NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F097079

Metagenome / Metatranscriptome Family F097079

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F097079
Family Type Metagenome / Metatranscriptome
Number of Sequences 104
Average Sequence Length 45 residues
Representative Sequence IGPPCYVPRVTDAALLERLQGQMEQELRRLYGVARDALVRRG
Number of Associated Samples 99
Number of Associated Scaffolds 104

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 0.00 %
% of genes near scaffold ends (potentially truncated) 100.00 %
% of genes from short scaffolds (< 2000 bps) 93.27 %
Associated GOLD sequencing projects 95
AlphaFold2 3D model prediction Yes
3D model pTM-score0.58

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (99.038 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(28.846 % of family members)
Environment Ontology (ENVO) Unclassified
(25.962 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(49.038 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 41.43%    β-sheet: 0.00%    Coil/Unstructured: 58.57%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.58
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 104 Family Scaffolds
PF08447PAS_3 13.46
PF01075Glyco_transf_9 9.62
PF08448PAS_4 3.85
PF00535Glycos_transf_2 1.92
PF13188PAS_8 0.96
PF07578LAB_N 0.96
PF13426PAS_9 0.96
PF11937DUF3455 0.96

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 104 Family Scaffolds
COG0859ADP-heptose:LPS heptosyltransferaseCell wall/membrane/envelope biogenesis [M] 9.62
COG3952Uncharacterized N-terminal domain of lipid-A-disaccharide synthaseGeneral function prediction only [R] 0.96


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms99.04 %
UnclassifiedrootN/A0.96 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300001084|JGI12648J13191_1012041All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria837Open in IMG/M
3300001867|JGI12627J18819_10371871All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria579Open in IMG/M
3300005181|Ga0066678_10189811All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria1307Open in IMG/M
3300005184|Ga0066671_10339195All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria951Open in IMG/M
3300005186|Ga0066676_10471756All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria851Open in IMG/M
3300005335|Ga0070666_11469396All Organisms → cellular organisms → Bacteria510Open in IMG/M
3300005439|Ga0070711_100242551All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria1410Open in IMG/M
3300005450|Ga0066682_10277686All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium1080Open in IMG/M
3300005530|Ga0070679_100744147All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium923Open in IMG/M
3300005533|Ga0070734_10445644All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium738Open in IMG/M
3300005538|Ga0070731_10517948All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium794Open in IMG/M
3300005566|Ga0066693_10323311All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium618Open in IMG/M
3300005591|Ga0070761_10155894All Organisms → cellular organisms → Bacteria1339Open in IMG/M
3300005764|Ga0066903_100280618All Organisms → cellular organisms → Bacteria2611Open in IMG/M
3300005921|Ga0070766_11130217All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium541Open in IMG/M
3300006755|Ga0079222_11455933All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium638Open in IMG/M
3300006797|Ga0066659_10258673All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria1307Open in IMG/M
3300006800|Ga0066660_10884190All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria728Open in IMG/M
3300006806|Ga0079220_10855854All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium698Open in IMG/M
3300009545|Ga0105237_10349630All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium1483Open in IMG/M
3300009820|Ga0105085_1043939All Organisms → cellular organisms → Bacteria802Open in IMG/M
3300009826|Ga0123355_11977128All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium542Open in IMG/M
3300010044|Ga0126310_10936105Not Available678Open in IMG/M
