Basic Information | |
---|---|
Family ID | F096251 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 105 |
Average Sequence Length | 46 residues |
Representative Sequence | ALDKKARRGKVAWVMPRRIGHAEIGHAVPGALVRRVVTRSLA |
Number of Associated Samples | 86 |
Number of Associated Scaffolds | 105 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 0.00 % |
% of genes near scaffold ends (potentially truncated) | 98.10 % |
% of genes from short scaffolds (< 2000 bps) | 81.90 % |
Associated GOLD sequencing projects | 80 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.35 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (88.571 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil (25.714 % of family members) |
Environment Ontology (ENVO) | Unclassified (44.762 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (62.857 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 21.43% β-sheet: 0.00% Coil/Unstructured: 78.57% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.35 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 105 Family Scaffolds |
---|---|---|
PF01220 | DHquinase_II | 64.76 |
PF08207 | EFP_N | 11.43 |
PF03780 | Asp23 | 7.62 |
PF01513 | NAD_kinase | 4.76 |
PF01029 | NusB | 2.86 |
PF09285 | Elong-fact-P_C | 2.86 |
PF02681 | DUF212 | 1.90 |
PF02609 | Exonuc_VII_S | 0.95 |
PF02616 | SMC_ScpA | 0.95 |
PF01728 | FtsJ | 0.95 |
PF01761 | DHQ_synthase | 0.95 |
COG ID | Name | Functional Category | % Frequency in 105 Family Scaffolds |
---|---|---|---|
COG0757 | 3-dehydroquinate dehydratase | Amino acid transport and metabolism [E] | 64.76 |
COG0231 | Translation elongation factor P (EF-P)/translation initiation factor 5A (eIF-5A) | Translation, ribosomal structure and biogenesis [J] | 11.43 |
COG1302 | Uncharacterized conserved protein YloU, alkaline shock protein (Asp23) family | Function unknown [S] | 7.62 |
COG1963 | Acid phosphatase family membrane protein YuiD | General function prediction only [R] | 1.90 |
COG0293 | 23S rRNA U2552 (ribose-2'-O)-methylase RlmE/FtsJ | Translation, ribosomal structure and biogenesis [J] | 0.95 |
COG1189 | Predicted rRNA methylase YqxC, contains S4 and FtsJ domains | Translation, ribosomal structure and biogenesis [J] | 0.95 |
COG1354 | Chromatin segregation and condensation protein Rec8/ScpA/Scc1, kleisin family | Replication, recombination and repair [L] | 0.95 |
COG1722 | Exonuclease VII small subunit | Replication, recombination and repair [L] | 0.95 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 88.57 % |
Unclassified | root | N/A | 11.43 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300000956|JGI10216J12902_105758402 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia | 2428 | Open in IMG/M |
3300001409|JGI20185J14861_1004094 | All Organisms → cellular organisms → Bacteria | 1310 | Open in IMG/M |
3300001535|A3PFW1_10476274 | All Organisms → cellular organisms → Bacteria | 632 | Open in IMG/M |
3300002562|JGI25382J37095_10077823 | All Organisms → cellular organisms → Bacteria | 1223 | Open in IMG/M |
3300002916|JGI25389J43894_1061590 | All Organisms → cellular organisms → Bacteria | 638 | Open in IMG/M |
3300004479|Ga0062595_100977236 | All Organisms → cellular organisms → Bacteria | 724 | Open in IMG/M |
3300004479|Ga0062595_102294401 | All Organisms → cellular organisms → Bacteria | 532 | Open in IMG/M |
3300005167|Ga0066672_10160834 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia | 1413 | Open in IMG/M |
3300005171|Ga0066677_10455113 | All Organisms → cellular organisms → Bacteria | 733 | Open in IMG/M |
3300005174|Ga0066680_10954676 | All Organisms → cellular organisms → Bacteria | 505 | Open in IMG/M |
3300005179|Ga0066684_10017690 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 3643 | Open in IMG/M |
