Basic Information | |
---|---|
Family ID | F096528 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 104 |
Average Sequence Length | 46 residues |
Representative Sequence | LLLEADAAAEGGDVVIGGKECDQAKDHSPAGLDGTEVIQAGPGALWCW |
Number of Associated Samples | 67 |
Number of Associated Scaffolds | 104 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 68.27 % |
% of genes near scaffold ends (potentially truncated) | 29.81 % |
% of genes from short scaffolds (< 2000 bps) | 75.00 % |
Associated GOLD sequencing projects | 62 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.14 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (96.154 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater (45.192 % of family members) |
Environment Ontology (ENVO) | Unclassified (91.346 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (68.269 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 0.00% Coil/Unstructured: 100.00% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.14 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 104 Family Scaffolds |
---|---|---|
PF03781 | FGE-sulfatase | 15.38 |
PF05685 | Uma2 | 4.81 |
PF01850 | PIN | 3.85 |
PF00793 | DAHP_synth_1 | 2.88 |
PF00078 | RVT_1 | 1.92 |
PF04879 | Molybdop_Fe4S4 | 1.92 |
PF12680 | SnoaL_2 | 0.96 |
PF07704 | PSK_trans_fac | 0.96 |
PF02560 | Cyanate_lyase | 0.96 |
PF09722 | Xre_MbcA_ParS_C | 0.96 |
PF01435 | Peptidase_M48 | 0.96 |
PF00656 | Peptidase_C14 | 0.96 |
PF00528 | BPD_transp_1 | 0.96 |
PF13560 | HTH_31 | 0.96 |
PF13676 | TIR_2 | 0.96 |
PF00384 | Molybdopterin | 0.96 |
PF04014 | MazE_antitoxin | 0.96 |
PF04545 | Sigma70_r4 | 0.96 |
PF00849 | PseudoU_synth_2 | 0.96 |
PF08808 | RES | 0.96 |
COG ID | Name | Functional Category | % Frequency in 104 Family Scaffolds |
---|---|---|---|
COG1262 | Formylglycine-generating enzyme, required for sulfatase activity, contains SUMF1/FGE domain | Posttranslational modification, protein turnover, chaperones [O] | 15.38 |
COG4636 | Endonuclease, Uma2 family (restriction endonuclease fold) | General function prediction only [R] | 4.81 |
COG0564 | Pseudouridine synthase RluA, 23S rRNA- or tRNA-specific | Translation, ribosomal structure and biogenesis [J] | 0.96 |
COG1187 | Pseudouridylate synthase RsuA, specific for 16S rRNA U516 and 23S rRNA U2605 | Translation, ribosomal structure and biogenesis [J] | 0.96 |
COG1513 | Cyanate lyase | Inorganic ion transport and metabolism [P] | 0.96 |
COG4249 | Uncharacterized conserved protein, contains caspase domain | General function prediction only [R] | 0.96 |
COG4423 | Uncharacterized conserved protein | Function unknown [S] | 0.96 |
COG5654 | Predicted toxin component of a toxin-antitoxin system, contains RES domain | Defense mechanisms [V] | 0.96 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 96.15 % |
Unclassified | root | N/A | 3.85 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300004793|Ga0007760_11266224 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Prochlorococcaceae → Cyanobium → unclassified Cyanobium → Cyanobium sp. | 573 | Open in IMG/M |
3300009068|Ga0114973_10012140 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 5529 | Open in IMG/M |
3300009152|Ga0114980_10017497 | All Organisms → cellular organisms → Bacteria | 4509 | Open in IMG/M |
3300009152|Ga0114980_10067948 | All Organisms → cellular organisms → Bacteria | 2148 | Open in IMG/M |
3300009152|Ga0114980_10107076 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Synechococcaceae → Synechococcus | 1670 | Open in IMG/M |
3300009152|Ga0114980_10557960 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales | 649 | Open in IMG/M |
3300009154|Ga0114963_10025010 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Prochlorococcaceae → Cyanobium → Cyanobium gracile | 3960 | Open in IMG/M |
3300009158|Ga0114977_10030176 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 3399 | Open in IMG/M |
3300009158|Ga0114977_10486937 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Prochlorococcaceae → Cyanobium → unclassified Cyanobium → Cyanobium sp. | 676 | Open in IMG/M |
3300009160|Ga0114981_10290486 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Synechococcaceae → Synechococcus | 888 | Open in IMG/M |
3300009164|Ga0114975_10227249 | Not Available | 1049 | Open in IMG/M |
3300009164|Ga0114975_10431127 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Synechococcaceae → Synechococcus | 716 | Open in IMG/M |