3300010361|Ga0126378_10429765All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria1434Open in IMG/M
3300010376|Ga0126381_100969131All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium1226Open in IMG/M
3300011120|Ga0150983_12695775All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria914Open in IMG/M
3300012198|Ga0137364_10205646All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria1444Open in IMG/M
3300012917|Ga0137395_10909176All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria636Open in IMG/M
3300012927|Ga0137416_10450695All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria1100Open in IMG/M
3300012930|Ga0137407_10558204All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium1072Open in IMG/M
3300012931|Ga0153915_11538777All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium778Open in IMG/M
3300012975|Ga0134110_10319356All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria674Open in IMG/M
3300013105|Ga0157369_10339445All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium1561Open in IMG/M
3300015372|Ga0132256_100393983All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria1486Open in IMG/M
3300016270|Ga0182036_10450844All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria1011Open in IMG/M
3300016294|Ga0182041_11505089All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria620Open in IMG/M
3300016341|Ga0182035_11089588All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria710Open in IMG/M
3300016404|Ga0182037_10513684All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria1006Open in IMG/M
3300016422|Ga0182039_11306187All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria657Open in IMG/M
3300017927|Ga0187824_10003685All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria4175Open in IMG/M
3300017930|Ga0187825_10130876All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria880Open in IMG/M
3300017947|Ga0187785_10260822All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria781Open in IMG/M
3300018034|Ga0187863_10172506All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria1205Open in IMG/M
3300018058|Ga0187766_10194435All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria1279Open in IMG/M
3300018086|Ga0187769_10096152All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium2123Open in IMG/M
3300020170|Ga0179594_10127853All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria929Open in IMG/M
3300020583|Ga0210401_10373757All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium1287Open in IMG/M
3300020583|Ga0210401_11452241All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria543Open in IMG/M
3300021168|Ga0210406_10364374All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium1164Open in IMG/M
3300021178|Ga0210408_10042937All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria3543Open in IMG/M
3300021180|Ga0210396_10273671All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium1499Open in IMG/M
3300021181|Ga0210388_10719828All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium869Open in IMG/M
3300021402|Ga0210385_11070232All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium619Open in IMG/M
3300021405|Ga0210387_11322550All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium622Open in IMG/M
3300021432|Ga0210384_10393855All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium1248Open in IMG/M
3300021444|Ga0213878_10288901All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria702Open in IMG/M
3300021476|Ga0187846_10269977All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium705Open in IMG/M
3300021477|Ga0210398_11329812All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium564Open in IMG/M
3300021560|Ga0126371_11043318All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria958Open in IMG/M
3300022467|Ga0224712_10501126All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria587Open in IMG/M
3300025914|Ga0207671_10291473All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium1288Open in IMG/M
3300026296|Ga0209235_1279949All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium510Open in IMG/M
