NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F096792

Metagenome / Metatranscriptome Family F096792

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F096792
Family Type Metagenome / Metatranscriptome
Number of Sequences 104
Average Sequence Length 43 residues
Representative Sequence MWAMSSASAPASATGLADGQRDAVIHTEDLTKIYPGTDFAAVDRLN
Number of Associated Samples 91
Number of Associated Scaffolds 104

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 38.46 %
% of genes near scaffold ends (potentially truncated) 100.00 %
% of genes from short scaffolds (< 2000 bps) 92.31 %
Associated GOLD sequencing projects 89
AlphaFold2 3D model prediction Yes
3D model pTM-score0.18

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (76.923 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(35.577 % of family members)
Environment Ontology (ENVO) Unclassified
(32.692 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(49.038 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: Yes Secondary Structure distribution: α-helix: 13.51%    β-sheet: 0.00%    Coil/Unstructured: 86.49%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.18
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 104 Family Scaffolds
PF03807F420_oxidored 5.77
PF00440TetR_N 4.81
PF02687FtsX 4.81
PF00196GerE 3.85
PF01734Patatin 3.85
PF13556HTH_30 3.85
PF00067p450 2.88
PF00106adh_short 2.88
PF12680SnoaL_2 2.88
PF03448MgtE_N 2.88
PF00912Transgly 1.92
PF00005ABC_tran 1.92
PF00561Abhydrolase_1 1.92
PF13191AAA_16 0.96
PF00415RCC1 0.96
PF00903Glyoxalase 0.96
PF02801Ketoacyl-synt_C 0.96
PF01471PG_binding_1 0.96
PF02190LON_substr_bdg 0.96
PF01022HTH_5 0.96
PF13520AA_permease_2 0.96
PF04679DNA_ligase_A_C 0.96
PF11716MDMPI_N 0.96
PF06197DUF998 0.96
PF08241Methyltransf_11 0.96
PF07690MFS_1 0.96
PF00165HTH_AraC 0.96
PF104171-cysPrx_C 0.96
PF030614HBT 0.96

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 104 Family Scaffolds
COG1752Predicted acylesterase/phospholipase RssA, containd patatin domainGeneral function prediction only [R] 3.85
COG3621Patatin-like phospholipase/acyl hydrolase, includes sporulation protein CotRGeneral function prediction only [R] 3.85
COG4667Predicted phospholipase, patatin/cPLA2 familyLipid transport and metabolism [I] 3.85
COG2124Cytochrome P450Defense mechanisms [V] 2.88
COG2239Mg/Co/Ni transporter MgtE (contains CBS domain)Inorganic ion transport and metabolism [P] 2.88
COG0744Penicillin-binding protein 1B/1F, peptidoglycan transglycosylase/transpeptidaseCell wall/membrane/envelope biogenesis [M] 1.92
COG4953Membrane carboxypeptidase/penicillin-binding protein PbpCCell wall/membrane/envelope biogenesis [M] 1.92
COG5009Membrane carboxypeptidase/penicillin-binding proteinCell wall/membrane/envelope biogenesis [M] 1.92
COG5184Alpha-tubulin suppressor ATS1 and related RCC1 domain-containing proteinsCell cycle control, cell division, chromosome partitioning [D] 1.92
COG1793ATP-dependent DNA ligaseReplication, recombination and repair [L] 0.96
COG3371Uncharacterized membrane proteinFunction unknown [S] 0.96


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms77.88 %
UnclassifiedrootN/A22.12 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300004092|Ga0062389_102854541Not Available645Open in IMG/M
3300005332|Ga0066388_108459441All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria512Open in IMG/M
3300005434|Ga0070709_10087213All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia2050Open in IMG/M
3300005546|Ga0070696_100421606All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1048Open in IMG/M
3300005549|Ga0070704_101319024All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia661Open in IMG/M
3300005602|Ga0070762_10409714All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia875Open in IMG/M
3300005617|Ga0068859_101708601All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia695Open in IMG/M
3300006047|Ga0075024_100864807Not Available511Open in IMG/M
