NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F096228

Metagenome Family F096228

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F096228
Family Type Metagenome
Number of Sequences 105
Average Sequence Length 47 residues
Representative Sequence MNYDDWLVKQEHDFRGWNDPDYTCDHCEKPIHKKGYCSNNCFEADMM
Number of Associated Samples 78
Number of Associated Scaffolds 105

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Unclassified
% of genes with valid RBS motifs 15.24 %
% of genes near scaffold ends (potentially truncated) 23.81 %
% of genes from short scaffolds (< 2000 bps) 50.48 %
Associated GOLD sequencing projects 65
AlphaFold2 3D model prediction Yes
3D model pTM-score0.43

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Unclassified (64.762 % of family members)
NCBI Taxonomy ID N/A
Taxonomy N/A

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine
(47.619 % of family members)
Environment Ontology (ENVO) Unclassified
(80.000 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(90.476 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 28.00%    β-sheet: 5.33%    Coil/Unstructured: 66.67%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.43
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 105 Family Scaffolds
PF08299Bac_DnaA_C 13.33
PF04466Terminase_3 8.57
PF02195ParBc 7.62
PF04438zf-HIT 4.76
PF06378DUF1071 4.76
PF00118Cpn60_TCP1 1.90
PF08800VirE_N 1.90
PF01227GTP_cyclohydroI 1.90
PF04488Gly_transf_sug 1.90
PF13884Peptidase_S74 1.90
PF027395_3_exonuc_N 1.90
PF01569PAP2 0.95
PF12705PDDEXK_1 0.95
PF14550Peptidase_S78_2 0.95
PF03819MazG 0.95
PF03796DnaB_C 0.95
PF05766NinG 0.95
PF00303Thymidylat_synt 0.95
PF12518DUF3721 0.95
PF05869Dam 0.95

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 105 Family Scaffolds
COG0593Chromosomal replication initiation ATPase DnaAReplication, recombination and repair [L] 13.33
COG1783Phage terminase large subunitMobilome: prophages, transposons [X] 8.57
COG02585'-3' exonuclease Xni/ExoIX (flap endonuclease)Replication, recombination and repair [L] 1.90
COG0459Chaperonin GroEL (HSP60 family)Posttranslational modification, protein turnover, chaperones [O] 1.90
COG3774Mannosyltransferase OCH1 or related enzymeCell wall/membrane/envelope biogenesis [M] 1.90
COG0207Thymidylate synthaseNucleotide transport and metabolism [F] 0.95
COG0305Replicative DNA helicaseReplication, recombination and repair [L] 0.95
COG1066DNA repair protein RadA/Sms, contains AAA+ ATPase domainReplication, recombination and repair [L] 0.95

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
UnclassifiedrootN/A64.76 %
All OrganismsrootAll Organisms35.24 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000101|DelMOSum2010_c10083487All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.1402Open in IMG/M
3300000116|DelMOSpr2010_c10000489Not Available25345Open in IMG/M
3300000117|DelMOWin2010_c10006784Not Available6823Open in IMG/M
3300000168|LPjun09P1210mDRAFT_c1021800All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon510Open in IMG/M
3300001450|JGI24006J15134_10002347Not Available10461Open in IMG/M
3300001450|JGI24006J15134_10004115Not Available7731Open in IMG/M
3300001450|JGI24006J15134_10010152Not Available4658Open in IMG/M
3300001450|JGI24006J15134_10076665Not Available1264Open in IMG/M
3300001450|JGI24006J15134_10172905Not Available685Open in IMG/M
3300001450|JGI24006J15134_10197565Not Available616Open in IMG/M
3300001460|JGI24003J15210_10001678Not Available9729Open in IMG/M
3300001460|JGI24003J15210_10005865Not Available5202Open in IMG/M
3300001472|JGI24004J15324_10016895Not Available2525Open in IMG/M
3300001472|JGI24004J15324_10018227Not Available2411Open in IMG/M
3300001472|JGI24004J15324_10025403All Organisms → Viruses → Predicted Viral1972Open in IMG/M
3300001589|JGI24005J15628_10010952All Organisms → Viruses → Predicted Viral4163Open in IMG/M
3300001589|JGI24005J15628_10023519Not Available2638Open in IMG/M
3300001589|JGI24005J15628_10031816Not Available2184Open in IMG/M