3300026330|Ga0209473_1088158All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria1303Open in IMG/M
3300026333|Ga0209158_1342269All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium519Open in IMG/M
3300026547|Ga0209156_10337139All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria662Open in IMG/M
3300027853|Ga0209274_10215631All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria978Open in IMG/M
3300027879|Ga0209169_10377986All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria745Open in IMG/M
3300027986|Ga0209168_10149206All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium1186Open in IMG/M
3300028536|Ga0137415_11279984All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium551Open in IMG/M
3300028906|Ga0308309_10651699All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium915Open in IMG/M
3300031507|Ga0307509_10260343All Organisms → cellular organisms → Bacteria1511Open in IMG/M
3300031549|Ga0318571_10402410All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium535Open in IMG/M
3300031564|Ga0318573_10463236All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria682Open in IMG/M
3300031668|Ga0318542_10153696All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria1145Open in IMG/M
3300031708|Ga0310686_114145568All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria543Open in IMG/M
3300031715|Ga0307476_10062718All Organisms → cellular organisms → Bacteria2559Open in IMG/M
3300031720|Ga0307469_11238995All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria706Open in IMG/M
3300031720|Ga0307469_12367044All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria518Open in IMG/M
3300031740|Ga0307468_101211193All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria681Open in IMG/M
3300031740|Ga0307468_102423813All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria512Open in IMG/M
3300031744|Ga0306918_10407818All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria1059Open in IMG/M
3300031753|Ga0307477_10893882All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria586Open in IMG/M
3300031778|Ga0318498_10455965All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria565Open in IMG/M
3300031782|Ga0318552_10154579All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria1153Open in IMG/M
3300031792|Ga0318529_10065839All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria1590Open in IMG/M
3300031794|Ga0318503_10253001All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria571Open in IMG/M
3300031819|Ga0318568_10690023All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria635Open in IMG/M
3300031823|Ga0307478_10322119All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria1269Open in IMG/M
3300031831|Ga0318564_10460569All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria553Open in IMG/M
3300031831|Ga0318564_10517988All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria517Open in IMG/M
3300031832|Ga0318499_10129458All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria982Open in IMG/M
3300031835|Ga0318517_10122995All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria1149Open in IMG/M
3300031942|Ga0310916_10551377All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria981Open in IMG/M
3300031945|Ga0310913_10051444All Organisms → cellular organisms → Bacteria2690Open in IMG/M
3300032001|Ga0306922_12338109All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium512Open in IMG/M
3300032008|Ga0318562_10439952All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria757Open in IMG/M
3300032035|Ga0310911_10816353All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria539Open in IMG/M
3300032044|Ga0318558_10269127All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria840Open in IMG/M
3300032051|Ga0318532_10286277All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria585Open in IMG/M
3300032068|Ga0318553_10007421All Organisms → cellular organisms → Bacteria4654Open in IMG/M
3300032180|Ga0307471_100434091All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria1449Open in IMG/M