3300009180|Ga0114979_10385638 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 822 | Open in IMG/M |
3300009180|Ga0114979_10414528 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Synechococcaceae → Synechococcus | 787 | Open in IMG/M |
3300009180|Ga0114979_10431178 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Prochlorococcaceae → Cyanobium → unclassified Cyanobium → Cyanobium sp. | 768 | Open in IMG/M |
3300009180|Ga0114979_10554781 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Prochlorococcaceae → Cyanobium → unclassified Cyanobium → Cyanobium sp. | 660 | Open in IMG/M |
3300009180|Ga0114979_10849017 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Prochlorococcaceae → Cyanobium → unclassified Cyanobium → Cyanobium sp. | 510 | Open in IMG/M |
3300009187|Ga0114972_10055792 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Synechococcaceae → Synechococcus | 2694 | Open in IMG/M |
3300009187|Ga0114972_10080508 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 2172 | Open in IMG/M |
3300010158|Ga0114960_10142056 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales | 1297 | Open in IMG/M |
3300010158|Ga0114960_10392498 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales | 680 | Open in IMG/M |
3300010160|Ga0114967_10019974 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales | 4719 | Open in IMG/M |
3300010885|Ga0133913_11670025 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 1603 | Open in IMG/M |
3300010885|Ga0133913_11750632 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Synechococcaceae → Synechococcus | 1559 | Open in IMG/M |
3300010885|Ga0133913_12544874 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 1245 | Open in IMG/M |
3300012702|Ga0157596_1180913 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Synechococcaceae → Synechococcus → unclassified Synechococcus → Synechococcus sp. CBW1004 | 509 | Open in IMG/M |
3300012706|Ga0157627_1074930 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Prochlorococcaceae → Cyanobium → unclassified Cyanobium → Cyanobium sp. | 536 | Open in IMG/M |
3300012711|Ga0157607_1127249 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Synechococcaceae → Synechococcus → unclassified Synechococcus → Synechococcus sp. CBW1004 | 885 | Open in IMG/M |
3300012714|Ga0157601_1063010 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Synechococcaceae → Synechococcus → unclassified Synechococcus → Synechococcus sp. CBW1004 | 577 | Open in IMG/M |
3300012717|Ga0157609_1192682 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Synechococcaceae → Synechococcus | 701 | Open in IMG/M |
3300012721|Ga0157612_1170642 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Synechococcaceae → Synechococcus | 670 | Open in IMG/M |
3300012723|Ga0157604_1254445 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Synechococcaceae → Synechococcus | 622 | Open in IMG/M |
3300012724|Ga0157611_1030108 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Synechococcaceae → Synechococcus → unclassified Synechococcus → Synechococcus sp. CBW1004 | 596 | Open in IMG/M |
3300012730|Ga0157602_1077997 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Synechococcaceae → Synechococcus → unclassified Synechococcus → Synechococcus sp. CBW1004 | 516 | Open in IMG/M |
3300012731|Ga0157616_1221843 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Synechococcaceae → Synechococcus | 671 | Open in IMG/M |
3300012731|Ga0157616_1229130 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Synechococcaceae → Synechococcus | 697 | Open in IMG/M |
3300012733|Ga0157606_1056669 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Synechococcaceae → Synechococcus → unclassified Synechococcus → Synechococcus sp. CBW1004 | 709 | Open in IMG/M |
3300012733|Ga0157606_1291291 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Synechococcaceae → Synechococcus | 528 | Open in IMG/M |
3300012758|Ga0138285_1099564 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Synechococcaceae → Synechococcus → unclassified Synechococcus → Synechococcus sp. CBW1004 | 536 | Open in IMG/M |
3300012770|Ga0138291_1287925 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Prochlorococcaceae → Cyanobium → unclassified Cyanobium → Cyanobium sp. | 604 | Open in IMG/M |
3300012777|Ga0138292_1049177 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Synechococcaceae → Synechococcus | 657 | Open in IMG/M |