3300001589|JGI24005J15628_10101970Not Available962Open in IMG/M
3300002488|JGI25128J35275_1114542All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon539Open in IMG/M
3300004097|Ga0055584_101938959Not Available605Open in IMG/M
3300004448|Ga0065861_1039501Not Available851Open in IMG/M
3300004461|Ga0066223_1052563Not Available1053Open in IMG/M
3300004461|Ga0066223_1216843Not Available749Open in IMG/M
3300005920|Ga0070725_10261110Not Available758Open in IMG/M
3300006029|Ga0075466_1003316All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.5874Open in IMG/M
3300006735|Ga0098038_1005926All Organisms → Viruses → Predicted Viral4956Open in IMG/M
3300006735|Ga0098038_1030540All Organisms → Viruses → Predicted Viral2011Open in IMG/M
3300006737|Ga0098037_1000097Not Available60976Open in IMG/M
3300006737|Ga0098037_1000805Not Available15162Open in IMG/M
3300006737|Ga0098037_1295985All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon511Open in IMG/M
3300006749|Ga0098042_1022376All Organisms → Viruses → Predicted Viral1848Open in IMG/M
3300006749|Ga0098042_1081559All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.837Open in IMG/M
3300006752|Ga0098048_1056740All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon1221Open in IMG/M
3300006752|Ga0098048_1200756Not Available588Open in IMG/M
3300006793|Ga0098055_1106059All Organisms → Viruses → Predicted Viral1096Open in IMG/M
3300006802|Ga0070749_10002132Not Available13323Open in IMG/M
3300006803|Ga0075467_10002440Not Available14630Open in IMG/M
3300006920|Ga0070748_1005326Not Available5767Open in IMG/M
3300009488|Ga0114925_10757776All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon696Open in IMG/M
3300009512|Ga0115003_10158347Not Available1373Open in IMG/M
3300009593|Ga0115011_10051291All Organisms → Viruses → Predicted Viral2821Open in IMG/M
3300010150|Ga0098056_1038976Not Available1658Open in IMG/M
3300011258|Ga0151677_1081922All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon905Open in IMG/M
3300011261|Ga0151661_1232286All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon674Open in IMG/M
3300012920|Ga0160423_10081331All Organisms → Viruses → Predicted Viral2306Open in IMG/M
3300012954|Ga0163111_12159192All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon563Open in IMG/M
3300013098|Ga0164320_10000680Not Available11580Open in IMG/M
3300013101|Ga0164313_10001022Not Available24059Open in IMG/M
3300013103|Ga0164318_10915383All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon726Open in IMG/M
3300017727|Ga0181401_1005506All Organisms → Viruses → Predicted Viral4328Open in IMG/M
3300017728|Ga0181419_1000212Not Available19902Open in IMG/M
3300017755|Ga0181411_1148717Not Available674Open in IMG/M
3300017760|Ga0181408_1140870All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon622Open in IMG/M
3300017762|Ga0181422_1111856Not Available849Open in IMG/M
3300017772|Ga0181430_1025270All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon1929Open in IMG/M
3300017782|Ga0181380_1204757Not Available661Open in IMG/M
3300017952|Ga0181583_10496052Not Available747Open in IMG/M
3300018421|Ga0181592_10688940Not Available683Open in IMG/M
3300020166|Ga0206128_1067814All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp.1654Open in IMG/M
3300020185|Ga0206131_10015435Not Available6669Open in IMG/M
3300020185|Ga0206131_10153107Not Available1205Open in IMG/M
3300020396|Ga0211687_10045776Not Available1989Open in IMG/M
3300020403|Ga0211532_10038672All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon2356Open in IMG/M
3300021085|Ga0206677_10318467Not Available616Open in IMG/M
3300021335|Ga0213867_1001855Not Available9431Open in IMG/M
3300021512|Ga0190303_1013216All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon2703Open in IMG/M
3300021957|Ga0222717_10010799Not Available6337Open in IMG/M
3300021960|Ga0222715_10081315Not Available2136Open in IMG/M
3300022061|Ga0212023_1000510Not Available3298Open in IMG/M
3300022072|Ga0196889_1012579Not Available1835Open in IMG/M