3300005181|Ga0066678_10090591 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 1832 | Open in IMG/M |
3300005334|Ga0068869_101993547 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 521 | Open in IMG/M |
3300005440|Ga0070705_101126184 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 643 | Open in IMG/M |
3300005440|Ga0070705_101774622 | All Organisms → cellular organisms → Bacteria | 523 | Open in IMG/M |
3300005445|Ga0070708_101575375 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia | 612 | Open in IMG/M |
3300005446|Ga0066686_10245735 | All Organisms → cellular organisms → Bacteria | 1207 | Open in IMG/M |
3300005467|Ga0070706_100850484 | All Organisms → cellular organisms → Bacteria | 843 | Open in IMG/M |
3300005467|Ga0070706_101546745 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales | 606 | Open in IMG/M |
3300005468|Ga0070707_100715219 | All Organisms → cellular organisms → Bacteria | 964 | Open in IMG/M |
3300005468|Ga0070707_102195541 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 519 | Open in IMG/M |
3300005471|Ga0070698_100226332 | All Organisms → cellular organisms → Bacteria | 1803 | Open in IMG/M |
3300005530|Ga0070679_101268224 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales | 682 | Open in IMG/M |
3300005536|Ga0070697_100810392 | All Organisms → cellular organisms → Bacteria | 829 | Open in IMG/M |
3300005552|Ga0066701_10821984 | All Organisms → cellular organisms → Bacteria | 553 | Open in IMG/M |
3300005552|Ga0066701_10888849 | All Organisms → cellular organisms → Bacteria | 528 | Open in IMG/M |
3300005553|Ga0066695_10146952 | All Organisms → cellular organisms → Bacteria | 1466 | Open in IMG/M |
3300005554|Ga0066661_10014554 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia | 4034 | Open in IMG/M |
3300005554|Ga0066661_10397033 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia | 844 | Open in IMG/M |
3300005555|Ga0066692_10004493 | All Organisms → cellular organisms → Bacteria | 6055 | Open in IMG/M |
3300005555|Ga0066692_10822878 | All Organisms → cellular organisms → Bacteria | 570 | Open in IMG/M |
3300005556|Ga0066707_10013058 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia | 4180 | Open in IMG/M |
3300005561|Ga0066699_10259102 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 1230 | Open in IMG/M |
3300005586|Ga0066691_10003661 | All Organisms → cellular organisms → Bacteria | 6501 | Open in IMG/M |
3300005764|Ga0066903_107864272 | All Organisms → cellular organisms → Bacteria | 548 | Open in IMG/M |
3300006057|Ga0075026_100566124 | All Organisms → cellular organisms → Bacteria | 663 | Open in IMG/M |
3300006755|Ga0079222_12131051 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales | 555 | Open in IMG/M |
3300006794|Ga0066658_10770235 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 539 | Open in IMG/M |
3300006806|Ga0079220_10883850 | All Organisms → cellular organisms → Bacteria | 690 | Open in IMG/M |
3300006903|Ga0075426_10861481 | All Organisms → cellular organisms → Bacteria | 683 | Open in IMG/M |
3300006903|Ga0075426_11439965 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 523 | Open in IMG/M |
3300007258|Ga0099793_10625132 | Not Available | 541 | Open in IMG/M |
3300007265|Ga0099794_10025154 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 2739 | Open in IMG/M |
3300009012|Ga0066710_100739643 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 1503 | Open in IMG/M |
3300009012|Ga0066710_101038245 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 1266 | Open in IMG/M |
3300009012|Ga0066710_102348916 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia | 774 | Open in IMG/M |
3300009038|Ga0099829_10256066 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 1428 | Open in IMG/M |