3300012777|Ga0138292_1152290 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Prochlorococcaceae → Cyanobium → unclassified Cyanobium → Cyanobium sp. | 842 | Open in IMG/M |
3300013004|Ga0164293_10048649 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Synechococcaceae | 3426 | Open in IMG/M |
3300013005|Ga0164292_10284947 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 1136 | Open in IMG/M |
3300013005|Ga0164292_10840644 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Prochlorococcaceae → Cyanobium → unclassified Cyanobium → Cyanobium sp. | 578 | Open in IMG/M |
3300020508|Ga0208225_1034013 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Prochlorococcaceae → Cyanobium → unclassified Cyanobium → Cyanobium sp. | 613 | Open in IMG/M |
3300020526|Ga0208085_1001627 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Prochlorococcaceae → Cyanobium | 5550 | Open in IMG/M |
3300020526|Ga0208085_1017967 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Synechococcaceae → Synechococcus → unclassified Synechococcus → Synechococcus sp. CBW1108 | 1014 | Open in IMG/M |
3300020540|Ga0208227_1033835 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Prochlorococcaceae → Cyanobium → unclassified Cyanobium → Cyanobium sp. | 754 | Open in IMG/M |
3300020550|Ga0208600_1064515 | Not Available | 532 | Open in IMG/M |
3300020559|Ga0208083_1006874 | Not Available | 2477 | Open in IMG/M |
3300020560|Ga0208852_1069831 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Prochlorococcaceae → Cyanobium → unclassified Cyanobium → Cyanobium sp. | 551 | Open in IMG/M |
3300020574|Ga0208221_1095655 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Prochlorococcaceae → Cyanobium → unclassified Cyanobium → Cyanobium sp. | 515 | Open in IMG/M |
3300021079|Ga0194055_10000589 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 29336 | Open in IMG/M |
3300021079|Ga0194055_10021880 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Synechococcaceae → Synechococcus | 3813 | Open in IMG/M |
3300021354|Ga0194047_10083997 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales | 1378 | Open in IMG/M |
3300021601|Ga0194061_1165091 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Synechococcaceae → Synechococcus | 654 | Open in IMG/M |
3300027656|Ga0209357_1071165 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales | 1037 | Open in IMG/M |
3300027733|Ga0209297_1048186 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Synechococcaceae → Synechococcus | 1930 | Open in IMG/M |
3300027734|Ga0209087_1059162 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 1722 | Open in IMG/M |
3300027741|Ga0209085_1138750 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Synechococcaceae → Synechococcus | 1036 | Open in IMG/M |
3300027760|Ga0209598_10051033 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 2131 | Open in IMG/M |
3300027763|Ga0209088_10260910 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Synechococcaceae → Synechococcus | 716 | Open in IMG/M |
3300027806|Ga0209985_10237123 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Synechococcaceae → Synechococcus | 850 | Open in IMG/M |
3300027974|Ga0209299_1000125 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales | 39665 | Open in IMG/M |
3300027974|Ga0209299_1000826 | All Organisms → cellular organisms → Bacteria | 17294 | Open in IMG/M |
3300027974|Ga0209299_1062499 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 1524 | Open in IMG/M |
3300027974|Ga0209299_1140294 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Synechococcaceae → Synechococcus | 919 | Open in IMG/M |
3300027974|Ga0209299_1202917 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Synechococcaceae → Synechococcus | 724 | Open in IMG/M |
3300027974|Ga0209299_1207711 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Synechococcaceae → Synechococcus → unclassified Synechococcus → Synechococcus sp. CBW1004 | 714 | Open in IMG/M |
3300027974|Ga0209299_1338717 | Not Available | 516 | Open in IMG/M |
3300031786|Ga0315908_10008961 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales | 7196 | Open in IMG/M |
3300031951|Ga0315904_10619569 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Synechococcaceae → Synechococcus | 927 | Open in IMG/M |
3300033816|Ga0334980_0058559 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Synechococcaceae → Synechococcus | 1624 | Open in IMG/M |
3300033816|Ga0334980_0146265 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales | 968 | Open in IMG/M |