3300024262|Ga0210003_1189558Not Available851Open in IMG/M
3300025048|Ga0207905_1003279Not Available3219Open in IMG/M
3300025071|Ga0207896_1000019Not Available50268Open in IMG/M
3300025071|Ga0207896_1002712All Organisms → Viruses → Predicted Viral3351Open in IMG/M
3300025079|Ga0207890_1057694Not Available644Open in IMG/M
3300025086|Ga0208157_1000534Not Available20398Open in IMG/M
3300025086|Ga0208157_1021465All Organisms → Viruses → Predicted Viral1958Open in IMG/M
3300025099|Ga0208669_1059033Not Available860Open in IMG/M
3300025101|Ga0208159_1000029Not Available48175Open in IMG/M
3300025108|Ga0208793_1069676All Organisms → Viruses → Predicted Viral1037Open in IMG/M
3300025120|Ga0209535_1001827Not Available14139Open in IMG/M
3300025120|Ga0209535_1009798Not Available5467Open in IMG/M
3300025120|Ga0209535_1042384All Organisms → Viruses → Predicted Viral2020Open in IMG/M
3300025120|Ga0209535_1106826Not Available987Open in IMG/M
3300025132|Ga0209232_1004561All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon6291Open in IMG/M
3300025137|Ga0209336_10001814Not Available10272Open in IMG/M
3300025137|Ga0209336_10021080Not Available2317Open in IMG/M
3300025138|Ga0209634_1044948Not Available2221Open in IMG/M
3300025138|Ga0209634_1167907Not Available875Open in IMG/M
3300025168|Ga0209337_1104274Not Available1313Open in IMG/M
3300025168|Ga0209337_1152416Not Available999Open in IMG/M
3300025508|Ga0208148_1113323Not Available568Open in IMG/M
3300025543|Ga0208303_1001558Not Available8906Open in IMG/M
3300025645|Ga0208643_1021833All Organisms → Viruses → Predicted Viral2224Open in IMG/M
3300025652|Ga0208134_1001705Not Available12397Open in IMG/M
3300025652|Ga0208134_1005691Not Available5852Open in IMG/M
3300025674|Ga0208162_1056071All Organisms → Viruses → Predicted Viral1300Open in IMG/M
3300025759|Ga0208899_1202112Not Available631Open in IMG/M
3300025806|Ga0208545_1118789All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon667Open in IMG/M
3300027906|Ga0209404_10020785All Organisms → Viruses → Predicted Viral3608Open in IMG/M
(restricted) 3300027996|Ga0233413_10002406Not Available7874Open in IMG/M
3300029306|Ga0135212_1000923All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon1475Open in IMG/M
3300033742|Ga0314858_031258Not Available1230Open in IMG/M
3300034375|Ga0348336_022824All Organisms → Viruses → Predicted Viral3169Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine47.62%
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous14.29%
SeawaterEnvironmental → Aquatic → Marine → Strait → Unclassified → Seawater6.67%
MarineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Marine2.86%
SeawaterEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Seawater2.86%
MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine2.86%
Marine SedimentEnvironmental → Aquatic → Marine → Hydrothermal Vents → Sediment → Marine Sediment2.86%
Surface SeawaterEnvironmental → Aquatic → Marine → Oceanic → Photic Zone → Surface Seawater1.90%
Deep SubsurfaceEnvironmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface1.90%
Salt MarshEnvironmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh1.90%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine1.90%
Estuarine WaterEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water1.90%
MarineEnvironmental → Aquatic → Marine → Oceanic → Photic Zone → Marine0.95%
SeawaterEnvironmental → Aquatic → Marine → Inlet → Unclassified → Seawater0.95%
Marine SedimentEnvironmental → Aquatic → Marine → Coastal → Sediment → Marine Sediment0.95%
MarineEnvironmental → Aquatic → Marine → Coastal → Sediment → Marine0.95%
MarineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Marine0.95%
SeawaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Seawater0.95%
Sea-Ice BrineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Sea-Ice Brine0.95%
SeawaterEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater0.95%
Pelagic MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine0.95%