3300009088|Ga0099830_11167779 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 639 | Open in IMG/M |
3300009093|Ga0105240_12435619 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 542 | Open in IMG/M |
3300009137|Ga0066709_101528786 | All Organisms → cellular organisms → Bacteria | 961 | Open in IMG/M |
3300009137|Ga0066709_103451257 | Not Available | 574 | Open in IMG/M |
3300009661|Ga0105858_1042767 | All Organisms → cellular organisms → Bacteria | 1156 | Open in IMG/M |
3300010325|Ga0134064_10323716 | Not Available | 594 | Open in IMG/M |
3300010326|Ga0134065_10446872 | Not Available | 528 | Open in IMG/M |
3300010326|Ga0134065_10449544 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 527 | Open in IMG/M |
3300010335|Ga0134063_10430217 | Not Available | 651 | Open in IMG/M |
3300010336|Ga0134071_10798130 | Not Available | 505 | Open in IMG/M |
3300010399|Ga0134127_10419015 | All Organisms → cellular organisms → Bacteria | 1330 | Open in IMG/M |
3300010400|Ga0134122_12026547 | Not Available | 614 | Open in IMG/M |
3300012198|Ga0137364_10092356 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia | 2115 | Open in IMG/M |
3300012199|Ga0137383_11091310 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 578 | Open in IMG/M |
3300012201|Ga0137365_10478837 | All Organisms → cellular organisms → Bacteria | 916 | Open in IMG/M |
3300012211|Ga0137377_10093641 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia | 2839 | Open in IMG/M |
3300012349|Ga0137387_10234282 | All Organisms → cellular organisms → Bacteria | 1321 | Open in IMG/M |
3300012349|Ga0137387_10495160 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 887 | Open in IMG/M |
3300012349|Ga0137387_11219268 | Not Available | 530 | Open in IMG/M |
3300012358|Ga0137368_10497494 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia | 786 | Open in IMG/M |
3300012359|Ga0137385_10308513 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 1360 | Open in IMG/M |
3300012359|Ga0137385_10944067 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 712 | Open in IMG/M |
3300012362|Ga0137361_11246246 | Not Available | 667 | Open in IMG/M |
3300012399|Ga0134061_1213908 | Not Available | 561 | Open in IMG/M |
3300012923|Ga0137359_11304198 | All Organisms → cellular organisms → Bacteria | 614 | Open in IMG/M |
3300012927|Ga0137416_10104579 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 2136 | Open in IMG/M |
3300012975|Ga0134110_10186746 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 866 | Open in IMG/M |
3300012977|Ga0134087_10547902 | All Organisms → cellular organisms → Bacteria | 590 | Open in IMG/M |
3300014154|Ga0134075_10075679 | All Organisms → cellular organisms → Bacteria | 1409 | Open in IMG/M |
3300014157|Ga0134078_10476892 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 575 | Open in IMG/M |
3300017654|Ga0134069_1138999 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia | 807 | Open in IMG/M |
3300018431|Ga0066655_10565136 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales | 762 | Open in IMG/M |
3300020581|Ga0210399_11124052 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 628 | Open in IMG/M |
3300021478|Ga0210402_11909476 | All Organisms → cellular organisms → Bacteria | 520 | Open in IMG/M |
3300022691|Ga0248483_170688 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 540 | Open in IMG/M |
3300025581|Ga0208355_1047541 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales | 1066 | Open in IMG/M |
3300025922|Ga0207646_10121117 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia | 2350 | Open in IMG/M |
3300025922|Ga0207646_10807437 | All Organisms → cellular organisms → Bacteria | 835 | Open in IMG/M |
3300026298|Ga0209236_1002079 | All Organisms → cellular organisms → Bacteria | 12204 | Open in IMG/M |
