NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F096867

Metagenome / Metatranscriptome Family F096867

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F096867
Family Type Metagenome / Metatranscriptome
Number of Sequences 104
Average Sequence Length 47 residues
Representative Sequence DLLSDEEQFSIWFSKDNDEVRFQAAFKAGVQIAYPDLVVDFRLT
Number of Associated Samples 93
Number of Associated Scaffolds 104

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Unclassified
% of genes with valid RBS motifs 0.96 %
% of genes near scaffold ends (potentially truncated) 93.27 %
% of genes from short scaffolds (< 2000 bps) 93.27 %
Associated GOLD sequencing projects 89
AlphaFold2 3D model prediction Yes
3D model pTM-score0.29

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Unclassified (58.654 % of family members)
NCBI Taxonomy ID N/A
Taxonomy N/A

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater
(23.077 % of family members)
Environment Ontology (ENVO) Unclassified
(41.346 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Water (non-saline)
(41.346 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 15.28%    β-sheet: 0.00%    Coil/Unstructured: 84.72%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.29
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 104 Family Scaffolds
PF00534Glycos_transf_1 7.69
PF07603DUF1566 0.96
PF13692Glyco_trans_1_4 0.96
PF08299Bac_DnaA_C 0.96

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 104 Family Scaffolds
COG0593Chromosomal replication initiation ATPase DnaAReplication, recombination and repair [L] 0.96


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
UnclassifiedrootN/A58.65 %
All OrganismsrootAll Organisms41.35 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300001267|B570J13875_101937Not Available1156Open in IMG/M
3300002201|metazooDRAFT_1275721All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium939Open in IMG/M
3300002408|B570J29032_109165548All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium618Open in IMG/M
3300002835|B570J40625_100313391Not Available1581Open in IMG/M
3300005581|Ga0049081_10284814Not Available572Open in IMG/M
3300005582|Ga0049080_10167643Not Available732Open in IMG/M
3300005940|Ga0073913_10027703Not Available843Open in IMG/M
3300006030|Ga0075470_10138367All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium715Open in IMG/M
3300006805|Ga0075464_10388089Not Available847Open in IMG/M
3300006863|Ga0075459_1065145All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage618Open in IMG/M
3300006875|Ga0075473_10059141Not Available1489Open in IMG/M
3300006875|Ga0075473_10059870All Organisms → Viruses1480Open in IMG/M
3300006917|Ga0075472_10057560All Organisms → Viruses → Predicted Viral1851Open in IMG/M
3300006917|Ga0075472_10238643Not Available895Open in IMG/M
3300007541|Ga0099848_1184294Not Available756Open in IMG/M
3300007547|Ga0102875_1053067Not Available1324Open in IMG/M
3300007551|Ga0102881_1061919Not Available1044Open in IMG/M
3300007551|Ga0102881_1140265Not Available668Open in IMG/M
3300007593|Ga0102918_1100874Not Available858Open in IMG/M
3300007597|Ga0102919_1122030Not Available820Open in IMG/M
3300007600|Ga0102920_1018863All Organisms → Viruses → Predicted Viral2063Open in IMG/M
3300007618|Ga0102896_1093828Not Available980Open in IMG/M
3300007620|Ga0102871_1231690Not Available511Open in IMG/M
3300007716|Ga0102867_1042930All Organisms → Viruses → Predicted Viral1184Open in IMG/M
3300007960|Ga0099850_1275386Not Available643Open in IMG/M
3300007973|Ga0105746_1007948All Organisms → Viruses → Predicted Viral2970Open in IMG/M
3300007974|Ga0105747_1018314All Organisms → Viruses → Predicted Viral1897Open in IMG/M
3300008055|Ga0108970_11232783Not Available827Open in IMG/M
3300008116|Ga0114350_1189224All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.520Open in IMG/M
3300008264|Ga0114353_1397905All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium511Open in IMG/M