3300033978|Ga0334977_0000029 | All Organisms → cellular organisms → Bacteria | 121548 | Open in IMG/M |
3300033978|Ga0334977_0000463 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Synechococcaceae | 25311 | Open in IMG/M |
3300033980|Ga0334981_0488537 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Synechococcaceae → Synechococcus | 515 | Open in IMG/M |
3300033981|Ga0334982_0064179 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 1998 | Open in IMG/M |
3300033981|Ga0334982_0109697 | All Organisms → cellular organisms → Bacteria | 1446 | Open in IMG/M |
3300033993|Ga0334994_0001578 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 16941 | Open in IMG/M |
3300033993|Ga0334994_0481440 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 580 | Open in IMG/M |
3300033996|Ga0334979_0181391 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Synechococcaceae → Synechococcus | 1253 | Open in IMG/M |
3300033996|Ga0334979_0538131 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Synechococcaceae → Synechococcus → unclassified Synechococcus → Synechococcus sp. CBW1004 | 628 | Open in IMG/M |
3300033996|Ga0334979_0637232 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales | 562 | Open in IMG/M |
3300034062|Ga0334995_0033202 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Synechococcaceae → Synechococcus | 4407 | Open in IMG/M |
3300034062|Ga0334995_0052636 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales | 3317 | Open in IMG/M |
3300034062|Ga0334995_0132593 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales | 1826 | Open in IMG/M |
3300034063|Ga0335000_0253500 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales | 1104 | Open in IMG/M |
3300034093|Ga0335012_0507109 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Prochlorococcaceae → Cyanobium → unclassified Cyanobium → Cyanobium sp. | 571 | Open in IMG/M |
3300034094|Ga0335014_0454703 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Synechococcaceae → Synechococcus | 548 | Open in IMG/M |
3300034102|Ga0335029_0000229 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 45700 | Open in IMG/M |
3300034106|Ga0335036_0042732 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 3502 | Open in IMG/M |
3300034106|Ga0335036_0066168 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 2720 | Open in IMG/M |
3300034106|Ga0335036_0140853 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 1726 | Open in IMG/M |
3300034106|Ga0335036_0153013 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 1640 | Open in IMG/M |
3300034111|Ga0335063_0258771 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Synechococcaceae → Synechococcus | 944 | Open in IMG/M |
3300034119|Ga0335054_0178124 | All Organisms → cellular organisms → Bacteria | 1290 | Open in IMG/M |
3300034119|Ga0335054_0353280 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Synechococcaceae → Synechococcus | 850 | Open in IMG/M |
3300034120|Ga0335056_0634164 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Prochlorococcaceae → Cyanobium → unclassified Cyanobium → Cyanobium sp. | 548 | Open in IMG/M |
3300034166|Ga0335016_0330412 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Synechococcaceae → Synechococcus | 919 | Open in IMG/M |
3300034200|Ga0335065_0160641 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Synechococcaceae → Synechococcus | 1490 | Open in IMG/M |
3300034279|Ga0335052_0075512 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Synechococcaceae → Synechococcus | 2056 | Open in IMG/M |
3300034284|Ga0335013_0108115 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 1939 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 45.19% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 38.46% |
Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 5.77% |
Anoxic Zone Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Zone Freshwater | 3.85% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 2.88% |
Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 1.92% |
Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 1.92% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300004793 | Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.SN (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300009068 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaG | Environmental | Open in IMG/M |
3300009152 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaG | Environmental | Open in IMG/M |