3300026308|Ga0209265_1212156 | Not Available | 526 | Open in IMG/M |
3300026310|Ga0209239_1146179 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 946 | Open in IMG/M |
3300026315|Ga0209686_1026016 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia | 2284 | Open in IMG/M |
3300026316|Ga0209155_1135457 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 840 | Open in IMG/M |
3300026329|Ga0209375_1026330 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia | 3218 | Open in IMG/M |
3300026334|Ga0209377_1214043 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 637 | Open in IMG/M |
3300026514|Ga0257168_1090409 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 680 | Open in IMG/M |
3300026524|Ga0209690_1173372 | All Organisms → cellular organisms → Bacteria | 732 | Open in IMG/M |
3300026524|Ga0209690_1255870 | Not Available | 551 | Open in IMG/M |
3300026530|Ga0209807_1336563 | All Organisms → cellular organisms → Bacteria | 514 | Open in IMG/M |
3300026532|Ga0209160_1105504 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia | 1417 | Open in IMG/M |
3300026550|Ga0209474_10047858 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia | 3075 | Open in IMG/M |
3300026552|Ga0209577_10022744 | All Organisms → cellular organisms → Bacteria | 5525 | Open in IMG/M |
3300026552|Ga0209577_10506869 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia | 799 | Open in IMG/M |
3300027846|Ga0209180_10726420 | All Organisms → cellular organisms → Bacteria | 538 | Open in IMG/M |
3300027882|Ga0209590_10021309 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia | 3276 | Open in IMG/M |
3300027882|Ga0209590_10279273 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 1070 | Open in IMG/M |
3300028536|Ga0137415_10153768 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 2136 | Open in IMG/M |
3300031754|Ga0307475_10064925 | All Organisms → cellular organisms → Bacteria | 2779 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 25.71% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 20.00% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 10.48% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 10.48% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 9.52% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 3.81% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 2.86% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.90% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.90% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.90% |
Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 1.90% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.90% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.95% |
Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 0.95% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.95% |
Permafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil | 0.95% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.95% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.95% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.95% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.95% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
3300001409 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 53-1 deep-072012 | Environmental | Open in IMG/M |
3300001535 | Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A3-PF-15A)- 1 week illumina | Environmental | Open in IMG/M |
3300002562 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_40cm | Environmental | Open in IMG/M |
3300002916 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_20cm | Environmental | Open in IMG/M |
3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
3300005167 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 | Environmental | Open in IMG/M |
3300005171 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 | Environmental | Open in IMG/M |