3300008265|Ga0114361_1075686Not Available1045Open in IMG/M
3300008339|Ga0114878_1014838Not Available3779Open in IMG/M
3300008510|Ga0110928_1035587All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1595Open in IMG/M
3300009081|Ga0105098_10396184Not Available684Open in IMG/M
3300009165|Ga0105102_10623884Not Available598Open in IMG/M
3300010354|Ga0129333_10149220All Organisms → cellular organisms → Bacteria2146Open in IMG/M
3300010354|Ga0129333_10309517Not Available1412Open in IMG/M
3300010354|Ga0129333_11646178Not Available523Open in IMG/M
3300010368|Ga0129324_10361053Not Available564Open in IMG/M
3300012013|Ga0153805_1062066Not Available633Open in IMG/M
3300012716|Ga0157605_1214039All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium575Open in IMG/M
3300012729|Ga0157625_1198715Not Available814Open in IMG/M
3300012757|Ga0157628_1130058Not Available814Open in IMG/M
3300012988|Ga0164306_11088568All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage664Open in IMG/M
3300013004|Ga0164293_10129473All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetes bacterium RIFCSPHIGHO2_12_39_61900Open in IMG/M
3300013074|Ga0157618_1104954Not Available609Open in IMG/M
(restricted) 3300013126|Ga0172367_10559064Not Available620Open in IMG/M
(restricted) 3300013126|Ga0172367_10728656All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.520Open in IMG/M
(restricted) 3300013130|Ga0172363_10799406Not Available587Open in IMG/M
(restricted) 3300013132|Ga0172372_10420282All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium907Open in IMG/M
(restricted) 3300013133|Ga0172362_10660458Not Available704Open in IMG/M
(restricted) 3300013137|Ga0172375_10548656All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage759Open in IMG/M
3300013295|Ga0170791_10996272Not Available701Open in IMG/M
3300017774|Ga0181358_1172371Not Available725Open in IMG/M
3300017777|Ga0181357_1287924Not Available561Open in IMG/M
3300017785|Ga0181355_1129908Not Available1026Open in IMG/M
3300020083|Ga0194111_10774925Not Available581Open in IMG/M
3300020084|Ga0194110_10225605All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1389Open in IMG/M
3300020183|Ga0194115_10366697Not Available631Open in IMG/M
3300020198|Ga0194120_10333506Not Available744Open in IMG/M
3300020570|Ga0208465_1000972All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetes bacterium RIFCSPHIGHO2_12_39_66653Open in IMG/M
3300020571|Ga0208723_1040115All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage668Open in IMG/M
3300020578|Ga0194129_10284906All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage937Open in IMG/M
3300021093|Ga0194123_10182474All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage1093Open in IMG/M
3300021961|Ga0222714_10641950Not Available525Open in IMG/M
3300021962|Ga0222713_10135658All Organisms → Viruses → Predicted Viral1717Open in IMG/M
3300021963|Ga0222712_10107156All Organisms → cellular organisms → Bacteria1944Open in IMG/M
3300022748|Ga0228702_1023733All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetes bacterium RIFCSPHIGHO2_12_39_61964Open in IMG/M
3300024510|Ga0255187_1054752Not Available534Open in IMG/M
3300024512|Ga0255186_1042513Not Available606Open in IMG/M
3300024571|Ga0256302_1081717Not Available760Open in IMG/M
3300025630|Ga0208004_1115655Not Available620Open in IMG/M
3300025889|Ga0208644_1190317Not Available901Open in IMG/M
3300027260|Ga0208027_1067248Not Available704Open in IMG/M
3300027281|Ga0208440_1066618Not Available766Open in IMG/M
3300027294|Ga0208441_1064235Not Available787Open in IMG/M
3300027304|Ga0208810_1038070Not Available1084Open in IMG/M
3300027492|Ga0255093_1059967Not Available728Open in IMG/M
3300027608|Ga0208974_1115971All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium703Open in IMG/M
3300027798|Ga0209353_10074586All Organisms → Viruses → Predicted Viral1543Open in IMG/M
3300027973|Ga0209298_10346579Not Available569Open in IMG/M
3300029930|Ga0119944_1015912All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1068Open in IMG/M