3300006162|Ga0075030_101537611All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria521Open in IMG/M
3300006854|Ga0075425_100782970All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales1093Open in IMG/M
3300010048|Ga0126373_12338645All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia595Open in IMG/M
3300010333|Ga0134080_10409627All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia629Open in IMG/M
3300010343|Ga0074044_10950067All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria563Open in IMG/M
3300010360|Ga0126372_10200200All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1662Open in IMG/M
3300010360|Ga0126372_10561865All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1086Open in IMG/M
3300010361|Ga0126378_12296991All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia616Open in IMG/M
3300010361|Ga0126378_13165361Not Available524Open in IMG/M
3300010379|Ga0136449_103066908All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria650Open in IMG/M
3300010396|Ga0134126_10663646All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1188Open in IMG/M
3300010401|Ga0134121_10536131All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1084Open in IMG/M
3300010401|Ga0134121_10967342All Organisms → cellular organisms → Bacteria833Open in IMG/M
3300010876|Ga0126361_10953882All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria688Open in IMG/M
3300012208|Ga0137376_10614587All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Actinocatenispora → Actinocatenispora sera940Open in IMG/M
3300012971|Ga0126369_10482545All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1294Open in IMG/M
3300014489|Ga0182018_10532624All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria620Open in IMG/M
3300016357|Ga0182032_11763905All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium540Open in IMG/M
3300017928|Ga0187806_1301594All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria565Open in IMG/M
3300017946|Ga0187879_10830119All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria516Open in IMG/M
3300017955|Ga0187817_11086021All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria513Open in IMG/M
3300017961|Ga0187778_10736371Not Available669Open in IMG/M
3300017966|Ga0187776_10346530All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria979Open in IMG/M
3300017974|Ga0187777_10373757Not Available983Open in IMG/M
3300018001|Ga0187815_10231566All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria782Open in IMG/M
3300018007|Ga0187805_10524345Not Available556Open in IMG/M
3300018047|Ga0187859_10824535All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria533Open in IMG/M
3300018058|Ga0187766_10089824All Organisms → cellular organisms → Archaea1850Open in IMG/M
3300018058|Ga0187766_11418620All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Kibdelosporangium → Kibdelosporangium aridum510Open in IMG/M
3300018085|Ga0187772_10982092All Organisms → cellular organisms → Bacteria → Proteobacteria616Open in IMG/M
3300018431|Ga0066655_10260585Not Available1112Open in IMG/M
3300020581|Ga0210399_10833602Not Available751Open in IMG/M
3300020581|Ga0210399_11576080Not Available507Open in IMG/M
3300021181|Ga0210388_10077879All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2808Open in IMG/M
3300021384|Ga0213876_10116999All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1415Open in IMG/M
3300021402|Ga0210385_10022226All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia4032Open in IMG/M
3300021402|Ga0210385_10726808Not Available760Open in IMG/M
3300021403|Ga0210397_11287795All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia568Open in IMG/M
3300021406|Ga0210386_10332114All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii1306Open in IMG/M
3300021433|Ga0210391_10900489Not Available690Open in IMG/M
3300024181|Ga0247693_1058809All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia564Open in IMG/M
3300025627|Ga0208220_1050102All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1227Open in IMG/M