3300005174 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 | Environmental | Open in IMG/M |
3300005179 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 | Environmental | Open in IMG/M |
3300005181 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 | Environmental | Open in IMG/M |
3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Host-Associated | Open in IMG/M |
3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
3300005446 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 | Environmental | Open in IMG/M |
3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Environmental | Open in IMG/M |
3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
3300005553 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 | Environmental | Open in IMG/M |
3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
3300005561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 | Environmental | Open in IMG/M |
3300005586 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 | Environmental | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300006057 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2012 | Environmental | Open in IMG/M |
3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
3300006794 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 | Environmental | Open in IMG/M |
3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Host-Associated | Open in IMG/M |
3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
3300009661 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil DNA_2013-062 | Environmental | Open in IMG/M |
3300010325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_0_1 metaG | Environmental | Open in IMG/M |
3300010326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300010335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015 | Environmental | Open in IMG/M |
3300010336 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09082015 | Environmental | Open in IMG/M |
3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
3300012358 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_100_16 metaG | Environmental | Open in IMG/M |
3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
3300012399 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_24_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012975 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_11112015 | Environmental | Open in IMG/M |
3300012977 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300014154 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09212015 | Environmental | Open in IMG/M |
3300014157 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300017654 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
3300022691 | Soil microbial communities from Calhoun CZO, South Carolina, United States - 60cm depth | Environmental | Open in IMG/M |
3300025581 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-3 deep-072012 (SPAdes) | Environmental | Open in IMG/M |
3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300026298 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
3300026308 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 (SPAdes) | Environmental | Open in IMG/M |
3300026310 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm (SPAdes) | Environmental | Open in IMG/M |
3300026315 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 (SPAdes) | Environmental | Open in IMG/M |
3300026316 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 (SPAdes) | Environmental | Open in IMG/M |
3300026329 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 (SPAdes) | Environmental | Open in IMG/M |
3300026334 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 (SPAdes) | Environmental | Open in IMG/M |