3300031951|Ga0315904_10209789All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetes bacterium RIFCSPHIGHO2_12_39_61903Open in IMG/M
3300031951|Ga0315904_11181022Not Available589Open in IMG/M
3300032050|Ga0315906_10273601All Organisms → Viruses → Predicted Viral1537Open in IMG/M
3300032050|Ga0315906_11014865All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium622Open in IMG/M
3300032092|Ga0315905_10000926Not Available31972Open in IMG/M
3300032116|Ga0315903_10296603Not Available1368Open in IMG/M
3300033981|Ga0334982_0178333All Organisms → Viruses → Predicted Viral1063Open in IMG/M
3300034012|Ga0334986_0598861All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium525Open in IMG/M
3300034023|Ga0335021_0652292All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium517Open in IMG/M
3300034061|Ga0334987_0123994All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetes bacterium RIFCSPHIGHO2_12_39_61939Open in IMG/M
3300034061|Ga0334987_0359111Not Available939Open in IMG/M
3300034062|Ga0334995_0649180All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium603Open in IMG/M
3300034073|Ga0310130_0016703All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetes bacterium RIFCSPHIGHO2_12_39_62400Open in IMG/M
3300034094|Ga0335014_0123238Not Available1290Open in IMG/M
3300034101|Ga0335027_0382553Not Available919Open in IMG/M
3300034101|Ga0335027_0495275All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium768Open in IMG/M
3300034101|Ga0335027_0507729All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium754Open in IMG/M
3300034106|Ga0335036_0472189Not Available788Open in IMG/M
3300034111|Ga0335063_0342863Not Available775Open in IMG/M
3300034112|Ga0335066_0324754Not Available862Open in IMG/M
3300034119|Ga0335054_0478344All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium700Open in IMG/M
3300034122|Ga0335060_0133755Not Available1460Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater23.08%
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine12.50%
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous10.58%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake6.73%
FreshwaterEnvironmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater5.77%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater3.85%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake3.85%
FreshwaterEnvironmental → Aquatic → Freshwater → River → Unclassified → Freshwater3.85%
Freshwater To Marine Saline GradientEnvironmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient3.85%
Freshwater LenticEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic2.88%
Freshwater, PlanktonEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton2.88%
Estuarine WaterEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water2.88%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment1.92%
SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Sediment1.92%
Estuary WaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water1.92%
LakeEnvironmental → Aquatic → Freshwater → Lentic → Epilimnion → Lake0.96%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater0.96%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake0.96%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater0.96%
AquaticEnvironmental → Aquatic → Freshwater → Drinking Water → Unclassified → Aquatic0.96%
Water BodiesEnvironmental → Aquatic → Freshwater → Unclassified → Unclassified → Water Bodies0.96%
Surface IceEnvironmental → Aquatic → Freshwater → Ice → Unclassified → Surface Ice0.96%
FreshwaterEnvironmental → Aquatic → Freshwater → Creek → Unclassified → Freshwater0.96%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.96%
SandEnvironmental → Terrestrial → Soil → Sand → Unclassified → Sand0.96%
Fracking WaterEnvironmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Fracking Water0.96%
EstuaryHost-Associated → Plants → Leaf → Unclassified → Unclassified → Estuary0.96%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