3300032180|Ga0307471_101046826All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria982Open in IMG/M
3300033290|Ga0318519_10675204All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria631Open in IMG/M
3300033807|Ga0314866_033435All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria800Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil28.85%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil9.62%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil8.65%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil6.73%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil5.77%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil4.81%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil2.88%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil2.88%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland2.88%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil2.88%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment1.92%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil1.92%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere1.92%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland0.96%
Freshwater WetlandsEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands0.96%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.96%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil0.96%
Bulk SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Bulk Soil0.96%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil0.96%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere0.96%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil0.96%
PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland0.96%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil0.96%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere0.96%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere0.96%
Groundwater SandEnvironmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand0.96%
BiofilmEnvironmental → Terrestrial → Cave → Unclassified → Unclassified → Biofilm0.96%
Termite GutHost-Associated → Arthropoda → Digestive System → Gut → Unclassified → Termite Gut0.96%
EctomycorrhizaHost-Associated → Plants → Roots → Unclassified → Unclassified → Ectomycorrhiza0.96%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.96%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere0.96%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere0.96%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300001084Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_O1EnvironmentalOpen in IMG/M
3300001867Texas A ecozone_OM1H0_M2 (Combined assembly for Texas A ecozone Site metagenome samples, ASSEMBLY_DATE=20130705)EnvironmentalOpen in IMG/M
3300005181Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127EnvironmentalOpen in IMG/M
3300005184Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120EnvironmentalOpen in IMG/M
3300005186Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125EnvironmentalOpen in IMG/M
3300005335Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaGHost-AssociatedOpen in IMG/M
3300005439Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaGEnvironmentalOpen in IMG/M
3300005450Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131EnvironmentalOpen in IMG/M
3300005530Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaGEnvironmentalOpen in IMG/M
3300005533Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1EnvironmentalOpen in IMG/M
3300005538Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1EnvironmentalOpen in IMG/M
3300005566Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142EnvironmentalOpen in IMG/M
3300005591Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1EnvironmentalOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300005921Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6EnvironmentalOpen in IMG/M
3300006755Agricultural soil microbial communities from Georgia to study Nitrogen management - GA PlitterEnvironmentalOpen in IMG/M
3300006797Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108EnvironmentalOpen in IMG/M
3300006800Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109EnvironmentalOpen in IMG/M