3300025906|Ga0207699_10074465All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2086Open in IMG/M
3300025927|Ga0207687_11612220All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia557Open in IMG/M
3300027783|Ga0209448_10062957All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1248Open in IMG/M
3300027812|Ga0209656_10063488All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2035Open in IMG/M
3300028742|Ga0302220_10366382All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria519Open in IMG/M
3300028775|Ga0302231_10439395All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria550Open in IMG/M
3300028781|Ga0302223_10030838All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1903Open in IMG/M
3300028789|Ga0302232_10243977All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia891Open in IMG/M
3300028877|Ga0302235_10491194All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria522Open in IMG/M
3300029999|Ga0311339_11430556All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria619Open in IMG/M
3300030007|Ga0311338_11473367All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria629Open in IMG/M
3300030494|Ga0310037_10264164All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium743Open in IMG/M
3300030503|Ga0311370_11466744All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria716Open in IMG/M
3300031236|Ga0302324_102645654All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria608Open in IMG/M
3300031544|Ga0318534_10279628All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia962Open in IMG/M
3300031544|Ga0318534_10409705Not Available778Open in IMG/M
3300031545|Ga0318541_10326993Not Available856Open in IMG/M
3300031549|Ga0318571_10094400Not Available970Open in IMG/M
3300031564|Ga0318573_10334434Not Available812Open in IMG/M
3300031679|Ga0318561_10057373All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1965Open in IMG/M
3300031708|Ga0310686_103650617Not Available1325Open in IMG/M
3300031708|Ga0310686_119648438All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1078Open in IMG/M
3300031713|Ga0318496_10483578All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia685Open in IMG/M
3300031747|Ga0318502_10079172All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1788Open in IMG/M
3300031777|Ga0318543_10383435All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia630Open in IMG/M
3300031796|Ga0318576_10414345All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium637Open in IMG/M
3300031805|Ga0318497_10171856All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1192Open in IMG/M
3300031835|Ga0318517_10327472All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria692Open in IMG/M
3300031835|Ga0318517_10583164All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia503Open in IMG/M
3300031860|Ga0318495_10212899Not Available869Open in IMG/M
3300031880|Ga0318544_10317307All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium605Open in IMG/M
3300031896|Ga0318551_10044605Not Available2214Open in IMG/M
3300031897|Ga0318520_10509712Not Available743Open in IMG/M
3300031910|Ga0306923_10258129All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1994Open in IMG/M
3300031910|Ga0306923_11287233Not Available776Open in IMG/M
3300031912|Ga0306921_12715285Not Available509Open in IMG/M
3300031942|Ga0310916_10626888All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium913Open in IMG/M
3300031945|Ga0310913_10181004All Organisms → cellular organisms → Bacteria1468Open in IMG/M
3300031946|Ga0310910_10422399All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1057Open in IMG/M
3300031954|Ga0306926_11946209All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria663Open in IMG/M
3300032001|Ga0306922_10244643All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1927Open in IMG/M
3300032008|Ga0318562_10026172All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Frankiales → Frankiaceae → Frankia → unclassified Frankia → Frankia sp. Iso8993074Open in IMG/M