3300026514 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-13-B | Environmental | Open in IMG/M |
3300026524 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 (SPAdes) | Environmental | Open in IMG/M |
3300026530 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 (SPAdes) | Environmental | Open in IMG/M |
3300026532 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 (SPAdes) | Environmental | Open in IMG/M |
3300026550 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes) | Environmental | Open in IMG/M |
3300026552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes) | Environmental | Open in IMG/M |
3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
JGI10216J12902_1057584021 | 3300000956 | Soil | ARRGKVAWVMPRRIGHAEIGHAVPGALVRRVVTRSLA* |
JGI20185J14861_10040944 | 3300001409 | Arctic Peat Soil | RGKVAWVLPRRLGHAETGHAVPGAIVSRVLRKALA* |
A3PFW1_104762741 | 3300001535 | Permafrost | DKKARRGKVAWVLPRRLGHAETGHEVPGAIVSRVLRKALA* |
JGI25382J37095_100778233 | 3300002562 | Grasslands Soil | RADPKRVLAAIALDKKARRGKVAWVMPRRIGHAEIGHSVPGAIIRRVVTXSLA* |
JGI25389J43894_10615901 | 3300002916 | Grasslands Soil | VLAAVALDKKARRGKVAWVMPRRIGHAEIGHAVPGALVRRVITRSLA* |
Ga0062595_1009772363 | 3300004479 | Soil | DKKARRGRVAWVLPRRIGYAEVGHTVPPGLVRRVIRKALA* |
Ga0062595_1022944012 | 3300004479 | Soil | LGLPDRAPRANAKRVLAAIALDKKARRGKVAWVMPRRIGHAEIGHAVPGALVRRVVTRSLA* |
Ga0066672_101608344 | 3300005167 | Soil | AFGLPDRPPHADPKRVLAAMAVDKKARRGKVAWVMPRRIGHAEIGHTVPGAVVRRVLTRSLT* |
Ga0066677_104551133 | 3300005171 | Soil | DKKARRGRVAWVLPRRIGHAVIGQDVPARLVRRVVRRAIA* |
Ga0066680_109546761 | 3300005174 | Soil | PDKPPHADPKRVLAAVALDKKARRGKVAWVMPRRIGHAEIGHAVPGALVRRVITRSMA* |
Ga0066684_100176901 | 3300005179 | Soil | PDKPPHADPKRVLAAMAADKKARRGKVAWVMPRRIGHAEIGHTVPGALVRRVITRSLA* |
Ga0066678_100905911 | 3300005181 | Soil | VLAAMALDKKARRGKVAWVMPRRIGHAEIGHSVPAPVVRRVVARSLA* |
Ga0068869_1019935471 | 3300005334 | Miscanthus Rhizosphere | RPPSVDASRVLAAIPHDKKSRRGKVAWVMPRRLGHAEPGHAVPASVVRRVVRKSLA* |
Ga0070705_1011261841 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | RDKKARRGKVAWVMPRRMGHAEPGHIVPSPLVRRVVTRALA* |
Ga0070705_1017746221 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | AVDKKARRGKVAWVMPRRIGHAEIGHAVPGALVRRVLIRSLA* |
Ga0070708_1015753751 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | VDKKARRGKVAWVMPRRIGHAEIGHTVPAPLVRRVVTRSLA* |
Ga0066686_102457351 | 3300005446 | Soil | FGLPDRPPSADPDRVLAAIALDKKARRGKVAWVMPRRIGHAEIGHAVPGALVRRVVTRSLA* |
Ga0070706_1008504841 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | FGLPDRPPHADPRRVLAAIALDKKARRGKVAWVMPRRIGHAEVGHAVPGALVRRVVTRALA* |
Ga0070706_1015467452 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | MSHDKKARRGKVAWVMPRRLGHAEPGHAVPAAIVRRVVRKALA* |
Ga0070707_1007152193 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | ALDKKARRGKVAWVMPRRIGHAEVGHAVPGALVRRVVTRALA* |
Ga0070707_1021955412 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | TDKKARRGKVAWVLPRRIGFAEVGHEVPPGLVRRVVRKALA* |
Ga0070698_1002263321 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | DKKARRGKVAWVMPRRIGHAEVGHAVPGALVRRVVTRALA* |
Ga0070679_1012682241 | 3300005530 | Corn Rhizosphere | LLSDLGLSDRPPSVDASRVLAAIPHDKKSRRGKVAWVMPRRLGHAEPGHAVPASVVRRVVRKSLA* |
Ga0070697_1008103921 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | PRDKKARRGKVAWVMPRRMGHAEPGHTVPSPLVRRVVTRALA* |
Ga0066701_108219841 | 3300005552 | Soil | PNRVLAAMALDKKARRGKVAWVMPRRIGHAEVGHAIPGALVRRVVIRSLG* |
Ga0066701_108888492 | 3300005552 | Soil | KARRGKVAWVMPRRMGHAEIGHAVPGALVRRVVTRSLA* |
Ga0066695_101469521 | 3300005553 | Soil | GKVAWVMPRRIGHAEIGHSVPGAIIRRVVTRSLA* |
Ga0066661_100145541 | 3300005554 | Soil | DRPPHADPKRVLAAMAVDKKARRGKVAWVMPRRIGHAEIGHTVPGAVVRRVLTRSLT* |
Ga0066661_103970333 | 3300005554 | Soil | RGKVAWVMPRRIGHAEVGHAIPGALVRRVVIRSLG* |
Ga0066692_1000449311 | 3300005555 | Soil | GKVAWVLPRRIGHSEIGHAVPGAIVRRVITRSLA* |