3300006806Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100EnvironmentalOpen in IMG/M
3300009545Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaGHost-AssociatedOpen in IMG/M
3300009820Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_50_60EnvironmentalOpen in IMG/M
3300009826Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1Host-AssociatedOpen in IMG/M
3300010044Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot60EnvironmentalOpen in IMG/M
3300010361Tropical forest soil microbial communities from Panama - MetaG Plot_23EnvironmentalOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300011120Combined assembly of Microbial Forest Soil metaTEnvironmentalOpen in IMG/M
3300012198Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012917Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaGEnvironmentalOpen in IMG/M
3300012927Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012930Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012931Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaGEnvironmentalOpen in IMG/M
3300012975Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_11112015EnvironmentalOpen in IMG/M
3300013105Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaGHost-AssociatedOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300016270Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080EnvironmentalOpen in IMG/M
3300016294Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178EnvironmentalOpen in IMG/M
3300016341Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170EnvironmentalOpen in IMG/M
3300016404Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082EnvironmentalOpen in IMG/M
3300016422Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111EnvironmentalOpen in IMG/M
3300017927Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_4EnvironmentalOpen in IMG/M
3300017930Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_5EnvironmentalOpen in IMG/M
3300017947Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_4_20_MGEnvironmentalOpen in IMG/M
3300018034Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_10EnvironmentalOpen in IMG/M
3300018058Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MGEnvironmentalOpen in IMG/M
3300018086Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MGEnvironmentalOpen in IMG/M
3300020170Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_1_08_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300020583Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-MEnvironmentalOpen in IMG/M
3300021168Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-MEnvironmentalOpen in IMG/M
3300021178Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-MEnvironmentalOpen in IMG/M
3300021180Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-OEnvironmentalOpen in IMG/M
3300021181Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-OEnvironmentalOpen in IMG/M
3300021402Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-OEnvironmentalOpen in IMG/M
3300021405Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-OEnvironmentalOpen in IMG/M
3300021432Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-MEnvironmentalOpen in IMG/M
3300021444Vellozia epidendroides bulk soil microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - BS_R02EnvironmentalOpen in IMG/M
3300021476Biofilm microbial communities from the roof of an iron ore cave, State of Minas Gerais, Brazil - TC_06 Biofilm (v2)EnvironmentalOpen in IMG/M
3300021477Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-OEnvironmentalOpen in IMG/M
3300021560Tropical forest soil microbial communities from Panama - MetaG Plot_4EnvironmentalOpen in IMG/M
3300022467Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300025914Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026296Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_20cm (SPAdes)EnvironmentalOpen in IMG/M
3300026330Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 (SPAdes)EnvironmentalOpen in IMG/M
3300026333Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 (SPAdes)EnvironmentalOpen in IMG/M