3300032009|Ga0318563_10052880All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2085Open in IMG/M
3300032041|Ga0318549_10292361All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria734Open in IMG/M
3300032054|Ga0318570_10046543All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1786Open in IMG/M
3300032055|Ga0318575_10054349All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1846Open in IMG/M
3300032065|Ga0318513_10335497All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria736Open in IMG/M
3300032065|Ga0318513_10454270Not Available626Open in IMG/M
3300032067|Ga0318524_10158856All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1146Open in IMG/M
3300032160|Ga0311301_11845444All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria716Open in IMG/M
3300032805|Ga0335078_10382471All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1855Open in IMG/M
3300032805|Ga0335078_11281151All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia838Open in IMG/M
3300032805|Ga0335078_12644069Not Available513Open in IMG/M
3300032828|Ga0335080_10522179All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1258Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil35.58%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa8.65%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil5.77%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil5.77%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland5.77%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment3.85%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil3.85%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere3.85%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil2.88%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil2.88%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil2.88%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland1.92%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds1.92%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil1.92%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil0.96%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil0.96%
Arctic Peat SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil0.96%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil0.96%
Bog Forest SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil0.96%
PalsaEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa0.96%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil0.96%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil0.96%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.96%
Plant RootsHost-Associated → Plants → Roots → Unclassified → Unclassified → Plant Roots0.96%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere0.96%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.96%
Boreal Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil0.96%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300004092Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3EnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005434Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaGEnvironmentalOpen in IMG/M
3300005546Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaGEnvironmentalOpen in IMG/M
3300005549Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaGEnvironmentalOpen in IMG/M
3300005602Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2EnvironmentalOpen in IMG/M
3300005617Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2Host-AssociatedOpen in IMG/M
3300006047Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013EnvironmentalOpen in IMG/M
3300006162Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012EnvironmentalOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300010048Tropical forest soil microbial communities from Panama - MetaG Plot_11EnvironmentalOpen in IMG/M
3300010333Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300010343Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1EnvironmentalOpen in IMG/M