Ga0066692_108228782 | 3300005555 | Soil | HADPKRVLAAMALDKKARRGKVAWVMPRRIGHAEIGHTVPAPVVRRVVTRSLA* |
Ga0066707_100130581 | 3300005556 | Soil | ADPKRVLAAMAVDKKARRGKVAWVMPRRIGHAEIGHTVPGAVVRRVLTRSLT* |
Ga0066699_102591023 | 3300005561 | Soil | ADPKRVLAAIAYDKKARRGKVAWVMPRRIGHAEIGHAVPAALVRRVVTRSLA* |
Ga0066691_100036611 | 3300005586 | Soil | RGKVAWVMPRRIGHAEIGHTVPGAVVRRVLTRSLT* |
Ga0066903_1078642722 | 3300005764 | Tropical Forest Soil | AITLDKKARRGKVAWVMPRRIGHAEIGHAVPGATVRRVVTKALA* |
Ga0075026_1005661243 | 3300006057 | Watersheds | RVLSAIEHDKKARRGRVAWVMPRRLGHAEPGHVVPAGVVRRFVRKALA* |
Ga0079222_121310511 | 3300006755 | Agricultural Soil | PPHAAPDRVMQAMTLDKKARRGKVAWVMPRRIGHAEIGHTVPGALVRRVVIRSLS* |
Ga0066658_107702351 | 3300006794 | Soil | AAIALDKKARRGKVAWVMPRRIGHAEIGHSVPGAIIRRVVTRSLA* |
Ga0079220_108838501 | 3300006806 | Agricultural Soil | ADPKRVLAAIALDKKARRGKVAWVMPRRIGHAEIGHAVPGALVRRVVTKALA* |
Ga0075426_108614811 | 3300006903 | Populus Rhizosphere | TDKKARRGRVAWVLPRRIGFAEIGHEVPPGLVRRVVRKALA* |
Ga0075426_114399652 | 3300006903 | Populus Rhizosphere | ARRGKVAWVMPRRIGHAEPGHAVPGAIVRRVVTRSLR* |
Ga0099793_106251322 | 3300007258 | Vadose Zone Soil | MALDKKARRGKVAWVMPRRIGHAEIGHAVPAPLVRRIVTRSLA* |
Ga0099794_100251548 | 3300007265 | Vadose Zone Soil | RVLAAIEHDKKARRGRVAWVMPRRLGHAEPGHVVPAGVVRRFVRKALA* |
Ga0066710_1007396434 | 3300009012 | Grasslands Soil | RGKVAWVMPRRIDHAEIGHMVPGATIRRVVTRSLA |
Ga0066710_1010382452 | 3300009012 | Grasslands Soil | VLTAFGLPDRPPQADPRRVLAAIALDKKARRGKVAWVMPRRMGHAEIGHAVPGALVRRVVTRSLA |
Ga0066710_1023489163 | 3300009012 | Grasslands Soil | LPDRAPHADPKRLLVAIALDKKARRGKVAWVMPRRVGHAEIGHAVPGALVRRVLVRSLA |
Ga0099829_102560663 | 3300009038 | Vadose Zone Soil | VLAAIEHDKKARRGRVAWVMPRRLGHAEPGHVVPAGVVRRFVRKALA* |
Ga0099830_111677791 | 3300009088 | Vadose Zone Soil | MMAAIPADKKARRGRVAWVLPRRIGHAVIGQNVPARLVRRVVRRSLA* |
Ga0105240_124356192 | 3300009093 | Corn Rhizosphere | DKKSRRGKVAWVMPRRLGHAEPGHAVPASVVRRVVRKSLA* |
Ga0066709_1015287861 | 3300009137 | Grasslands Soil | DKKARRGRVAWVLPRRIGYAEAGHVVPRGVVRRVLRKAIA* |
Ga0066709_1034512572 | 3300009137 | Grasslands Soil | RANPNKVLAAMALDKKARRGKVAWVMPRRIGHAEIGHSVPGAIIRRVITRSLA* |
Ga0105858_10427671 | 3300009661 | Permafrost Soil | RDKKARRGRVAWVMPRRLGHAEIGHEIPSPLVRRVVTRALG* |
Ga0134064_103237161 | 3300010325 | Grasslands Soil | LDKKARRGRVAWVMPRRIGHAEPGHAVPGALVRRVVTRSLA* |
Ga0134065_104468722 | 3300010326 | Grasslands Soil | DKKARRGKVAWVMPRRIGHAEIGHTVPGALVRRVITRSLA* |
Ga0134065_104495442 | 3300010326 | Grasslands Soil | RRGKVAWVMPRRIGHAEIGHTVPGALVRRVLVRSLA* |
Ga0134063_104302171 | 3300010335 | Grasslands Soil | DPKRVLAAMAADKKARRGKVAWVMPRRIGHAEIGHTVPGALVRRVITRSLA* |
Ga0134071_107981302 | 3300010336 | Grasslands Soil | ALDKKARRGKVAWVMPRRIGHAEIGHAVPGALVRRVVTRSLA* |
Ga0134127_104190151 | 3300010399 | Terrestrial Soil | KSRRGKVAWVMPRRLGHAEPGHAVPASVVRRVVRKSLA* |
Ga0134122_120265472 | 3300010400 | Terrestrial Soil | RVIAAIAFDKKARRGKVAWVMPRRIGHAEIGHTVPGALVRRVVTRSLA* |
Ga0137364_100923561 | 3300012198 | Vadose Zone Soil | KRVLAAIALDKKARRGKVAWVMPRRIGHAEIGHMVPGATIRRVVTRSLA* |
Ga0137383_110913101 | 3300012199 | Vadose Zone Soil | PTDKKARRGRVAWVLPRRIGHAVIGQDVPARLVRRVVRRAIA* |
Ga0137365_104788371 | 3300012201 | Vadose Zone Soil | AAIAVDKKARRGKVAWVLPRRIGHAEIGHAVPSALVRRVIARSLA* |
Ga0137377_100936418 | 3300012211 | Vadose Zone Soil | RADPKRVLAAIALDKKARRGKVAWVMPRRIGHAEIGHTVPGATIRRVVTRSLA* |
Ga0137387_102342821 | 3300012349 | Vadose Zone Soil | RDKKARRGRVAWVMPRRLGHAETGHAVPPAVVRRVVRRALA* |
Ga0137387_104951603 | 3300012349 | Vadose Zone Soil | IALDKKARRGKVAWVMPRRIGHAEIGHSVPGATIRRVVTRSLA* |
Ga0137387_112192682 | 3300012349 | Vadose Zone Soil | QLGSPFPLLAAIAVDKKARRGKVAWVLPRRIGHAEIGHAVPSALVRRVIARSLA* |
Ga0137368_104974943 | 3300012358 | Vadose Zone Soil | TSLGLCHRAPRADPERVLAAISLDKKARRGKVAWVMPRRIGHAEIGHAVPGPLVRRVVTRSLA* |