3300026547Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 (SPAdes)EnvironmentalOpen in IMG/M
3300027853Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 (SPAdes)EnvironmentalOpen in IMG/M
3300027879Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 (SPAdes)EnvironmentalOpen in IMG/M
3300027986Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300028536Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300028906Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2)EnvironmentalOpen in IMG/M
3300031507Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EMHost-AssociatedOpen in IMG/M
3300031549Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f24EnvironmentalOpen in IMG/M
3300031564Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21EnvironmentalOpen in IMG/M
3300031668Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23EnvironmentalOpen in IMG/M
3300031708FICUS49499 Metagenome Czech Republic combined assemblyEnvironmentalOpen in IMG/M
3300031715Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05EnvironmentalOpen in IMG/M
3300031720Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515EnvironmentalOpen in IMG/M
3300031740Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05EnvironmentalOpen in IMG/M
3300031744Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2)EnvironmentalOpen in IMG/M
3300031753Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515EnvironmentalOpen in IMG/M
3300031778Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f24EnvironmentalOpen in IMG/M
3300031782Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f20EnvironmentalOpen in IMG/M
3300031792Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f23EnvironmentalOpen in IMG/M
3300031794Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f23EnvironmentalOpen in IMG/M
3300031819Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21EnvironmentalOpen in IMG/M
3300031823Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05EnvironmentalOpen in IMG/M
3300031831Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f20EnvironmentalOpen in IMG/M
3300031832Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f25EnvironmentalOpen in IMG/M
3300031835Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f21EnvironmentalOpen in IMG/M
3300031942Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176EnvironmentalOpen in IMG/M
3300031945Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082EnvironmentalOpen in IMG/M
3300032001Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2)EnvironmentalOpen in IMG/M
3300032008Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f18EnvironmentalOpen in IMG/M
3300032035Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170EnvironmentalOpen in IMG/M
3300032044Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f20EnvironmentalOpen in IMG/M
3300032051Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f26EnvironmentalOpen in IMG/M
3300032068Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f21EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300033290Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15EnvironmentalOpen in IMG/M
3300033807Tropical peat soil microbial communities from peatlands in Loreto, Peru - MAQ_100_10EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI12648J13191_101204113300001084Forest SoilPYYVPRVTDSAILARLQGEMEQELRRLYGVARAALRAPGRAAG*
JGI12627J18819_1037187113300001867Forest SoilCYVPRVTDAAELGRWQERMEKELKRLFGVARAALEGDSVN*
Ga0066678_1018981123300005181SoilFSRIAIAIGPPYYVPRVSDASSLARLQSQMEQELKRLYGVARAALHPG*
Ga0066671_1033919523300005184SoilIAIGPPCYVPRVTDPPSLARLQSQMEQELKRLYGVARAALCRD*
Ga0066676_1047175623300005186SoilPFSRIAIAIGPPCYVPRVSDASSLARLQSQMEQELKRLYGVARAALHPD*
Ga0070666_1146939623300005335Switchgrass RhizosphereFVIPVPFSRVAIAIGPPRYVPRTTAAAGVESLQGEMEQELKRLYGVAQDALGKR*
Ga0070711_10024255113300005439Corn, Switchgrass And Miscanthus RhizosphereIGPPCYVPRVTDAATLEQLQGKMEEELRRLFAVARQALQRGR*
Ga0066682_1027768613300005450SoilAIAIGPPCYVPRVTDPPSLARLQSQMEQELKRLYGVARAALCRD*
Ga0070679_10074414713300005530Corn RhizosphereVIPVPFSRVAIAIGPPRYVPRTTGAGIESLQGEMEQELERLYRVARDALAKR*