3300009154 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_EF_MetaG | Environmental | Open in IMG/M |
3300009158 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG | Environmental | Open in IMG/M |
3300009160 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_MF_MetaG | Environmental | Open in IMG/M |
3300009164 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaG | Environmental | Open in IMG/M |
3300009180 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG | Environmental | Open in IMG/M |
3300009187 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_EF_MetaG | Environmental | Open in IMG/M |
3300010158 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_MF_MetaG | Environmental | Open in IMG/M |
3300010160 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130628_MF_MetaG | Environmental | Open in IMG/M |
3300010885 | northern Canada Lakes Co-assembly | Environmental | Open in IMG/M |
3300012702 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES114 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012706 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES159 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012711 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES133 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012714 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES125 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012717 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES135 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012721 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES139 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012723 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES129 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012724 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES138 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012730 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES126 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012731 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES145 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012733 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES131 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012758 | Freshwater microbial communities from Lake Simoncouche, Canada - S_130626_E_mt (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012770 | Freshwater microbial communities from Lake Simoncouche, Canada - S_140625_E_mt (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012777 | Freshwater microbial communities from Lake Simoncouche, Canada - S_140709_E_mt (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300013004 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES118 metaG | Environmental | Open in IMG/M |
3300013005 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES117 metaG | Environmental | Open in IMG/M |
3300020508 | Freshwater microbial communities from Lake Mendota, WI - 15JUN2010 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300020526 | Freshwater microbial communities from Lake Mendota, WI - 21JUN2010 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300020540 | Freshwater microbial communities from Lake Mendota, WI - 13JUN2011 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300020550 | Freshwater microbial communities from Lake Mendota, WI - 08OCT2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300020559 | Freshwater microbial communities from Lake Mendota, WI - 07JUL2009 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300020560 | Freshwater microbial communities from Lake Mendota, WI - 18JUN2009 deep hole epilimnion ns (SPAdes) | Environmental | Open in IMG/M |
3300020574 | Freshwater microbial communities from Lake Mendota, WI - 26JUN2009 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300021079 | Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Sep2016-L442-9m | Environmental | Open in IMG/M |
3300021354 | Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Jun2016-L221-5m | Environmental | Open in IMG/M |
3300021601 | Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Sep2016-L224-21m | Environmental | Open in IMG/M |
3300027656 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.SD (SPAdes) | Environmental | Open in IMG/M |