3300001267Freshwater microbial communities from Lake Mendota, WI - 31AUG2010 deep hole epilimnionEnvironmentalOpen in IMG/M
3300002201Freshwater microbial communities from San Paulo Zoo lake, Brazil - SEP 2013EnvironmentalOpen in IMG/M
3300002408Freshwater microbial communities from Lake Mendota, WI, sample - 15JUL2010 deep hole epilimnion (Lake Mendota Combined assembly, ASSEMBLY_DATE=20140123)EnvironmentalOpen in IMG/M
3300002835Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605)EnvironmentalOpen in IMG/M
3300005581Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRFEnvironmentalOpen in IMG/M
3300005582Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRFEnvironmentalOpen in IMG/M
3300005940Groundwater microbial communities from the Columbia River, Washington, USA, for microbe roles in carbon and contaminant biogeochemistry - GW-RW metaG T4_25-Nov-14EnvironmentalOpen in IMG/M
3300006030Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_<0.8_DNAEnvironmentalOpen in IMG/M
3300006805Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNAEnvironmentalOpen in IMG/M
3300006863Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_0.3_>0.8_DNAEnvironmentalOpen in IMG/M
3300006875Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_>0.8_DNAEnvironmentalOpen in IMG/M
3300006917Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_<0.8_DNAEnvironmentalOpen in IMG/M
3300007541Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaGEnvironmentalOpen in IMG/M
3300007547Estuarine microbial communities from the Columbia River estuary - metaG 1547B-02EnvironmentalOpen in IMG/M
3300007551Estuarine microbial communities from the Columbia River estuary - metaG 1549B-3EnvironmentalOpen in IMG/M
3300007593Estuarine microbial communities from the Columbia River estuary - metaG 1563A-3EnvironmentalOpen in IMG/M
3300007597Estuarine microbial communities from the Columbia River estuary - metaG 1563A-02EnvironmentalOpen in IMG/M
3300007600Estuarine microbial communities from the Columbia River estuary - metaG 1568A-3EnvironmentalOpen in IMG/M
3300007618Estuarine microbial communities from the Columbia River estuary - metaG 1554A-02EnvironmentalOpen in IMG/M
3300007620Estuarine microbial communities from the Columbia River estuary - metaG 1546C-02EnvironmentalOpen in IMG/M
3300007716Estuarine microbial communities from the Columbia River estuary - metaG 1546B-3EnvironmentalOpen in IMG/M
3300007960Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1D Viral MetaGEnvironmentalOpen in IMG/M
3300007973Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460A_0.2umEnvironmentalOpen in IMG/M
3300007974Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460C_0.2umEnvironmentalOpen in IMG/M
3300008055Metatranscriptomes of the Eelgrass leaves and roots. Combined Assembly of Gp0128390, Gp0128391, Gp0128392, and Gp0128393Host-AssociatedOpen in IMG/M
3300008116Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-3-NAEnvironmentalOpen in IMG/M
3300008264Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-53-LTREnvironmentalOpen in IMG/M
3300008265Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample HABS-E2014-0126-100-LTREnvironmentalOpen in IMG/M
3300008339Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - Sept 29, 2014 all contigsEnvironmentalOpen in IMG/M
3300008510Microbial Communities in Water bodies, Singapore - Site RAEnvironmentalOpen in IMG/M
3300009081Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm May2015EnvironmentalOpen in IMG/M
3300009165Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 1-3cm September2015EnvironmentalOpen in IMG/M
3300010354Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNAEnvironmentalOpen in IMG/M
3300010368Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.2_DNAEnvironmentalOpen in IMG/M
3300012013Freshwater microbial communities from Eastern Basin Lake Erie, Ontario, Canada - Station 67 - Surface IceEnvironmentalOpen in IMG/M