Hydrothermal Vent SedimentEnvironmental → Aquatic → Marine → Hydrothermal Vents → Sediment → Hydrothermal Vent Sediment0.95%
Marine HarborEnvironmental → Aquatic → Marine → Harbor → Unclassified → Marine Harbor0.95%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000101Marine microbial communities from Delaware Coast, sample from Delaware MO Early Summer May 2010EnvironmentalOpen in IMG/M
3300000116Marine microbial communities from Delaware Coast, sample from Delaware MO Spring March 2010EnvironmentalOpen in IMG/M
3300000117Marine microbial communities from Delaware Coast, sample from Delaware MO Winter December 2010EnvironmentalOpen in IMG/M
3300000168Marine microbial communities from expanding oxygen minimum zones in Line P, North Pacific Ocean - June 2009 P12 10mEnvironmentalOpen in IMG/M
3300001450Marine viral communities from the Pacific Ocean - LP-53EnvironmentalOpen in IMG/M
3300001460Marine viral communities from the Pacific Ocean - LP-28EnvironmentalOpen in IMG/M
3300001472Marine viral communities from the Pacific Ocean - LP-32EnvironmentalOpen in IMG/M
3300001589Marine viral communities from the Pacific Ocean - LP-40EnvironmentalOpen in IMG/M
3300002488Marine viral communities from the Pacific Ocean - ETNP_2_60EnvironmentalOpen in IMG/M
3300004097Pelagic marine sediment microbial communities from the LTER site Helgoland, North Sea, for post-phytoplankton bloom and carbon turnover studies - OSD3 (Helgoland) metaGEnvironmentalOpen in IMG/M
3300004448Marine viral communities from Newfoundland, Canada BC-1EnvironmentalOpen in IMG/M
3300004461Marine viral communities from Newfoundland, Canada BC-2EnvironmentalOpen in IMG/M
3300005920Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdDd00.2EnvironmentalOpen in IMG/M
3300006029Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_<0.8_DNAEnvironmentalOpen in IMG/M
3300006735Marine viral communities from the Subarctic Pacific Ocean - 5B_ETSP_OMZ_AT15132_CsCl metaGEnvironmentalOpen in IMG/M
3300006737Marine viral communities from the Subarctic Pacific Ocean - 5_ETSP_OMZ_AT15132 metaGEnvironmentalOpen in IMG/M
3300006749Marine viral communities from the Subarctic Pacific Ocean - 9_ETSP_OMZ_AT15188 metaGEnvironmentalOpen in IMG/M
3300006752Marine viral communities from the Subarctic Pacific Ocean - 13_ETSP_OMZ_AT15268 metaGEnvironmentalOpen in IMG/M
3300006793Marine viral communities from the Subarctic Pacific Ocean - 17_ETSP_OMZ_AT15314 metaGEnvironmentalOpen in IMG/M
3300006802Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18EnvironmentalOpen in IMG/M
3300006803Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_>0.8_DNAEnvironmentalOpen in IMG/M
3300006920Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12EnvironmentalOpen in IMG/M
3300009488Deep subsurface microbial communities from Indian Ocean to uncover new lineages of life (NeLLi) - Sumatra_00607 metaGEnvironmentalOpen in IMG/M
3300009512Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_88EnvironmentalOpen in IMG/M
3300009593Marine eukaryotic phytoplankton communities from Atlantic Ocean - Tropical Atlantic ANT8 MetagenomeEnvironmentalOpen in IMG/M
3300010150Marine viral communities from the Subarctic Pacific Ocean - 17B_ETSP_OMZ_AT15314_CsCl metaGEnvironmentalOpen in IMG/M
3300011258Seawater microbial communities from Japan Sea near Toyama Prefecture, Japan - 2015_1, permeateEnvironmentalOpen in IMG/M
3300011261Marine sediment microbial communities from Japan Sea near Toyama Prefecture, Japan - 2015_4, 0.02EnvironmentalOpen in IMG/M
3300012920Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St8 metaGEnvironmentalOpen in IMG/M
3300012954Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St18 metaGEnvironmentalOpen in IMG/M
3300013098Subseafloor sediment microbial communities from Guaymas Basin, Gulf of California, Mexico - Guay11, Core 4567-28, 0-3 cmEnvironmentalOpen in IMG/M
3300013101Subseafloor sediment microbial communities from Guaymas Basin, Gulf of California, Mexico - Guay4, Core 4569-4, 0-3 cmEnvironmentalOpen in IMG/M