3300027733 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027734 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027741 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027760 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027763 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027806 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel6S_1000h metaG (SPAdes) | Environmental | Open in IMG/M |
3300027974 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300031786 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA124 | Environmental | Open in IMG/M |
3300031951 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA120 | Environmental | Open in IMG/M |
3300033816 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME16Sep2004-rr0005 | Environmental | Open in IMG/M |
3300033978 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME28Sep2014-rr0002 | Environmental | Open in IMG/M |
3300033980 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME09Aug2015-rr0007 | Environmental | Open in IMG/M |
3300033981 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Aug2014-rr0011 | Environmental | Open in IMG/M |
3300033993 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2012-rr0037 | Environmental | Open in IMG/M |
3300033996 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2016-rr0004 | Environmental | Open in IMG/M |
3300034062 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Jul2012-rr0045 | Environmental | Open in IMG/M |
3300034063 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Oct2008D10-rr0053 | Environmental | Open in IMG/M |
3300034093 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME08Jun2014-rr0072 | Environmental | Open in IMG/M |
3300034094 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME11Sep2000-rr0077 | Environmental | Open in IMG/M |
3300034102 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jul2002-rr0112 | Environmental | Open in IMG/M |
3300034106 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23Aug2013-rr0131 | Environmental | Open in IMG/M |
3300034111 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Oct2011-rr0186 | Environmental | Open in IMG/M |
3300034119 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME21Jul2015-rr0166 | Environmental | Open in IMG/M |
3300034120 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2014-rr0172 | Environmental | Open in IMG/M |
3300034166 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME13Sep2012-rr0079 | Environmental | Open in IMG/M |
3300034200 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Jul2013-rr0190 | Environmental | Open in IMG/M |
3300034279 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jul2014-rr0163 | Environmental | Open in IMG/M |
3300034284 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME08Jul2016-rr0075 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
Ga0007760_112662242 | 3300004793 | Freshwater Lake | LLLETDVVAEGGDVVIGGKQSDQAEDHSPAGLDGTEVIQA |
Ga0114973_100121406 | 3300009068 | Freshwater Lake | LLLEADAAAEGGDVVIGGKESDQAKDHPPAGLDGTEVVQAGPGSLKYW* |
Ga0114980_100174973 | 3300009152 | Freshwater Lake | LLLEADAAAEDGDVVIGRKKSDQAEKQTAAGLDGTEVIQAGPGALWCW* |
Ga0114980_100679484 | 3300009152 | Freshwater Lake | LLLEADTAAEDGDVVIGGKECDQAKDHSPAGLDGTEVIQAGPGALWCW* |
Ga0114980_101070762 | 3300009152 | Freshwater Lake | LLLEADTAAEGGDVVIGGKECDQAKDHSPTSLDGTEVIQAGPGALWCW* |
Ga0114980_105579602 | 3300009152 | Freshwater Lake | LLLEADAAAEGGDVVIRGKECDQAKNHSPTGLEGTEVIQTGPGALLYW* |
Ga0114963_100250102 | 3300009154 | Freshwater Lake | LLLETDAAAEGGDVVIGGKQSDQAKDHSPAGLDGTELIQAGPGALWCW* |
Ga0114977_100301765 | 3300009158 | Freshwater Lake | LLLETDVVAEGGDVVIGGKQSDQAEDHSPASLDGTEVIQAGPGALWYW* |
Ga0114977_104869372 | 3300009158 | Freshwater Lake | GSDEGDAPLLLEADTAAEGGDVVIGGKECDQAKNHSPAGLDGTEVIEAGPGPLWWW* |
Ga0114981_102904862 | 3300009160 | Freshwater Lake | LLLETDGAAGEGDVVIGGKQSDQAEDHSPAGLDGTEVIQAGPGALWCW* |
Ga0114975_102272493 | 3300009164 | Freshwater Lake | LLLETDAAAEGGDVVIGGKESDQADDQTATGLEGTEVIQAGPGALCCCQSWRS* |
Ga0114975_104311272 | 3300009164 | Freshwater Lake | LLLEADAAAEGGDVVIGGKECDQAKDHSPAGLNGTEVIEAGPGPLWWW* |
Ga0114979_103856381 | 3300009180 | Freshwater Lake | GGDVVIGGKECDQAKDHSPAGLNGTEVIQAGPGPLLYW* |
Ga0114979_104145282 | 3300009180 | Freshwater Lake | LLLETDAAAEGGDVVIGRKESDQADDQTATGLDGTEVIQAGPGALCCCQFWRS* |
Ga0114979_104311781 | 3300009180 | Freshwater Lake | GDVVIGGKECDQAKDHSPAGLNGTEVIQAGPGPLWYW* |
Ga0114979_105547811 | 3300009180 | Freshwater Lake | AEGGDVVIGGKQSDQAEDHSPASLDGTEVIQAGPGALWYW* |