3300012716Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES130 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012729Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES157 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012757Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES161 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012988Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MGEnvironmentalOpen in IMG/M
3300013004Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES118 metaGEnvironmentalOpen in IMG/M
3300013074Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES147 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300013126 (restricted)Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_022012_10mEnvironmentalOpen in IMG/M
3300013130 (restricted)Sediment microbial communities from Lake Kivu, Rwanda - Sediment s2_kivu2a2EnvironmentalOpen in IMG/M
3300013132 (restricted)Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_9.5mEnvironmentalOpen in IMG/M
3300013133 (restricted)Sediment microbial communities from Lake Kivu, Rwanda - Sediment s1_kivu2a2EnvironmentalOpen in IMG/M
3300013137 (restricted)Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_11.1mEnvironmentalOpen in IMG/M
3300013295northern Canada Lakes metatranscriptome co-assemblyEnvironmentalOpen in IMG/M
3300017774Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.DEnvironmentalOpen in IMG/M
3300017777Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.D.NEnvironmentalOpen in IMG/M
3300017785Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.D.NEnvironmentalOpen in IMG/M
3300020083Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015033 Kigoma Deep Cast 300mEnvironmentalOpen in IMG/M
3300020084Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015032 Kigoma Deep Cast 1200mEnvironmentalOpen in IMG/M
3300020183Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015002 Mahale S4 surfaceEnvironmentalOpen in IMG/M
3300020198Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015019 Mahale Deep Cast 65mEnvironmentalOpen in IMG/M
3300020570Freshwater microbial communities from Lake Mendota, WI - 31AUG2010 deep hole epilimnion (SPAdes)EnvironmentalOpen in IMG/M
3300020571Freshwater microbial communities from Lake Mendota, WI - 31AUG2012 deep hole epilimnion (SPAdes)EnvironmentalOpen in IMG/M
3300020578Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015038 Kigoma Deep Cast 35mEnvironmentalOpen in IMG/M
3300021093Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015023 Mahale A surfaceEnvironmentalOpen in IMG/M
3300021961Estuarine water microbial communities from San Francisco Bay, California, United States - C33_3DEnvironmentalOpen in IMG/M
3300021962Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649DEnvironmentalOpen in IMG/M
3300021963Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657DEnvironmentalOpen in IMG/M
3300022748Freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 20-17_Aug_MGEnvironmentalOpen in IMG/M
3300024510Freshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Cont_RepA_8hEnvironmentalOpen in IMG/M
3300024512Freshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Cont_RepC_0hEnvironmentalOpen in IMG/M
3300024571Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Colum_RepA_8h (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300025630Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_>0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025889Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 (SPAdes)EnvironmentalOpen in IMG/M
3300027260Estuarine microbial communities from the Columbia River estuary - metaG 1563A-02 (SPAdes)EnvironmentalOpen in IMG/M
3300027281Estuarine microbial communities from the Columbia River estuary - metaG 1547B-02 (SPAdes)EnvironmentalOpen in IMG/M
3300027294Estuarine microbial communities from the Columbia River estuary - metaG 1548B-02 (SPAdes)EnvironmentalOpen in IMG/M