3300010360Tropical forest soil microbial communities from Panama - MetaG Plot_6EnvironmentalOpen in IMG/M
3300010361Tropical forest soil microbial communities from Panama - MetaG Plot_23EnvironmentalOpen in IMG/M
3300010379Sb_50d combined assemblyEnvironmentalOpen in IMG/M
3300010396Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2EnvironmentalOpen in IMG/M
3300010401Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1EnvironmentalOpen in IMG/M
3300010876Boreal forest soil eukaryotic communities from Alaska, USA - W5-5 Metatranscriptome (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300012208Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012971Tropical forest soil microbial communities from Panama - MetaG Plot_1EnvironmentalOpen in IMG/M
3300014489Permafrost microbial communities from Stordalen Mire, Sweden - 812P2M metaGEnvironmentalOpen in IMG/M
3300016357Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000EnvironmentalOpen in IMG/M
3300017928Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_1EnvironmentalOpen in IMG/M
3300017946Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_10EnvironmentalOpen in IMG/M
3300017955Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2EnvironmentalOpen in IMG/M
3300017961Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MGEnvironmentalOpen in IMG/M
3300017966Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MGEnvironmentalOpen in IMG/M
3300017974Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MGEnvironmentalOpen in IMG/M
3300018001Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_5EnvironmentalOpen in IMG/M
3300018007Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_5EnvironmentalOpen in IMG/M
3300018047Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_10EnvironmentalOpen in IMG/M
3300018058Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MGEnvironmentalOpen in IMG/M
3300018085Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300018431Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104EnvironmentalOpen in IMG/M
3300020581Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-MEnvironmentalOpen in IMG/M
3300021181Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-OEnvironmentalOpen in IMG/M
3300021384Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9Host-AssociatedOpen in IMG/M
3300021402Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-OEnvironmentalOpen in IMG/M
3300021403Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-OEnvironmentalOpen in IMG/M
3300021406Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-OEnvironmentalOpen in IMG/M
3300021433Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-OEnvironmentalOpen in IMG/M
3300024181Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK34EnvironmentalOpen in IMG/M
3300025627Arctic peat soil from Barrow, Alaska - NGEE Surface sample F53-1 deep-092012 (SPAdes)EnvironmentalOpen in IMG/M
3300025906Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025927Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300027783Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM2 (SPAdes)EnvironmentalOpen in IMG/M
3300027812Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2 (SPAdes)EnvironmentalOpen in IMG/M
3300028742Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E1_3EnvironmentalOpen in IMG/M
3300028775Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N2_2EnvironmentalOpen in IMG/M
3300028781Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E2_3EnvironmentalOpen in IMG/M
3300028789Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N2_3EnvironmentalOpen in IMG/M
3300028877Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N3_3EnvironmentalOpen in IMG/M
3300029999I_Palsa_E3 coassemblyEnvironmentalOpen in IMG/M
3300030007I_Palsa_E1 coassemblyEnvironmentalOpen in IMG/M
3300030494Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG (v2)EnvironmentalOpen in IMG/M