Ga0114979_108490172 | 3300009180 | Freshwater Lake | AAEGGDVVIGGKESDQAKDHSPAGLDGTEVIQAGPGALSCW* |
Ga0114972_100557923 | 3300009187 | Freshwater Lake | LLLEADTAAEGGDVVIGGKECDQAKDHSPAGLNGTEVIQAGPGALLYW* |
Ga0114972_100805083 | 3300009187 | Freshwater Lake | LLLEIDAAAEGGDVVIGGKQSNQADDQTATGLDGTEVIQAGPGALWYW* |
Ga0114960_101420563 | 3300010158 | Freshwater Lake | LLLEADTAAEGGDVVIGGKECHQANDHSPAGLDGTEVIQAGPGALWWC* |
Ga0114960_103924982 | 3300010158 | Freshwater Lake | LLLESEAAAEGGDVVIGRKESDQADNQTPTGLDGTEVIQAGPGALWWM* |
Ga0114967_100199746 | 3300010160 | Freshwater Lake | DGAAGEGDVVIRGKEGNQAENQAAAGLDGTEVIEPGPGALWWS* |
Ga0133913_116700252 | 3300010885 | Freshwater Lake | LLEADAAAEGGDVVIGGKECDQAKDHSPAGLDGTEVIQAGPGALWWC* |
Ga0133913_117506322 | 3300010885 | Freshwater Lake | LLLEADAAAEGGDVVIGGKECDQAKDHSPAGLNGTEVIQAGPGPLWYW* |
Ga0133913_125448743 | 3300010885 | Freshwater Lake | LLLEIDAAAEGGDVVIGGKQSNQADDQTATGLDGTEVIQAGPGA |
Ga0157596_11809131 | 3300012702 | Freshwater | LLLETDAAAEGGDVVIGGKESDQAKDHSPAGLDGTEVIQA |
Ga0157627_10749302 | 3300012706 | Freshwater | LLLETDAAAEGGDVVIGGKQSDQAEDHSPAGLDGTEVIQAWPGALLCW* |
Ga0157607_11272491 | 3300012711 | Freshwater | LLLEADAAAEGGDVVIGGKECDQAKDHPPAGLDGTEVIQ |
Ga0157601_10630101 | 3300012714 | Freshwater | LLLEADAAAEGGDVVIGGKECDQAKDHPPAGLDGTEVIQAGP |
Ga0157609_11926822 | 3300012717 | Freshwater | LLLEADAAVEDGDVVIGGKESDQAKDHSPAGLDGTEVIQAGPGALWYW* |
Ga0157612_11706423 | 3300012721 | Freshwater | LLLEADAAVEDGDVVIGGKESDQAKDHSSAGLDGTEVIQAW |
Ga0157604_12544452 | 3300012723 | Freshwater | LLLEADAAVEDGDVVIGGKESDQAKDHSPAGLDGTEVIQA |
Ga0157611_10301082 | 3300012724 | Freshwater | LLLEADAAAEGGDVVIGGKECDQAKDHSPTGLNGTEVIQ |
Ga0157602_10779972 | 3300012730 | Freshwater | LLLETDAAAEGGDVVIGGKESDQAKDHSAAGLNGTEVIQAG |
Ga0157616_12218431 | 3300012731 | Freshwater | LLLEADAAVEDGDVVIGGKESDQADAQTATGLDGTEVIQAGPSALC* |
Ga0157616_12291301 | 3300012731 | Freshwater | LLLEGDAAAEGGDVVIGGKQSDQAEDHSPAGLDGTEVIQAGPGA |
Ga0157606_10566691 | 3300012733 | Freshwater | LLLETDVVAGEGDVVIGSKQGYQAEDQAATGLDGTEVIQ |
Ga0157606_12912912 | 3300012733 | Freshwater | LLLEADAAVEDGDVVIGGKESDQAKDHSPAGLDGTEVIQAWPGALLCW* |
Ga0138285_10995642 | 3300012758 | Freshwater Lake | LLLEADAAAEGGDVVIGGKECDQAKDHSPAGLNGTEVIQAGPGALSCW* |
Ga0138291_12879251 | 3300012770 | Freshwater Lake | LLLETDVVAEGGDVVIGGKQSDQAEDHSPAGLDGTEV |
Ga0138292_10491772 | 3300012777 | Freshwater Lake | LLLETDAAAEGGDVVIGGKESDQADDQTAAGLDGTEMIQAGPGALWCFQFWRS* |
Ga0138292_11522902 | 3300012777 | Freshwater Lake | LLLETDVVAEGGDVVIGGKQSDQAEEQSATGLDGTEVIQAWRGALWFW* |
Ga0164293_100486495 | 3300013004 | Freshwater | LLLEADAAAEGGDVVIGGKESDQADGQTAPGLDGTEVIQAGPGALCSC* |
Ga0164292_102849473 | 3300013005 | Freshwater | LLLEADAAAEGGDVVIGRKESDQAKDHPPAGLDGTEVIQAGPGSL* |
Ga0164292_108406441 | 3300013005 | Freshwater | DAAAEDGDVVIGGKESDQAEKQTAAGLDGTEVIQAGPGAL* |
Ga0208225_10340133 | 3300020508 | Freshwater | LLLETDAAAEGGDVVIGGKESDQADAQTATGLDGTEVIQAGPGALLYW |
Ga0208085_10016276 | 3300020526 | Freshwater | LLLEADAAAEGVDVVIGGKECDQAKDHSPAGLDGTEVIQAWPGALLCW |
Ga0208085_10179672 | 3300020526 | Freshwater | LLLETDAAAEGGDVVIGGKESDQAKDHSAAGLNGTEVIQAGPGALWCFQFWRS |
Ga0208227_10338351 | 3300020540 | Freshwater | LLLEADAAAEGGDVVIGGKECDQAKDHSPAGLDGTEVIQAWPGALLYW |
Ga0208600_10645153 | 3300020550 | Freshwater | LLLEADAAAEDADVVIGGKESDQAEDHSPTGLNGTE |
Ga0208083_10068744 | 3300020559 | Freshwater | LLLEIDAAAEGGDVVIGRKESDQADAQTATGLDGTEVIQAGPSALC |
Ga0208852_10698311 | 3300020560 | Freshwater | LLLEADAAAEGGDVVIRGKECDQAKDHSPTGLDGTEVIQTGPGALWWM |
Ga0208221_10956552 | 3300020574 | Freshwater | LLLEIDAAAEGGDVVIGRKESDQADAQTATGLDGTELIQAGPSALCYWQFWRSWGRLAVS |
Ga0194055_1000058925 | 3300021079 | Anoxic Zone Freshwater | LLLETDAAAEGGDVVIGGKQSDQAEDHSPAGLDGTEVIQAEPGALWC |
Ga0194055_100218805 | 3300021079 | Anoxic Zone Freshwater | LLLEADAAVEDGDVVIGGKESDQAKDHSPAGLDGTEVIQAWPGALLCW |
Ga0194047_100839974 | 3300021354 | Anoxic Zone Freshwater | LLLEADAAAEGGDVVIGGKECDQAKDHSAAGLDGTEVIQTG |
Ga0194061_11650913 | 3300021601 | Anoxic Zone Freshwater | LLLETDAAAEGGDVVIGGKECDQAKDHSPNGLDGTEVIQAGPGALWC |
Ga0209357_10711652 | 3300027656 | Freshwater Lake | LLLEADAAAEGGDVVIGGKECDQAKDHPPAGLDGTEVIQAGPGSL |
Ga0209297_10481863 | 3300027733 | Freshwater Lake | LLLETDAAAEDGDVVIGGKESDQAEKQTAAGLDGTEVIQAGPGAL |
Ga0209087_10591623 | 3300027734 | Freshwater Lake | LLLETDVVAEGGDVVIGGKQSDQAEDHSPAGLDGTEVIQAEPGALCSC |
Ga0209085_11387502 | 3300027741 | Freshwater Lake | LLLEADTAAEGGDVVIGGKESDQAKDHSPAGLDGTEVIQAGPGAFCYW |