3300027304Estuarine microbial communities from the Columbia River estuary - metaG 1560A-02 (SPAdes)EnvironmentalOpen in IMG/M
3300027492Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Law_RepA_8dEnvironmentalOpen in IMG/M
3300027608Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF (SPAdes)EnvironmentalOpen in IMG/M
3300027798Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD (SPAdes)EnvironmentalOpen in IMG/M
3300027973Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300029930Aquatic microbial communities from drinking water treatment plant in Pearl River Delta area, China - influent_20120727EnvironmentalOpen in IMG/M
3300031951Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA120EnvironmentalOpen in IMG/M
3300032050Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA122EnvironmentalOpen in IMG/M
3300032092Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA121EnvironmentalOpen in IMG/M
3300032116Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA119EnvironmentalOpen in IMG/M
3300033981Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Aug2014-rr0011EnvironmentalOpen in IMG/M
3300034012Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Aug2017-rr0027EnvironmentalOpen in IMG/M
3300034023Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME21Oct2016-rr0090EnvironmentalOpen in IMG/M
3300034061Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Sep2004-rr0028EnvironmentalOpen in IMG/M
3300034062Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Jul2012-rr0045EnvironmentalOpen in IMG/M
3300034073Fracking water microbial communities from deep shales in Oklahoma, United States - MC-6-XLEnvironmentalOpen in IMG/M
3300034094Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME11Sep2000-rr0077EnvironmentalOpen in IMG/M
3300034101Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME19Sep2005-rr0107EnvironmentalOpen in IMG/M
3300034106Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23Aug2013-rr0131EnvironmentalOpen in IMG/M
3300034111Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Oct2011-rr0186EnvironmentalOpen in IMG/M
3300034112Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Aug2014-rr0191EnvironmentalOpen in IMG/M
3300034119Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME21Jul2015-rr0166EnvironmentalOpen in IMG/M
3300034122Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Aug2014-rr0181EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
B570J13875_10193713300001267FreshwaterIFYARENDEIRSIAAFKAGVQIAWPDLVVDFRLT*
metazooDRAFT_127572133300002201LakeFFYGTDLLSDEENFSLWYSKDNDEVRFQAAFKVGVQVAYPDLVVDFRLA*
B570J29032_10916554823300002408FreshwaterTYLGNLFYGTDLLSDEENFELWYSKDNDEVRFQAAFKAGVQFAYPDLMVDFRLA*
B570J40625_10031339113300002835FreshwaterDEENFELWYSKDNDEVRFQAAFKAGVQFAYPDLMVDFKLA*
Ga0049081_1028481413300005581Freshwater LenticYGTDLLSDEENFSLWYSKDNDEVRFQAAFKVGVQVAYPDLVVDFKLA*
Ga0049080_1016764313300005582Freshwater LenticFYGTDLLSDEEQFSIWLSRDNDSIRYQAAFKAGVNFAYPDLMVDFRLA*
Ga0073913_1002770313300005940SandNRIVCTYLGNLFYGTDLLSDEEQFSIWFSKDNDEVRFQAAFKAGVQIAYPDLVVDFRLT*
Ga0075470_1013836713300006030AqueousTYLGNLFYGTDLLSDEEQFSIWFSKDNDEVRFQAAFKAGVQFAYPDLIVDFRLT*
Ga0075464_1038808933300006805AqueousEEQFSIWFSKDNDEVRFQAAFKAGVQFAYPDLIVDFRLT*
Ga0075459_106514513300006863AqueousRIVCTYLGNLFYGTDLLSDEEQFSIWFSKDNDEVRFQAAFKAGVQFAYPDQIVDFRLT*
Ga0075473_1005914113300006875AqueousEQFSIWFSKDNDEVRFQAAFKAGVQFAYPDLIVDFRLT*
Ga0075473_1005987013300006875AqueousLWYSKDNDEVRFQAAFKAGVQFAYPDLMVDFRLA*
Ga0075472_1005756033300006917AqueousSIWPSIDNDEIRFQCALKCGVQVAYPDLVVDWRLA*
Ga0075472_1023864333300006917AqueousLSDEEQFSIWFSKDNDEVRFQAAFKAGVQFAYPDLIVDFRLT*
Ga0099848_118429423300007541AqueousTNTNRIVCSYLGNFFLGTDLLSDEEQFSIFYARENDEVRSIAAFKCGVQIAYPDLVVDFKLA*
Ga0102875_105306713300007547EstuarineNRMVCSYLGNFFYGTDLLSDEEQFSIWPSIDNDEIRFQCALKCGVQVAYPDLVVDWRLA*
Ga0102881_106191913300007551EstuarineTYLGNLVYATDLLSDEEQFSIFYARENDEVRSIAAFKAGVQIAYPDFVVDFRLA*
Ga0102881_114026523300007551EstuarineYGTDLLSDEEQFSIFYARENDEIRSIAAFKAGVQIAYPDLVVDFRLT*