3300030503III_Palsa_E3 coassemblyEnvironmentalOpen in IMG/M
3300031236Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1EnvironmentalOpen in IMG/M
3300031544Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26EnvironmentalOpen in IMG/M
3300031545Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26EnvironmentalOpen in IMG/M
3300031549Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f24EnvironmentalOpen in IMG/M
3300031564Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21EnvironmentalOpen in IMG/M
3300031679Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23EnvironmentalOpen in IMG/M
3300031708FICUS49499 Metagenome Czech Republic combined assemblyEnvironmentalOpen in IMG/M
3300031713Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22EnvironmentalOpen in IMG/M
3300031747Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22EnvironmentalOpen in IMG/M
3300031777Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f24EnvironmentalOpen in IMG/M
3300031796Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f24EnvironmentalOpen in IMG/M
3300031805Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23EnvironmentalOpen in IMG/M
3300031835Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f21EnvironmentalOpen in IMG/M
3300031860Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f25EnvironmentalOpen in IMG/M
3300031880Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f25EnvironmentalOpen in IMG/M
3300031896Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19EnvironmentalOpen in IMG/M
3300031897Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16EnvironmentalOpen in IMG/M
3300031910Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2)EnvironmentalOpen in IMG/M
3300031912Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2)EnvironmentalOpen in IMG/M
3300031942Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176EnvironmentalOpen in IMG/M
3300031945Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082EnvironmentalOpen in IMG/M
3300031946Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172EnvironmentalOpen in IMG/M
3300031954Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2)EnvironmentalOpen in IMG/M
3300032001Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2)EnvironmentalOpen in IMG/M
3300032008Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f18EnvironmentalOpen in IMG/M
3300032009Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f19EnvironmentalOpen in IMG/M
3300032041Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f22EnvironmentalOpen in IMG/M
3300032054Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f23EnvironmentalOpen in IMG/M
3300032055Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f23EnvironmentalOpen in IMG/M
3300032065Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f20EnvironmentalOpen in IMG/M
3300032067Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f22EnvironmentalOpen in IMG/M
3300032160Sb_50d combined assembly (MetaSPAdes)EnvironmentalOpen in IMG/M
3300032805Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2EnvironmentalOpen in IMG/M
3300032828Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
Ga0062389_10285454123300004092Bog Forest SoilMSSVPAPVSAIDRPDGHTDAVIHTEDLTKVYPGADFAAVDHLNLDVR
Ga0066388_10845944123300005332Tropical Forest SoilMWAMSSAPASASAAGKADGQRDAVIHTEDLTKVYQGTDFAAVD
Ga0070709_1008721333300005434Corn, Switchgrass And Miscanthus RhizosphereMGTAEAQASAAGQADGEPGAVIHTEDLTKVYPGTDFAAVDRLNLDV
Ga0070696_10042160633300005546Corn, Switchgrass And Miscanthus RhizosphereMWAMSSASAPASATGLADGQRDAVIHTEDLTKIYPGTDFAAVDRLN
Ga0070704_10131902423300005549Corn, Switchgrass And Miscanthus RhizosphereMWAMSSASAPASATGLADGQRDAVIHTEDLTKIYPGTDFAAVDRLNL
Ga0070762_1040971413300005602SoilMWPMSTADAPAGAAGTRDADRDAVIHTEDLTKVYPGTD
Ga0068859_10170860133300005617Switchgrass RhizosphereMWAMSSASAPASATGLADGQRDAVIHTEDLTKIYPGTDFAAVDRLNLDV
Ga0075024_10086480723300006047WatershedsMCAMSTADAPAGAAGIRDADRDAVIHTEDLTKVYPGTDFAAVDRLNLDV