3300013103Subseafloor sediment microbial communities from Guaymas Basin, Gulf of California, Mexico - Guay9, Core 4571-4, 0-3 cmEnvironmentalOpen in IMG/M
3300017727Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 24 SPOT_SRF_2011-07-20EnvironmentalOpen in IMG/M
3300017728Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 42 SPOT_SRF_2013-04-24EnvironmentalOpen in IMG/M
3300017755Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 34 SPOT_SRF_2012-07-09EnvironmentalOpen in IMG/M
3300017760Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 31 SPOT_SRF_2012-02-16EnvironmentalOpen in IMG/M
3300017762Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 45 SPOT_SRF_2013-07-18EnvironmentalOpen in IMG/M
3300017772Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 53 SPOT_SRF_2014-04-10EnvironmentalOpen in IMG/M
3300017782Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 3 SPOT_SRF_2009-08-19EnvironmentalOpen in IMG/M
3300017952Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071405CT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018421Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071412BT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300020166Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160426_1EnvironmentalOpen in IMG/M
3300020185Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160517_1EnvironmentalOpen in IMG/M
3300020396Marine microbial communities from Tara Oceans - TARA_B100000767 (ERX555915-ERR599122)EnvironmentalOpen in IMG/M
3300020403Marine microbial communities from Tara Oceans - TARA_B100000085 (ERX556015-ERR599145)EnvironmentalOpen in IMG/M
3300021085Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 30m 12015EnvironmentalOpen in IMG/M
3300021335Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO540EnvironmentalOpen in IMG/M
3300021512Hydrothermal vent sediment bacterial communities from Southern Trench, Guaymas Basin, Mexico - 4870-07-0-1_MGEnvironmentalOpen in IMG/M
3300021957Estuarine water microbial communities from San Francisco Bay, California, United States - C33_18DEnvironmentalOpen in IMG/M
3300021960Estuarine water microbial communities from San Francisco Bay, California, United States - C33_9DEnvironmentalOpen in IMG/M
3300022061Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 (v2)EnvironmentalOpen in IMG/M
3300022072Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 (v3)EnvironmentalOpen in IMG/M
3300024262Deep subsurface microbial communities from Baltic Sea to uncover new lineages of life (NeLLi) - Landsort_02402 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025048Marine viral communities from the Subarctic Pacific Ocean - LP-49 (SPAdes)EnvironmentalOpen in IMG/M
3300025071Marine viral communities from the Pacific Ocean - LP-36 (SPAdes)EnvironmentalOpen in IMG/M
3300025079Marine viral communities from the Pacific Ocean - LP-48 (SPAdes)EnvironmentalOpen in IMG/M
3300025086Marine viral communities from the Subarctic Pacific Ocean - 5_ETSP_OMZ_AT15132 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025099Marine viral communities from the Subarctic Pacific Ocean - 21_ETSP_OMZ_AT15319 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025101Marine viral communities from the Subarctic Pacific Ocean - 9_ETSP_OMZ_AT15188 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025108Marine viral communities from the Subarctic Pacific Ocean - 17_ETSP_OMZ_AT15314 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025120Marine viral communities from the Pacific Ocean - LP-28 (SPAdes)EnvironmentalOpen in IMG/M
3300025132Marine viral communities from the Pacific Ocean - ETNP_2_60 (SPAdes)EnvironmentalOpen in IMG/M
3300025137Marine viral communities from the Pacific Ocean - LP-32 (SPAdes)EnvironmentalOpen in IMG/M
3300025138Marine viral communities from the Pacific Ocean - LP-40 (SPAdes)EnvironmentalOpen in IMG/M
3300025168Marine viral communities from the Pacific Ocean - LP-53 (SPAdes)EnvironmentalOpen in IMG/M