Ga0070734_1044564413300005533Surface SoilFSRVAIAIGPPRYVPRTSSAGGIEALQGEMEQELKRLYGVARDALVKP*
Ga0070731_1051794823300005538Surface SoilFLARIAIAIGPPRYVARVNGAAGLAQLQGEMERELHRVYGVARDALGRQR*
Ga0066693_1032331113300005566SoilARVALAIGPPRYVPRVTHAAALEALQAQMEQELKRLFILAKGALNTH*
Ga0070761_1015589413300005591SoilFVIPMPFSRIAIAIGAPYYVPRVTDSAILARLQAEMEQELRRLYGVARAALRAPGRAAG*
Ga0066903_10028061813300005764Tropical Forest SoilAPCYVPRVTDATTLGKLQGKMEEELRRLFAVAREALQRRR*
Ga0070766_1113021713300005921SoilRVVIAIGPPRYIPRTTAAPGIEALQVEMERELQRLYGVARDALGQR*
Ga0079222_1145593313300006755Agricultural SoilIAIGPPRYVPRTTGAGIESLQGEMEQELKRLYGVARDALANS*
Ga0066659_1025867313300006797SoilVPRVTDPPSLARLQSQMEQELKRLYGVARAALCRD*
Ga0066660_1088419023300006800SoilVPFSRIAIAIGPPFYVPRVTDAALLERLAGEMEGELKRLYGVARAALRAR*
Ga0079220_1085585413300006806Agricultural SoilIPVPFLARIAIAVGPPHYVPRVMDAVGLARLEGEMERELHRLFGVARAALAQAR*
Ga0105237_1034963023300009545Corn RhizosphereIPVPFSRVAIAIGPPRYVPRTTAAAGVESLQVAMEQELQRLYGVAKDALEKR*
Ga0105085_104393913300009820Groundwater SandPRYVPRVTDSASLERMQGELKSELKRLYGVARASLQGHAP*
Ga0123355_1197712813300009826Termite GutIAIGPPFQVPRVTDAATLARLQNQMEAELHRLYGVARDALR*
Ga0126310_1093610513300010044Serpentine SoilIAIVIGAPRYVARVTDAAAIEKMQGEMELELKRLFEVARAAL*
Ga0126378_1042976523300010361Tropical Forest SoilPVPFARIAIAIGPPCYVPRVTDAASLERLQRQMEAELKRLYEVARAALGTRG*
Ga0126381_10096913123300010376Tropical Forest SoilYVPRVMDATGLERLEGEMERELHRLYGTAREALGGRG*
Ga0150983_1269577513300011120Forest SoilIGPPCYVPRVTDAPSLTRLQSQMEQELKRLYGVARAALQPNPGGFC*
Ga0137364_1020564613300012198Vadose Zone SoilGPPCYVPRVTDPPSLARLQSQMEQELKRLYGVARGALCRD*
Ga0137395_1090917623300012917Vadose Zone SoilVPFSRIAIAIGPPCYVARTTDPATLEALQSQMERELKRLFAEARAALR*
Ga0137416_1045069523300012927Vadose Zone SoilVTDAPSLARLQSQMEQELKRLYAVARAALQPHGEGFC*
Ga0137407_1055820423300012930Vadose Zone SoilVPFARVALAIGPPRYVPRVTDAAALEALQAQMEQELKRLFTVAKGALNTD*
Ga0153915_1153877713300012931Freshwater WetlandsPMPFAKIAIAIGAPRYVPRVTDPAGLESLQAEMESELKRLYETARSALHGKRS*
Ga0134110_1031935613300012975Grasslands SoilVPFSRIAIAIGPPFYVPRVTDAALLERLAGEMEGELKRLYAVARAALRAR*
Ga0157369_1033944513300013105Corn RhizosphereFSRVAIAIGPPRYVPRTTAVASVESLQGEMEQELKRLYGVARDALAKR*
Ga0132256_10039398323300015372Arabidopsis RhizosphereGPPCYVPRVTDAPTLERLQIQMEEELGRLFGVAREALREGG*
Ga0182036_1045084413300016270SoilVPRVTDAAMLERLQGQLELELRRLYEVARDALTRRD
Ga0182041_1150508923300016294SoilGPPCYVPRVTDAASLERLQGRLEVELKRLYEVAREALVRRT
Ga0182035_1108958823300016341SoilVAIAIGPPCYVPRVTDAASLARLQQQMEEELKRLYGVARDALEAP
Ga0182037_1051368423300016404SoilGPPCYVPRVTDAASLARLQQQMEEELKRLYGVARDALEAP
Ga0182039_1130618713300016422SoilIGPPCYVPRVSDAASLEKLQGKMEEELRRLFAVAREALQRRR
Ga0187824_1000368533300017927Freshwater SedimentPFLARIAIAIGPPRYVARVNGAAGLAQLQGEMERELHRVYGVARDALGRQR
Ga0187825_1013087623300017930Freshwater SedimentIGPPCYVPRVTDAPTLERLQRRMEEELKRVFGVAQEALRKVR
Ga0187785_1026082223300017947Tropical PeatlandFVIPVPFSRIAIAVGPPRYVPRVSDRKALERLQAEMELELKRLYLEARAAL
Ga0187863_1017250613300018034PeatlandPPRYIPRVTDAAVLVAVQAEMEAELKRLFGVARAALGSA
Ga0187766_1019443513300018058Tropical PeatlandFSRIAIAIGPPCYVPRVTDAATLERLQGQMEQELKRLYGVARAALRGDSVK
Ga0187769_1009615223300018086Tropical PeatlandVPFSRIAIAIGPPRYVPRVSDAAGLVRLQGQMEEELARLYAVARAALDGKR
Ga0179594_1012785323300020170Vadose Zone SoilAIAIGPPRYVPRVTDAPSLTRLQSQMEQELKRLYGVARAALQPDPGGFC
Ga0210401_1037375713300020583SoilKFVIPVPFLARIAIAIGPPRYVPRVTDAATLATLQAEMERELQRLYGVAREALR
Ga0210401_1145224123300020583SoilIPMPFSRIAIAIGPPCYVPRVTDGATLERLQGRMEEELRRLFEVAREALQARR
Ga0210406_1036437423300021168SoilVAIAIGPPRYVPRTSAAAGIEALQVEMEQELKRLYGVAREALGR
Ga0210408_1004293713300021178SoilGPPCYVPRVTDPPSLARLQSQMEQELKRLYGVARAALHPNPGRFC
Ga0210396_1027367123300021180SoilAWLVKWDKFVIPVPFLARIAIAIGTPRYVARVTDAAGLERLQEEMERELQRLYGVARDVLGERA
Ga0210388_1071982823300021181SoilAIGPPRYVPRVTDAATLATLQAQMERELQRLYGVAREALR
Ga0210385_1107023213300021402SoilPRSNDGAALEVLQGEMERELKRLYGVARAALAPRT
Ga0210387_1132255023300021405SoilPVPFSRVVIAIGPPRYIPRTTAAPGIEALQVEMERELQRLYGVARDALGQR
Ga0210384_1039385513300021432SoilRAWLVKWDKFVIPVPFLARIAIAIGTPRYVARVTDAAGLERLQEEMERELQRLYGVARDVLGERA