Ga0137385_103085134 | 3300012359 | Vadose Zone Soil | LGLPDTAPRADPKRVLAAIALDKKARRGKVAWVMPRRIGHAEIGHSVPGAIIRRVVTRSLA* |
Ga0137385_109440672 | 3300012359 | Vadose Zone Soil | LGLPDTAPRADPKRVLAAIALDKKARRGKVAWVMPRRIGHAEIGHSVPGATIRRVITRSLA* |
Ga0137361_112462463 | 3300012362 | Vadose Zone Soil | ADPKRVLAAMALDKKARRGKVAWVMPRRIGHAEIGHTVPAPLVRRVVTRSLA* |
Ga0134061_12139082 | 3300012399 | Grasslands Soil | GKVAWVMPRRIGHAEIGHAVPGALVRRVVTRSLA* |
Ga0137359_113041982 | 3300012923 | Vadose Zone Soil | LAAMSHDKKARRGKVAWVMPRRLGHAEPGHAVPAAVVRRVVRKALA* |
Ga0137416_101045796 | 3300012927 | Vadose Zone Soil | MSHDKKARRGKVAWVMPRRLGHAEPGHAVPAAVVRRVVRKALA* |
Ga0134110_101867461 | 3300012975 | Grasslands Soil | RRGHVAWVLPRRIGHAVIGQDVPVRLVRRVVRGAIV* |
Ga0134087_105479022 | 3300012977 | Grasslands Soil | VLAAIALDKKARRGRVAWVMPRRIGHAEPGHAVPGALVRRVVTRSLA* |
Ga0134075_100756791 | 3300014154 | Grasslands Soil | IALDKKARRGKVAWVMPRRIGHAEIGHAVPGALVRRVVTRSLA* |
Ga0134078_104768921 | 3300014157 | Grasslands Soil | VLAAIALDKKARRGKVAWVMPRRIGHAEIGHSVPGATIRRIVTRSLA* |
Ga0134069_11389993 | 3300017654 | Grasslands Soil | ADAKKVLGAIALDKKARRGRVAWVMPRRIGHAEPGHAVPGALVRRVVTRSLA |
Ga0066655_105651363 | 3300018431 | Grasslands Soil | DKKARRGKVAWVMPRRLGHAEPGHAVPAAIVRRVLRKALA |
Ga0210399_111240523 | 3300020581 | Soil | IEHDKKARRGQVAWVMPRRLGHAEPGHVVPAGVVRRFVRKALA |
Ga0210402_119094762 | 3300021478 | Soil | RGKVAWVMPRLLGRAEPGHAVPSPLVRRIVTRALA |
Ga0248483_1706881 | 3300022691 | Soil | RRGKVAWVMPRRLGHAEVGHAVPGAIVRRVVTRSLA |
Ga0208355_10475413 | 3300025581 | Arctic Peat Soil | RGKVAWVLPRRLGHAETGHAVPGAIVSRVLRKALA |
Ga0207646_101211177 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | KRVLAAMAVDKKARRGKVAWVMPRRIGHAEIGHTVPAPLVRRVVTRSLA |
Ga0207646_108074371 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | ADPKRILAAIALDKKARRGKVAWVMPRRIGHAEPGHAVPGAIVRRVVTRSLQ |
Ga0209236_10020791 | 3300026298 | Grasslands Soil | RGKVAWVMPRRIGHAEIGHSVPGAIIRRVVTRSLA |
Ga0209265_12121561 | 3300026308 | Soil | VLAAMAADKKARRGKVAWVMPRRIGHAEIGHTVPGALVRRVITRSLA |
Ga0209239_11461791 | 3300026310 | Grasslands Soil | ADPKRVLAAIALDKKARRGKVAWVMPRRIGHAEIGHSVPGAIIRRVVTRSLA |
Ga0209686_10260161 | 3300026315 | Soil | PDKPPHADPKRVLAAMALDKKARRGKVAWVMPRRIGHAEIGHSVPAPVVRRVVARSLA |
Ga0209155_11354573 | 3300026316 | Soil | DPKRVLAAMAVDKKARRGKVAWVMPRRIGHAEIGHTVPGAVVRRVLTRSLT |
Ga0209375_10263308 | 3300026329 | Soil | TADAKKVLGAIALDKKARRGRVAWVMPRRIGHAEPGHAVPGALVRRVVTRSLA |
Ga0209377_12140431 | 3300026334 | Soil | DKKARRGKVAWVLPRRIGHSEIGHAVPGAIVRRVITRSLA |
Ga0257168_10904091 | 3300026514 | Soil | KKARRGKVAWVMPRRLGHAEPGHAVPAAVVRRVVRKALA |
Ga0209690_11733723 | 3300026524 | Soil | ARRGKVAWVMPRRMGHAEIGHAVPGALVRRVVTRSLA |
Ga0209690_12558701 | 3300026524 | Soil | RVLAAMALDKKARRGKVAWVMPRRIGHAEVGHAIPGALVRRVVIRSLG |
Ga0209807_13365632 | 3300026530 | Soil | VLAAISLDKKARRGKVAWVLPRRIGHAEIGRSVPGPLVRRVITRSLA |
Ga0209160_11055044 | 3300026532 | Soil | RVLAAMALDKKARRGKVAWVMPRRIGHAEIGHSVPAPVVRRVVARSLA |
Ga0209474_100478581 | 3300026550 | Soil | DRPPHVEPNRVLAAMALDKKARRGKVAWVMPRRIGHAEVGHAIPGALVRRVVIRSLG |
Ga0209577_100227441 | 3300026552 | Soil | PPHVEPKRVLAAMALDKKARRGKVAWVMPRRIGHAEVGHAIPGALVRRVVIRSLG |
Ga0209577_105068691 | 3300026552 | Soil | VLAAITLDKKALRGKVAWVMPRRIGKAEVGHSVPPAVVRRVVTRALA |
Ga0209180_107264201 | 3300027846 | Vadose Zone Soil | AAIEHDKKARRGRVAWVMPRRLGHAEPGHVVPAAVVRKFVRKALA |
Ga0209590_100213098 | 3300027882 | Vadose Zone Soil | HDKKARRGKVAWVMPRRLGHAEPGHAVPSALVRRVVRKALA |
Ga0209590_102792731 | 3300027882 | Vadose Zone Soil | ARRGRVAWVMPRRLGHAEPGHVVPAGVVRRFVRKALA |
Ga0137415_101537681 | 3300028536 | Vadose Zone Soil | MSHDKKARRGKVAWVMPRRLGHAEPGHAVPAAVVRRVVRKALA |
Ga0307475_100649258 | 3300031754 | Hardwood Forest Soil | DRVVRAITLDKKARRGKVAWVMPRRIGHAEIGHAVPGALVRRVVTRSLS |
⦗Top⦘ |