQETDKILS
Ga0190271_1037270623300018481SoilMFRDRASILMEAKAKRKPTSATSVVGFGLVSVDQEIKKIK
Ga0210377_1009874313300021090Groundwater SedimentVLRSRIPPNMFRDKASILMEANTKRRPISATSVVGIGLLSVDQKMDNLSL
Ga0210377_1051990423300021090Groundwater SedimentNMFRDHASILMEAKSKRKPMFTTSVVGSGHVSVDQEKGKDLL
Ga0255842_100524623300023211Activated SludgeFRDRASILMEAKAKRKPFSTTPVVGNGHVSVEQVIKKNSE
Ga0209172_100000232573300025310Hot Spring SedimentMFRDKASILMEAKSKRKPISATSVVGIGLVPVEQKKDNALV
Ga0210139_106328513300025558Natural And Restored WetlandsMFRDKASILMEAKAKRKPVSATSVVGIGLVSVQQKMDK
Ga0207687_1085782823300025927Miscanthus RhizosphereASILMEAKSKRKPISATSVVGTGLVSVKQKSDKLPL
Ga0207670_1123800123300025936Switchgrass RhizosphereMFRDRASILMEAKAKCKPLSATTVVGIGLVSVKQKKDKVSL
Ga0207712_1210659513300025961Switchgrass RhizosphereMFRDRASILMEAKAKRKPISATTVVGIGLVSVKQKKDKVS
Ga0256817_103369013300026373SedimentSRIPSNMFRDKASILMEAKSKRKPVSTTSVVGIGLVSVQQKNR
Ga0209575_1004926923300027739FreshwaterMFRDRASILMQAKAKRMPISATMVVGFGLVSVQQKIGENKALL
Ga0209277_10000787103300027776Wastewater EffluentMFRDQASILMEAKTKRKPMSTTAVVGSGHVSVKQEMGKTLL
Ga0209706_1054152323300027818Freshwater SedimentMSSRILPNMYRDQASILMEAKSKRKPISATLVVGIGLVSVKQKK
Ga0209797_1038220113300027831Wetland SedimentILHSRIPPNMFRDEASILMDANAKRKPVSTTSVVGIGLVSVDQKKDSLSL
Ga0208980_1044034823300027887WetlandMLRDQAGIPMEAKSKRKPISATSVVGTGLVSVKQEKDRLSL
Ga0311337_1142563513300030000FenMFRDKASILMEAKAKRQPISATTVVGIGLVSVKQKKDKVSL
Ga0311366_1152101223300030943FenASILMEAKAKRQPISATTVVGFGLVSVKQKKDKVSL
Ga0302321_10195465323300031726FenMFRDRASILMQAKAKRMPTSATTVVGVGLVSVKQKMDKNK
Ga0302321_10242256123300031726FenMFRDKASILMEAKAKRKPISTTLVVGIGHVSVKQDSTKNAA
Ga0315910_1040334323300032144SoilDQASILMEAKAKRKPISATQVVGIGLVSVQQKKAKDLL
Ga0310810_1071777823300033412SoilMFRDQASILMEANSKRKPISATSVVGIGLVSVYQMKEKVSL
Ga0370479_0035171_2_1093300034123Untreated Peat SoilMFRAKASILMEAKAKRKPISATSVVGTGLVSVYQKK
Ga0370490_0024250_631_7563300034128Untreated Peat SoilMFRDKASILMEAKAKRKPISTTSVVGTGLVSVDQKKDNLSL
Ga0370490_0036008_1357_14823300034128Untreated Peat SoilMFRDKASILMEAKSKRKPSSATSVVGLGLVLVKQEIDKILS
Ga0370506_056530_431_5563300034157Untreated Peat SoilMFRDKASILMEAKSKLKPTGTTSVVGTGLVSVDQKKDNLSL
Ga0370499_0054148_119_2443300034194Untreated Peat SoilMFRDKASILMEAKSKRKPSSATSVVGLGLVLDKQEIDKILS
Ga0370499_0235187_194_3133300034194Untreated Peat SoilMFRDRASILMQAKAKRMPISAASVVGFGLVSVKQKMDKK


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.