Ga0213878_1028890113300021444Bulk SoilPMPFARIAIAIGPPCYVPRVTDAASLERLQLELEQELGKLFGIAREALQAPR
Ga0187846_1026997713300021476BiofilmIGPPRYVSRVTDAAGLARLEEEMEHELHRLYGVARDALAERP
Ga0210398_1132981223300021477SoilPRYIPRATAAPGIEALQAEMEQELKRLYGVARDALVRR
Ga0126371_1104331823300021560Tropical Forest SoilIAIAIGPPCYVPRVTDAAALQRLQEQMEEELKRLYGVARAALDAPA
Ga0224712_1050112623300022467Corn, Switchgrass And Miscanthus RhizosphereRITIAIGPPRYVPRAMDAATLERLQAEMEQELGRVYRLAQSRLRRFERPAEPLE
Ga0207671_1029147313300025914Corn RhizosphereGPPRYVPRTTAAAGVESLQSEMEQELKRLYGVARDALGKR
Ga0209235_127994913300026296Grasslands SoilVVPRVSDASSLARLQSQMEQELKRLYGVARAALHPG
Ga0209473_108815823300026330SoilYVPRVTDPPSLARLQSQMEQELKRLYGVARAALCRD
Ga0209158_134226923300026333SoilPRYVPRVLDAPSLARLQSHMERELKRLYGVARAALHAE
Ga0209156_1033713913300026547SoilCYVPRVTDPPSLARLQSQMEQELKRLYGVARAALCRD
Ga0209274_1021563123300027853SoilAIGPPVYVPRVIGAAGLEGLQRQMEQELKRLYGVARAAVDLGT
Ga0209169_1037798613300027879SoilIPVPFARIALAIGPPVYVPRVVDAAGLERLQRQMEQELKRLYAVARAALST
Ga0209168_1014920613300027986Surface SoilLARIAVAVGPPRYVPRVTDAATLQQLQSEMETELKRLYAQARGMLSGTDS
Ga0137415_1127998423300028536Vadose Zone SoilAIAIGPPRYVPRTSAAAGIEALQVEMEQELDRLYGVARDALGR
Ga0308309_1065169913300028906SoilVIAIGPPRYIPRTTAAPGIEALQVEMEQELQRLYGVARDALGQR
Ga0307509_1026034313300031507EctomycorrhizaGPPVYVPRVMDAASLERKQVELAAELKRLYGVARASLDERAA
Ga0318571_1040241013300031549SoilYVPRVTDAATLKQLQAEMEQELRRLYQQARDALGRS
Ga0318573_1046323623300031564SoilAIGPACYVPRVTDAASLERLRRQMEEELRRLYGVARGALEMHR
Ga0318542_1015369623300031668SoilYVPRVTDAAGLARLQEQMEEELKRLFGVAREALRAAR
Ga0310686_11414556823300031708SoilARIAIAIGPPFYVPRVTDATTLARLQTQMEEELLRLYRVARAALGTV
Ga0307476_1006271823300031715Hardwood Forest SoilFVIPMPFARIAIAIGPPCYVPRVTDAASLARLQGQMEEELRRLFGVAHEALRAAR
Ga0307469_1123899513300031720Hardwood Forest SoilPRVTDAASLTRLQSQMEQELKRLYGVARAALHPNPGGFC
Ga0307469_1236704423300031720Hardwood Forest SoilRIAIAIGEPRYVPRVTDAAALERMQGEMEAELRRLFGVARAALES
Ga0307468_10121119313300031740Hardwood Forest SoilAIAIGAPVYVPRVTDAASLERLQGQMEGTLKGLFGVARAALSGG
Ga0307468_10242381313300031740Hardwood Forest SoilPPYYVPRVTDAASLERLQRHMEGELQRLYGVARAALSPAARVAG
Ga0306918_1040781813300031744SoilARIAIAIGPPCYVPRVTDAASLERLQGQLEVELKRLYEVARQALVRRT
Ga0307477_1089388223300031753Hardwood Forest SoilFVIPMPFSRIAIAIGPACYVPRVTDAPSLARLQSQMEQELKRLYGVARAALHPNPGAFC
Ga0318498_1045596523300031778SoilVIPIPFSRIALAIGPPCYVPRVTDAAMLERLQGQMEQELRRLYGVARDALARRD
Ga0318552_1015457923300031782SoilVPRVTDAASLERLQGRLEVELKRLYEVAREALVRRT
Ga0318529_1006583913300031792SoilPMPFSRIALAIGPPCYVPRVTDAALLERLQGQMEQELRRLYGVARDALVRRG
Ga0318503_1025300113300031794SoilPCYVPRVTDAAGLARLQEQMEEELKRLFGVAREALRAAR
Ga0318568_1069002313300031819SoilCYVPRVTDAASLERLQGRMEEELKRLYAVARAALEAHR
Ga0307478_1032211913300031823Hardwood Forest SoilPPRYVPRATGAAALTQLQGQMQEELKRLYGVARAAL
Ga0318564_1046056923300031831SoilFARIAIAIGAPCYVPRVTDAAAIERLQGQMEADLKRLYEVAREALERRG
Ga0318564_1051798813300031831SoilIGPACYVPRVTDAASLERLRRQMEEELRRLYGVARGALEMHR
Ga0318499_1012945823300031832SoilIGPPCYVPRVTDAALLERLQGQMEQELRRLYGVARDALVRRG
Ga0318517_1012299523300031835SoilGPPCYVPRVTDAASLERLQGRMEEELKRLYAVARAALEAHR
Ga0310916_1055137713300031942SoilAIGPPCYVPRVTDAASLERLQGRLEVELKRLYEVAREALVRRT
Ga0310913_1005144413300031945SoilYVPRVTDAATLERLQRQMEEELRRLYGVAREALERHR
Ga0306922_1233810913300032001SoilGPPCYVPRVTDAAALAGLQSQLELELQRLFAVARAALGPR
Ga0318562_1043995213300032008SoilPCYVPRVSDAASLEKLQGKMEEELRRLFAVAREALQRRR
Ga0310911_1081635323300032035SoilVIPMPFSRIAIAIGPPCYVPRVSDAASLEKLQGKMEEELRRLFAVAREALQRRR
Ga0318558_1026912713300032044SoilFYVPRVTDTALLERLQDQMAEELRKLFGVAREALQKAR
Ga0318532_1028627723300032051SoilYVPRVTDAASLERLQGRLEVELKRLYEVAREALVRRT
Ga0318553_1000742153300032068SoilSRIALAIGPPCYVPRVTDAALLERLQGQMEQELRRLYGVARDALVRRG
Ga0307471_10043409123300032180Hardwood Forest SoilPVPFSSIAIAIGPACYVPRVTDAAALARLQLKMEGELKRLYGVAREALRAR
Ga0307471_10104682623300032180Hardwood Forest SoilIPMPFSRIAIAIGPPCYVPRVTDAPTLTRLQSQMEQELKRLYGVARAALQPSPGAFC
Ga0318519_1067520413300033290SoilFARVAIAIGPPCYVPRVTDAASLARLQQQMEEELKRLYGVARDALEAP
Ga0314866_033435_1_1383300033807PeatlandRIAIAIGPPCYVPRVTDGATLERLQGEMEQELKRLFGVARDALRG


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.