Ga0075030_10153761113300006162WatershedsMSAAQAPASPVSSASGLAGRGPDAVIHTEDLTKVY
Ga0075425_10078297013300006854Populus RhizosphereMWAMSSASAPASATGLANGQRDAVIHTEDLTKIYPGTD
Ga0126373_1233864523300010048Tropical Forest SoilMWAMSSASAPAGATGLADGQRDAVIHTEDLTKIYAGTDFAAVDRLNLDVE
Ga0134080_1040962723300010333Grasslands SoilMWAMSSASAPASATGLAGGQRDAVIHTEDLTKIYPGTDFAAVDKLNLDV
Ga0074044_1095006713300010343Bog Forest SoilMSTAQAPVTPAGINDGPQDAVIHTQDLTKVYPGADFSAVDKLNLDV
Ga0126372_1020020013300010360Tropical Forest SoilMWAMSSASAPAGATGLADGQRDAVIHTEDLTKIYAGTDFAAVDRLN
Ga0126372_1056186523300010360Tropical Forest SoilMSTTQAAASGTGALEGQPGAVIHTENLTKVYPGTDFAAVDHLD
Ga0126378_1229699113300010361Tropical Forest SoilMWAMSSASAPAGATGLAGGSQDAVIHTEDLTKIYAGTDFAAVDRLNLD
Ga0126378_1316536123300010361Tropical Forest SoilMCRMGIADAPASTAGLPDGQRPEDHRDAVIHTEDLTKIYPGTDFAAVD
Ga0136449_10306690813300010379Peatlands SoilMGTAQAPAVTAGRDGGEPDAVIHTEDLTKVYPGTDFAAVDKLNLD
Ga0134126_1066364623300010396Terrestrial SoilMGTAEAQASAAGQADGEPGAVIHTEDLTKVYPGTDFAAVDRLNLDVRA
Ga0134121_1053613123300010401Terrestrial SoilMCAMSTADAPAGAGTLDAERDAVIHTEDLTKIYAGTDFAAVDRLNL
Ga0134121_1096734213300010401Terrestrial SoilMSTAHMPAGTTERPEGRPDAVIHTEDLTKVYPGTDFAAVDRLNLDVAA
Ga0126361_1095388223300010876Boreal Forest SoilMSTAQAPVTPADLGEGEPAAVIHTEDLTKVYPGTDFAAVDKLN
Ga0137376_1061458713300012208Vadose Zone SoilMWAMSSASAPASAAGLAEGQRDAVIHTENLTKVYPGTDFAAVDK
Ga0126369_1048254513300012971Tropical Forest SoilMWAMSSASAPASAAGPAGGQRDAVIHTEDLTKVYPGTD
Ga0182018_1053262413300014489PalsaMSTVHAPASTTGLPEGERGSVIHTEDLTKVYPGADFTA
Ga0182032_1176390533300016357SoilMSIAQAPTGAADRPDGRADGVIHTEDLTKVYPGTDFAAVDRLNL
Ga0187806_130159423300017928Freshwater SedimentMRAAASPQSSLRVPGAEPAAIIHTEDLTKVYPGTDFAAVDKLNLD
Ga0187879_1083011923300017946PeatlandMGTAQAPAAAAGSPGTEHGGEPDAVIHTENLTKVYPGTAFA
Ga0187817_1108602113300017955Freshwater SedimentMGTAQAPTVAAGTEPGGEPDAVIHTENLTKVYPGTDFAAV
Ga0187778_1073637113300017961Tropical PeatlandMWAMSSASAAASATGLNGDQRDAIIHTEELTKVYPGTDFAA
Ga0187776_1034653013300017966Tropical PeatlandVAHPAQRTMWAMSSASAPASAAGLADGQRDAVIHTEDLTKVYPGTDFAAVDR
Ga0187777_1037375723300017974Tropical PeatlandMSTASAAASAAGLSGGEPGGVIHTEDLTKVYHGTDFAAVDKLNLDV
Ga0187815_1023156623300018001Freshwater SedimentMRAAASPQSSLRVPGAEPAAIIHTEDLTKVYPGTDFAAVDKLNLDV
Ga0187805_1052434523300018007Freshwater SedimentMPKEGSAISAAPAPAGATSLATGEQAAVIHTEDLTKVYPGADFAAVDKLNL
Ga0187859_1082453523300018047PeatlandMSTKPAPVTPASPGDGESASVIHTEDLTKVYPGTDFAAVDHLNLDVQAG
Ga0187766_1008982413300018058Tropical PeatlandMVYPPQRTMWAMSSASAAASTTGLAGGQRDAVIHTEDLTKVYPG
Ga0187766_1141862023300018058Tropical PeatlandMSTAPAAANSASHTGGRPDGQPGAVIHTEDLTKIYPGT
Ga0187772_1098209213300018085Tropical PeatlandMGAVQAATQAAGSGEPDAVIHTEDLTKVYPGTDFA
Ga0066655_1026058513300018431Grasslands SoilMSTADAPAGTGTRDAERDAVIHTEDLTKIYAGTDFAAVDRLNLD
Ga0210399_1083360213300020581SoilMSTAQAPTSAPGRPDGQEDGVIHTEDLTKVYPGTDFAAVDR
Ga0210399_1157608013300020581SoilMRTAHAPASAAGQPGQEPGGEPDAVIHTENLTKVYPDTDFAA
Ga0210388_1007787913300021181SoilMSTAQAPASPVSSTGGEPDGVIHTEDLTKVYPGTDFAAVD
Ga0213876_1011699933300021384Plant RootsMSTAAAPARPAGQQPGGEPDAVIHTEDLTKVYRGTDF
Ga0210385_1002222613300021402SoilMSTVETPASATHSPEANPAGIIHTEDLTKVYPGTDFAAVD
Ga0210385_1072680823300021402SoilMSTAEVTASQDGRPRKDEPDAVIHTEDLTKVYPGTDF
Ga0210397_1128779513300021403SoilMSTAPAPASATGRPEGQPGGVIHTEDLTKVYPGTDFAAVD
Ga0210386_1033211413300021406SoilMGTEATARSPAGGPGGKPEAVIHTEDLTKVYPGTDFTAVDKLNL
Ga0210391_1090048913300021433SoilMSTVEAPASATHSPEANPAGIIHTEDLTKVYPGTDFAAVDR
Ga0247693_105880913300024181SoilMWAMSSASAPASATGLADGQRDAVIHTEDLTKIYPGTDFAAVDKL
Ga0208220_105010213300025627Arctic Peat SoilVAMSTAHAPASSTDLPGGEPVAVIHTSDLTKIYPGTD
Ga0207699_1007446513300025906Corn, Switchgrass And Miscanthus RhizosphereMGTAEAQASAAGQADGEPGAVIHTEDLTKVYPGTDFAAVDRLNLDVR
Ga0207687_1161222023300025927Miscanthus RhizosphereMWAMSSASAPASATGLADDQRDAVIHTEDLTKIYPG
Ga0209448_1006295713300027783Bog Forest SoilMGTARAPAVTAGPPGTEHGGEPDAVIHTENLTKVYPGTDFAAV