Ga0102918_110087423300007593EstuarineYGTDLLSDEEQFSIFYARENDEVRSIAAFKAGVQIAYPDFVVDFRLA*
Ga0102919_112203023300007597EstuarineYQGNFFYGTDLLSDEDQFNMWYSQDNDEVRFMAAFKMGVQMAYPDLVVQFRLATS*
Ga0102920_101886313300007600EstuarineDEEQFSIWFSKDNDEVRFQAAFKAGVQFAYPDLIVDFRLT*
Ga0102896_109382813300007618EstuarineTDLLSDEEQFSIWPSIDNDEIRFQCALKCGVQVAYPDLVVDWRLA*
Ga0102871_123169013300007620EstuarineIVCTYLGNLFYASDLLSDEEQFSIFYARENDEVRSIAAFKAGVQTAYPDLVVDFRLA*
Ga0102867_104293013300007716EstuarineNRIVSSYLGNFFYGTDLLSDEEQFSIWFSKDNDQVRFQASFKAGVQIAYPDLVVDFKLT*
Ga0099850_127538623300007960AqueousLLSDEEQFSIWHSKDNDQVRFQASFKCGVNFAYGDLIVDWKLA*
Ga0105746_100794813300007973Estuary WaterDLLSDEEQFSIWFSKDNDEVRFQAAFKAGVQIAYPDLVVDFRLT*
Ga0105747_101831413300007974Estuary WaterSYLGNFFYGTDLLSDEEQFSIWFSKDNDEVRFQAAFKAGVQIAYPDLVVDFRLT*
Ga0108970_1123278323300008055EstuaryLWYSKDNDEVRFQAAFKVGVQVAYPDLVVDFKLA*
Ga0114350_118922413300008116Freshwater, PlanktonVPGLTGTNRIVSSYLGNFFYGTDLLSDEEQFSIWFSKDNDQVRFQASFKCGVQLAWPDLVVDFRLT*
Ga0114353_139790513300008264Freshwater, PlanktonYLGNMFYGTDLLSDEEQFSIWHSRDNDEIRFQAAMKAGVQIAYPEFVVDWKLA*
Ga0114361_107568613300008265Freshwater, PlanktonQFSIFYARENDEVRSIAAFKAGVQMAYPDLVVDFRLA*
Ga0114878_101483853300008339Freshwater LakeEQFSIWHSRDNDEIRFQAAMKAGVQIAYPEFVVDWKLA*
Ga0110928_103558733300008510Water BodiesLFYGTDLLTDEENFELWYSKDNDEVRFQASFKVGVQVAYPDLVVDFRLA*
Ga0105098_1039618413300009081Freshwater SedimentLSNLFYGTDLLSDEEQFSIWHSRDNDEVRLQAAFKAGVQFAYPEFIVDWKLA*
Ga0105102_1062388413300009165Freshwater SedimentTDLLSDEEQFSIWHSRDNDEVRFQAAFKAGVQFAYPEFIVDWKLA*
Ga0129333_1014922013300010354Freshwater To Marine Saline GradientLGNFFYGTDLLSDEENFSLWYSKDNDEVRFQAAFKVGVQVAYPDLVVDWRLA*
Ga0129333_1030951713300010354Freshwater To Marine Saline GradientDLLSDEEQFSIWHSKDQDEVRFQASFKASTQIAYPEFVVDFRLA*
Ga0129333_1164617813300010354Freshwater To Marine Saline GradientDLLSDEEQFSIFYARENDEIRSIAAFKAGVQIAYPEFVVDFKLA*
Ga0129324_1036105313300010368Freshwater To Marine Saline GradientSDEEQFSIFYARENDEIRSIAAFKAGVQIAYPDLVVDFKLA*
Ga0153805_106206613300012013Surface IceLGNFFYGTDLLSDEEQFSIWFSKDNDQVRFQASFKCGVQLAWPDLVVDFRLT*
Ga0157605_121403913300012716FreshwaterGTDLLSDEEQFSIWFSKDNDEVRFQAAFKAGVQIAYPDLVVDFKLT*
Ga0157625_119871513300012729FreshwaterRIVASYLGNFHLGTDLLSDEEQFSIFYSRDNDEVRSIAAFKAGVQIAYPDLVVDFRLT*
Ga0157628_113005813300012757FreshwaterIVSSYLGNFFYGTDLLSDEEQFSIWFSKDNDEVRFQAAFKAGVQIAYPDLIVDFRLT*
Ga0164306_1108856823300012988SoilFEMYYSKDNDEVRFWAEFKMGVNVVLPDEVVEFTLAA*
Ga0164293_1012947333300013004FreshwaterFSIWFSKDNDEVRFQAAFKAGVQIAYPDLVVDFRLT*
Ga0157618_110495413300013074FreshwaterSYLGNFFYGTDLLSDEEQFSIFYSRDLDEVRSIAAFKAGVQIAYPDLVVDFRLT*
(restricted) Ga0172367_1055906413300013126FreshwaterSYLGNFFYGTDLLSDEERFELFWSRDNDEVRFQASLKCGVQTAYPDLVVDWKLA*
(restricted) Ga0172367_1072865623300013126FreshwaterDEENFSLWYSKDNDEVRFQAAFKVGVQVAYPDLVVDFKLA*
(restricted) Ga0172363_1079940613300013130SedimentLLSDEEQFSIWHSRDNDEIRFQAALKAGVQIAYPEFVVNWQLA*
(restricted) Ga0172372_1042028233300013132FreshwaterFFYGTDLLSDEENFSLWYSKDNDEVRFQAAFKVGVQVAYPDLVVDFKLA*
(restricted) Ga0172362_1066045813300013133SedimentDLLSDEENFSLWYSKDNDEVRFQAAFKVGVQVAYPDLVVDFKLA*
(restricted) Ga0172375_1054865623300013137FreshwaterENFSLWYSKDNDEVRFQAAFKVGVQVAYPDLVVDFKLA*
Ga0170791_1099627213300013295FreshwaterSDEEQFSIWFSKDNDEVRFQAAFKAGVQFAYPDLIVDFRLT*
Ga0181358_117237113300017774Freshwater LakeNFFYGTDLLSDEEQFSIWFSKDNDEVRFQAAFKAGVQIAYPDLIVDFRLT
Ga0181357_128792423300017777Freshwater LakeELWYSKDNDEVRFQAAFKAGVQFAYPDLMVDFKLA
Ga0181355_112990813300017785Freshwater LakeSIFYSRDLDEVRSIAAFKAGVQIAYPDLVVDFRLT
Ga0194111_1077492513300020083Freshwater LakeFYGTDLLSDEEQFSIFYSRDNDEVRFQASFKAGVQVAYPDLIVDFKLA
Ga0194110_1022560533300020084Freshwater LakeTDLLSDEEQFSIFYSRDNDEVRFQASFKAGVQVAYPDLIVDFKLA
Ga0194115_1036669713300020183Freshwater LakeQFSIFYSRDNDEVRFQASFKAGVQVAYPDLIVDFKLA
Ga0194120_1033350613300020198Freshwater LakeLTTNRIVCTYLGNLFYGTDLLSDEEQFSIFYSRDNDEVRFQASFKAGVQVAYPDLIVDFKLA
Ga0208465_1000972103300020570FreshwaterYATDLLSDEEQFSIFYARENDEIRSIAAFKAGVQIAWPDLVVDFRLT