Ga0209598_100510333 | 3300027760 | Freshwater Lake | LLLEIDAAAEGGDVVIGGKQSNQADDQTATGLDGTEVIQAGPGALWYW |
Ga0209088_102609101 | 3300027763 | Freshwater Lake | LLLETDAAAEGGDVVIGRKESDQADDQTATGLDGTEVIQAGPGALCCCQFWRS |
Ga0209985_102371233 | 3300027806 | Freshwater Lake | LLLEGDAAAEGGDVVIGGKECDQAKDHSPAGLDGTEVIQAWPGAL |
Ga0209299_100012519 | 3300027974 | Freshwater Lake | LLLEADAAAEGGDVVIGGKESDQAKDHSPAGLDGTEVIQAGPGALLYW |
Ga0209299_100082611 | 3300027974 | Freshwater Lake | LLLEADAAAEGGDVVIRGKECDQAKNHSPTGLEGTEVIQTGPGALLYW |
Ga0209299_10624991 | 3300027974 | Freshwater Lake | LLLEADAAAEGGDVVIGGKECDQAKDHSPAGLDGTDVIQAGPGALWCW |
Ga0209299_11402942 | 3300027974 | Freshwater Lake | LLLEADTAAEGGDVVIGGKECDQAKDHSPTGLDGTEVIQAGPGALWCW |
Ga0209299_12029172 | 3300027974 | Freshwater Lake | LLLETDGAAGEGDVVIGGKQSDQAEDHSPAGLDGTEVIQAGPGALWCW |
Ga0209299_12077111 | 3300027974 | Freshwater Lake | LLLEADAAAEGGDVVIGGKECDQAKDHSPAGLNGTEVIQA |
Ga0209299_13387172 | 3300027974 | Freshwater Lake | SPLLLETDAAAEGGDVVIGGKESDQADDQTAAGLDGTEMIQAGPGALGC |
Ga0315908_100089617 | 3300031786 | Freshwater | LLLQADAAAEGGDVVIGGKESDQAKDHPPAGLDGTEVVQAGPGSLKYW |
Ga0315904_106195692 | 3300031951 | Freshwater | LLLEGDAAAEGGDVVIGGKECDQAKDHSPAGLDGTEVIQAWPGALLYW |
Ga0334980_0058559_1438_1584 | 3300033816 | Freshwater | LLLEADAAAEGGDVVIGGKECDQAKDHSPAGLDGTEVIQAWPGALLCW |
Ga0334980_0146265_140_277 | 3300033816 | Freshwater | LLLEADAAAEGGDVVIGGKECDQAKDHPPAGLDGTEVIQAGPGTL |
Ga0334977_0000029_9130_9276 | 3300033978 | Freshwater | LLLEADAAAEGGDVVIGGKECDQAKDHSPAGLDGTEVIQAGPGALLCW |
Ga0334977_0000463_4236_4397 | 3300033978 | Freshwater | LLLEADVVAEGGDVVIGRKESDQAKDQAAAGLDGTELIQAGPGALWCFQFWRS |
Ga0334981_0488537_62_199 | 3300033980 | Freshwater | LLLETDAAAEGGDVVIGGKECDQAEDHPPAGLDGTEVIQAGPGSL |
Ga0334982_0064179_1669_1815 | 3300033981 | Freshwater | LLLETDAAAEGGDVAIGGKQSDQAEEQSATGLDGTELIQAWPGALWFC |
Ga0334982_0109697_569_715 | 3300033981 | Freshwater | LLLEADAAAEGGDVVIGGKECDQAKDHSPAGLDGTEVIQAGPGALWCW |
Ga0334994_0001578_7869_8015 | 3300033993 | Freshwater | MLLEADAAAEDADVVIGGKESDQAEDHSPTGLNGTEVIQAGPGELWCW |
Ga0334994_0481440_458_580 | 3300033993 | Freshwater | AEGGDVVIGGKESDQAKDHSPAGLDGTEVIQAGPGALFYW |
Ga0334979_0181391_345_491 | 3300033996 | Freshwater | LLLEADAAAEGGDVVIGGKQSDQAKEHSPAGLDGTEVIQAGPGALWCW |
Ga0334979_0538131_364_510 | 3300033996 | Freshwater | LLLEGDAAAEGGDVVIGGKQSDQAEDHSPAGLDGTEVIQAGPGAPWFW |
Ga0334979_0637232_115_261 | 3300033996 | Freshwater | LLLEADAAAEDGDVVIGRKKSDQAEKQTAAGLDGTEVIQAGPGALWCW |
Ga0334995_0033202_3891_4052 | 3300034062 | Freshwater | LLLETDVVAEGGDVVIGGKQSDQAEDQTAAGLNGTELIQAGPGALWCFQFWRS |
Ga0334995_0052636_1359_1505 | 3300034062 | Freshwater | LLLEADAAAEGGDVVIGGKESDQAKDHSPAGLDGTEVIQAGPGALFYW |
Ga0334995_0132593_200_346 | 3300034062 | Freshwater | LLLEAHTAAEGGDVVIRGKECDQAKDHSPTGLDGTEVIQTGPGALWWM |
Ga0335000_0253500_338_484 | 3300034063 | Freshwater | LLLEADAAAEGGDVVIGGEECDQAKDHSPAGLDGTEVIQAGPGALWYG |
Ga0335012_0507109_3_128 | 3300034093 | Freshwater | DAAAEGGDVVIGRKESDQADAQTATGLDGTEVIQAGPSALC |
Ga0335014_0454703_358_504 | 3300034094 | Freshwater | LLLEADAAAEGGDVVIGGKECDQAKDHSPAGLNGTEVIQAGPGPLWYW |
Ga0335029_0000229_37438_37578 | 3300034102 | Freshwater | LLLETDTAAEGGDVVIGRKESDQADAQTATGLDGTELIQAGPSALC |
Ga0335036_0042732_2346_2492 | 3300034106 | Freshwater | LLLEADAAAEGGDVVIGGKECDQAKDHSPAGLNGTEVVQAGPGALSCW |
Ga0335036_0066168_3_143 | 3300034106 | Freshwater | LETDAAAEGGDVAIGGKQSDQAEEQSATGLDGTELIQAWPGALWFC |
Ga0335036_0140853_3_131 | 3300034106 | Freshwater | LLLETDAAAEGGDVAIGGKQSDQAEEQSATGLDGTELIQAWPG |
Ga0335036_0153013_103_249 | 3300034106 | Freshwater | LLLEADTAAEGGDVVIGGKESDQAKDHSPAGLDGTEVIQAGPGALWYG |
Ga0335063_0258771_485_631 | 3300034111 | Freshwater | LLLETDAAAEDGDVVIGGKESDQAEKQTAAGLDGTEVIQAGPGALWCW |
Ga0335054_0178124_67_213 | 3300034119 | Freshwater | LLLEADAAAEGGDVVIGGKECDQAKDHSAAGLDGTEVVQAGPGALSCW |
Ga0335054_0353280_272_418 | 3300034119 | Freshwater | LLLEADAAAEGGDVVIGGKQSDQAEEHSPAGLDGTEVIQAGPGALWCW |
Ga0335056_0634164_79_225 | 3300034120 | Freshwater | LLLEADTAAEGGDVVIRGKECDQAKDHSPTGLDGTEVIQTGPGALWWM |
Ga0335016_0330412_1_126 | 3300034166 | Freshwater | LLLEADAAVEDGDVVIGGKESDQAKDHSPAGLDGTEVIQAWP |
Ga0335065_0160641_790_936 | 3300034200 | Freshwater | LLLEADAAAEDGDVVIGGKESDQAKDHSPAGLDGTEVIQAWPGALLCW |
Ga0335052_0075512_1050_1196 | 3300034279 | Freshwater | LLLEADAAAEGGDVVIGGKESDQAKDHSPAGLDGTEVIQAWPGALLCW |
Ga0335013_0108115_28_165 | 3300034284 | Freshwater | LLLEADAAAEGGDVVIGRKESDQAKDHPPAGLDGTEVIQAGPGSL |
⦗Top⦘ |