Ga0209656_1006348843300027812Bog Forest SoilMSTAHAPASPAELAGGEPGAVIHTEDLTKVYPGTDFAAVDRLNLDVRA
Ga0302220_1036638223300028742PalsaMSTAQAPVIPAGPGDGEAASVIHTEDLTKVYPGTDFAAVDHLNLD
Ga0302231_1043939523300028775PalsaMSTAQAPVTPAGPGDGEPAPVIHTEDLTKVYPGTDF
Ga0302223_1003083813300028781PalsaMSTAPAPVTPARPGDGESVPKTSVIHTQDLTKVYPGTD
Ga0302232_1024397723300028789PalsaMSTAQAHASATDLPAAGPVAVIHTEDLTKVYPGADLAAVDQLNLDVQAG
Ga0302235_1049119413300028877PalsaMSTAQAPAAAAGRPAGEEDAVIHTADLTKVYPGTDF
Ga0311339_1143055623300029999PalsaMSTAQAPVIPAGPGDGEAASVIHTEDLTKVYPGTDFAAVDHL
Ga0311338_1147336723300030007PalsaMNTAQAPVTPATPGGEPDPLTSVIHTEDLTKVYHGTDFAAVDHLNLDVQAG
Ga0310037_1026416433300030494Peatlands SoilMSTAQAPASAASLAGGPPAAVIHTEDLTKVYPGTDFAAVDR
Ga0311370_1146674413300030503PalsaMSTAPAPVTPARPGDGESDPKTSVIHTQDLTKVYPGTDFAAVDHLNL
Ga0302324_10264565413300031236PalsaMSTAQAPAAAAGRPAGEEDAVIHTADLTKVYPGTDFAAVDR
Ga0318534_1027962813300031544SoilMSTAEARASAAGTDHQDAVIHTEDLTKIYQGTDFAAVDKLN
Ga0318534_1040970513300031544SoilVDDVSSASAPASAAGRAGGSRDAVIHTEDLTKIYP
Ga0318541_1032699313300031545SoilMCRMSTAEATAGTGLPDGQRDAVIHTEDLTKVYPGTDFA
Ga0318571_1009440013300031549SoilMCRMSTAEATAGTGLPDGQRDAVIHTEDLTKVYPGTD
Ga0318573_1033443423300031564SoilMCRMSTAEATAGTGLPDGQRDAVIHTEDLTKVYPGTDFAAVDK
Ga0318561_1005737313300031679SoilMWAMSSASAAAGATGLADGGQRDAVIHTEDLTKIYAGTD
Ga0310686_10365061723300031708SoilLKEGSAISTAPAPAGATSLAHGQHAVAIHTEDLTKVYPGTDFAAVDK
Ga0310686_11964843833300031708SoilMRTAHAPASAAGLPDQEPDAVIHTEDLTKVYPDTDFAAVD
Ga0318496_1048357823300031713SoilMWAMSSASAPASAAGRAGGQRDAVIHTEDLTKIYPGTDFAAVDRLNLDVG
Ga0318502_1007917213300031747SoilMWAMSSASAAAGATGLADGGQRDAVIHTEDLTKIYA
Ga0318543_1038343523300031777SoilMWAMSSASAPAGATGLANGRRDAVIHTEELTKVYPGTDFAAVDRLNLDVE
Ga0318576_1041434523300031796SoilMSTAQAPTSATDRPDGHADGVIHTEDLTKIYPGTDFAAV
Ga0318497_1017185633300031805SoilVSSASAPASAAGRAGGSRDAVIHTEDLTKIYPGTDFAAV
Ga0318517_1032747213300031835SoilMWAMSSASSPASAAGLAGGQRDAVIHTEDLTKVYPGT
Ga0318517_1058316423300031835SoilMWAMSSASAAAGATGLADGGQRDAVIHTEDLTKIYAG
Ga0318495_1021289913300031860SoilMSTAPAPTSATDRPDGRPDGVIHTEDLTKIYPGTD
Ga0318544_1031730723300031880SoilMCAMSTADAPAGAGTRDAARDAVIHTEDLTKVYPG
Ga0318551_1004460533300031896SoilMSTAQAPTSATDRPDGHADGVIHTEDLTKIYPGTDFAAVDRLN
Ga0318520_1050971213300031897SoilMSTAPAPTSATDRPDGRPDGVIHTEDLTKIYPGTDFAAVDRLN
Ga0306923_1025812913300031910SoilMWAMSSASAAAGATGLADGQRDAVIHTEDLTKIYAGTDF
Ga0306923_1128723323300031910SoilMSTAPAPTSATDRPDGRPDGVIHTEDLTKIYPGTDFAAVDRLNLDVR
Ga0306921_1271528513300031912SoilMCRMSTAEATAGTGLPDGQRDAVIHTEDLTKVYPG
Ga0310916_1062688813300031942SoilMSTAQAPTSATDRPDGHADGVIHTEDLTKIYPGTDF
Ga0310913_1018100433300031945SoilMCAMSTADAPGGTGAGTHDAERGAVIHTEDLSKIYAGTDF
Ga0310910_1042239913300031946SoilMWAMSSASAAAGATGLADGGQRDAVIHTEDLTKIYAGTDFAAVDRLNLDVE
Ga0306926_1194620923300031954SoilMSTAQAPTSAPGRPDGQQDGVIHTEDLTKVYPGTDFAAVDRLNLDVRA
Ga0306922_1024464313300032001SoilMSSASAAAGVTGLADGQRDAVIHTEDLTKIYAGTDFAAVDRLNLD
Ga0318562_1002617233300032008SoilMWAMSSASAAAGATGLADGGQRDAVIHTEDLTKIYAGTDFAAVDRLNL
Ga0318563_1005288013300032009SoilMWAMSSASSPASAAGLAGGQRDAVIHTEDLTKVYPGTDFAAVDK
Ga0318549_1029236123300032041SoilMSTTEAKTSAAKVDLPDGVIHTEDLTKIYQGTDFAAVDKLNLDIRT
Ga0318570_1004654313300032054SoilVVRPPQRTMWAMSSASAAAGVTGLADGQRDAVIHTEDLTKIYAGTDFAAV
Ga0318575_1005434913300032055SoilMWAMSSASAAAGATGLADGGQRDAVIHTKDLTKIYAGTDFAAVDRLNLDV
Ga0318513_1033549733300032065SoilMSSASAAAGVTGLADGQRDAVIHTEDLTKIYAGTDFA
Ga0318513_1045427023300032065SoilMCPMSTADAPAGSAGTRDAGRDAVIHTEDLTKVYPGTD
Ga0318524_1015885613300032067SoilMSTAQAPTSATDRPDGRPDGVIHTEDLTKIYPGTDFAAVDRLNLDV
Ga0311301_1184544413300032160Peatlands SoilMGTAQAPAAAAGPPGTEHGGEPDAVIHTENLTKVYPGTDFAAVDQLNLDV
Ga0335078_1038247133300032805SoilVTSGTQVAAGTAGLSDGEPSAVIHTEDLTKVYGGTDFAA
Ga0335078_1128115113300032805SoilMGTAEAQASAAGQADREPGAVIHTEDLTKVYPGTDFAAVDRLNLDV
Ga0335078_1264406913300032805SoilMSTAEAAAKSAAQAGEPDAIIHTEDLTKVYPGTDFAAVDRLNLDV
Ga0335080_1052217913300032828SoilMWAMSSASAPASATGLADGQRDAVIHTEDLTKIYPGTDFAAVDKLNLDVEA


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.