Ga0208723_104011513300020571FreshwaterVCTYLGNLFYGTDLLSDEENFSLWYSQDNDEVRFQAAFKAGVQFAYPDLMVDFRLA
Ga0194129_1028490633300020578Freshwater LakeVCTYLGNLFVGVDLLSDEDNISVWHSKDNDSIRVQASFRLGVQTAYPDLIVDFKLA
Ga0194123_1018247413300021093Freshwater LakeVCTYLGNLFYGTDLLSDEEQFSIFYSRDNDEVRFQASFKAGVQVAYPDLIVDFKLA
Ga0222714_1064195013300021961Estuarine WaterLFYGTDLLSDEEQFSIWLSRDNDSIRWQAAFKAGVNFAYPDLMVDFRLA
Ga0222713_1013565813300021962Estuarine WaterGTDLLSDEENFSLWYSKDNDEVRFQAAFKVGVQVAYPDLVVDFRLA
Ga0222712_1010715633300021963Estuarine WaterNFFYGTDLLSDEENFSLWYSKDNDEVRFQAAFKVGVQVAYPDLMVDFRLA
Ga0228702_102373313300022748FreshwaterFYGTDLLSDEEQFSIWLSRDNDSIRYQAAFKAGVNFAYPDLMVDFKLA
Ga0255187_105475223300024510FreshwaterRIVATYLGNLFYGTDLLSDEEQFSIWLSRDNDSIRYQAAFKAGVNFAYPDLMVDFRLA
Ga0255186_104251313300024512FreshwaterLFYGTDLLSDEEQFSIWVSRDNDSIRYQAAFKAGVQFAYPDLIVDWKLA
Ga0256302_108171713300024571FreshwaterATYLGNLFYGTDLLSDEENFELWYSKDNDEVRFQAAFKAGVQFAYPDLMVDFRLA
Ga0208004_111565513300025630AqueousSDEEQFSIWHSRDNDEVRFQAAFKAGVQFAYPEFIVDWKLA
Ga0208644_119031713300025889AqueousDEENFSLWYSKDNDEVRFQAAFKVGVQVAYPDLVVDFRLA
Ga0208027_106724813300027260EstuarineFFYGTDLLSDEDQFNMWYSQDNDEVRFMAAFKMGVQMAYPDLVVQFRLATS
Ga0208440_106661813300027281EstuarineNRMVCSYLGNFFYGTDLLSDEEQFSIWPSIDNDEIRFQCALKCGVQVAYPDLVVDWRLA
Ga0208441_106423523300027294EstuarineVCSYLGNFFYGTDLLSDEEQFSIWPSIDNDEIRFQCALKCGVQVAYPDLVVDWRLA
Ga0208810_103807033300027304EstuarinePGLTNTNRIVCTYLGNLVYATDLLSDEEQFSIFYARENDEVRSIAAFKAGVQIAYPDFVVDFRLA
Ga0255093_105996723300027492FreshwaterFYGTDLLSDEENFSLWYSKDNDEVRFQAAFKVGVQVAYPDLVVDFKLA
Ga0208974_111597113300027608Freshwater LenticFFYGTDLLSDEENFSLWYSQDNDEVRFQAAFKVGVQVAYPDLIVDWRLA
Ga0209353_1007458633300027798Freshwater LakeCSYLGNFFYATDLLSDEENFSLWYSQDNDEVRFQAAFKVGVQVAYPDLIVDWKLA
Ga0209298_1034657923300027973Freshwater LakeLFYASDLLSDEEQFSIFYARENDEIRSIAAFKAGVQFAYPDLIVDFRLA
Ga0119944_101591233300029930AquaticIVTSYLGNMFYGTDLLSDEEQFSIWHSRDNDEIRFQAAMKAGVQIAYPEFVVDWKLA
Ga0315904_1020978933300031951FreshwaterGTDLLSDEEQFSIWPSIDNDEIRFQCALKCGVQVAYPDLVVDWRLA
Ga0315904_1118102223300031951FreshwaterDEENFSLWYSQDNDEVRFQAAFKAGVQFAYPDLMVDFRLA
Ga0315906_1027360133300032050FreshwaterSTNRIVCTYLGNLFYGTDLLSDEENFSLWYSQDNDEVRFQAAFKAGVQFAYPDLMVDFKL
Ga0315906_1101486513300032050FreshwaterDEENFSLWYSQDNDEVRFQAAFKAGVQFAYPDLIVDWKLA
Ga0315905_10000926493300032092FreshwaterNFELWYSKDNDEVRFQAAFKAGVQFAYPDLMVDFKLA
Ga0315903_1029660313300032116FreshwaterTDLLSDEENFSLWYSQDNDEVRFQAAFKAGVQFAYPDLMVDFKLA
Ga0334982_0178333_943_10623300033981FreshwaterEEQFSIWPSIDNDEIRFQCALKIGVNIAYPDLVVDWRLA
Ga0334986_0598861_385_5163300034012FreshwaterLLSDEEQFSIWFSKDNDEVRFQAAFKAGVQIAYPDLIVDFRLT
Ga0335021_0652292_1_1743300034023FreshwaterIVSSYLGNFFYGTDLLSDEEQFSIWFSKDNDEVRFQAAFKAGVQIAYPDLVVDFRLT
Ga0334987_0123994_1_1143300034061FreshwaterQFSIWFSKDNDEVRFQAAFKAGVQIAYPDLVVDFRLT
Ga0334987_0359111_17_1483300034061FreshwaterLLSDEEQFSIWFSKDNDEVRFQAAFKAGVQIAYPDLVVDFRLT
Ga0334995_0649180_1_1533300034062FreshwaterNFFYGTDLLSDEEQFSIWFSKDNDEVRFQAAFKAGVQIAYPDLVVDFKLT
Ga0310130_0016703_2240_23893300034073Fracking WaterLFYGTDLLSDEEQFSIWFSRDNDEVRFQAAFKAGVQFAYPDLIVDWKLA
Ga0335014_0123238_1_1263300034094FreshwaterSDEEQFSIWFSKDNDEVRFQAAFKAGVQIAYPDLVVDFRLT
Ga0335027_0382553_1_1683300034101FreshwaterSSYLGNFFYGTDLLSDEEQFSIWFSKDNDEVRFQAAFKAGVQIAYPDLVVDFRLT
Ga0335027_0495275_628_7593300034101FreshwaterLLSDEENFSLWYSQDNDEVRFQAAFKAGVQFAYPDLIVDWRLA
Ga0335027_0507729_15_1463300034101FreshwaterLLSDEENFSLWYSQDNDEVRFQAAFKAGVQFAYPDLMVDFRLA
Ga0335036_0472189_674_7873300034106FreshwaterQFSIFYSRDNDEVRSIAAFKCGVQLAWPDLVVDFKLT
Ga0335063_0342863_651_7733300034111FreshwaterDEEQFSIWFSKDNDEVRFQAAFKAGVQIAYPDLVVDFRLT
Ga0335066_0324754_754_8613300034112FreshwaterSIWPSIDNDEIRFQCALKIGVNIAYPDLVVDWRLA
Ga0335054_0478344_532_6633300034119FreshwaterLLSDEENFELWYSKDNDEVRFQAAFKAGVQFAYPDLMVDFRLA
Ga0335060_0133755_2_1783300034122FreshwaterRIVASYLGNFHLGTDLLSDEEQFSIFYSRDNDEVRSIAAFKCGVQLAWPDLVVDFRLT


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.