3300025508Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_<0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025543Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300025645Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 (SPAdes)EnvironmentalOpen in IMG/M
3300025652Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 (SPAdes)EnvironmentalOpen in IMG/M
3300025674Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300025759Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 (SPAdes)EnvironmentalOpen in IMG/M
3300025806Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_<0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300027906Marine eukaryotic phytoplankton communities from Atlantic Ocean - Tropical Atlantic ANT8 Metagenome (SPAdes)EnvironmentalOpen in IMG/M
3300027996 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_6_MGEnvironmentalOpen in IMG/M
3300029306Marine harbor viral communities from the Indian Ocean - SCH3EnvironmentalOpen in IMG/M
3300033742Sea-ice brine viral communities from Beaufort Sea near Barrow, Alaska, United States - 2018 seawaterEnvironmentalOpen in IMG/M
3300034375Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_30 (v4)EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
DelMOSum2010_1008348723300000101MarineMNYDDWLVKSEHDFRGWNDPEFSCDHCEKPIDKKGYCSNNCFEADMM*
DelMOSpr2010_10000489143300000116MarineMNYDDWLVKQEHDFRGWNDPDYTCDHCEKPIHKKGYCSNNCFEADMM*
DelMOWin2010_1000678473300000117MarineMDYDNWLVWQEHDHRGWNEPEHTCMHCEKPIDRKGYCSDACFEADLM*
LPjun09P1210mDRAFT_102180023300000168MarineDSWLVQMEHDYRGWNDEDYTCDYCEQPIDKKGYCSNNCFEADLM*
JGI24006J15134_1000234753300001450MarineMDYDSWLVHMEHEYRGWNTPDYVCQHCEKPIERDGYCSDNCFEADMM*
JGI24006J15134_1000411573300001450MarineMDYDSWLVQMEHDYRGWNDEDYTCDYCEQPIDKKGYCSNNCFEADLM*
JGI24006J15134_1001015243300001450MarineMGYDDWLVKQEHDYRGWNDKEYTCDHCEKPIDKEGYCSNNCFEADMM*
JGI24006J15134_1007666553300001450MarineMNYDDWLVEQEHNYRGWNDTEFNCDHCEKPINKKGYCSSNCFEADMM*
JGI24006J15134_1017290533300001450MarineMNYDDWIVEQEHNFRGWNDSEHTCDHCEKPINKKGYCSDNCFEADMM*
JGI24006J15134_1019756533300001450MarineMNYDDWLVEMEHNYRGWNDPDYTCDHCEKPIHQKGYCSNGCFEADMM*
JGI24003J15210_1000167853300001460MarineMDYDSWLVHMEHEYRGWNTPDYVCQHCEKPIEIDGYCSDNCFEADMM*
JGI24003J15210_1000586523300001460MarineMGYDDWLVKQEHDYRGWNDKEYTCDHCEKPIDKKGYCSNNCFEADMM*
JGI24004J15324_1001689513300001472MarineMSYDDWLVEQEHNFRGWNDPEHACDHCEKPIDKKGYCSDNCFEADMM*
JGI24004J15324_1001822723300001472MarineMGYDDWLVKQEHDYRGWNNKEYTCDHCEKPIDKEGYCSNNCFEADMM*
JGI24004J15324_1002540343300001472MarineMNYDDWLVEQEHNFRGWNDPDYTCDHCEKPIHKKGYCSNNCFEADMM*
JGI24005J15628_1001095293300001589MarineMNYDDWLVKMEHDYRGWNDPDYTCDHCEKPIHKKGYCSDGCFEADMM*
JGI24005J15628_1002351943300001589MarineMNYDDWIVEQEHNFRGWNDLEHTCDHCEKPINKKGYCSDNCFEADMM*
JGI24005J15628_1003181613300001589MarineLVKQEHDYRGWNDKEYTCDHCEKPIDKKGYCSNNCFEADMM*
JGI24005J15628_1010197013300001589MarineMGYDDWLVKQEHDYRGWNXKEYTCDHCEKPIDKEGYCSNNCFEADMM*
JGI25128J35275_111454213300002488MarineNYRLFMDYDNWLVHMEHDYRGWNDKDYTCDHCEAPISSKGYCSDDCFEADLM*
Ga0055584_10193895913300004097Pelagic MarineMNYDDWLVHQEHEFRGWNTPDYECMHCEKPIDKKGYCSDNCFEADML*
Ga0065861_103950113300004448MarineMNYDDWLVEQEHNFRGWNDPDYNCDHCEKPIHKKGYCSDNCFEADMM*
Ga0066223_105256323300004461MarineMNYDDWIVEQEHNFRGWNDPEHTCDHCEKPINKKGYCSDNCFEADMM*
Ga0066223_121684343300004461MarineMIYDDWLVEQEHNFRGWNDPDYNCDHCEKPIHKEGYCSDNCFEADMM*
Ga0070725_1026111013300005920Marine SedimentKRIKRQIRTLKKSRIMNYDDWLVHQEHEFRGWNTPDYECMHCEKPIDKKGYCSDNCFEADML*
Ga0075466_1003316123300006029AqueousMNYDDWLVKQEHDFRGWNDSDYTCDHCEKPIHKKGYCSN
Ga0098038_100592663300006735MarineMNYDDWLVQMEHDYRGWNDADYTCDHCEKPIHKKGYCSSNCFEADMM*
Ga0098038_103054023300006735MarineMNYDDWLVHMEHEHRGWNTPDYECQHCEKPIDKEGYCSDSCFEADMM*
Ga0098037_1000097233300006737MarineMDYDNWLIWQEHEHRGWNQPDHTCMHCEKPIDRKGYCSDACFEADLM*
Ga0098037_100080533300006737MarineMNYDDWLVQMEHDYRGWNDPDYTCDHCEKPIHKKGYCSSNCFEADMM*
Ga0098037_129598533300006737MarineMDYDSWLVWQEHDYRGWNNEHKCQCCEKPIDKKGYCSDD
Ga0098042_102237633300006749MarineMDYDNWLVWQEHDQRGWNEPDHTCMHCEKPIERKGYCSDACFEADLM*
Ga0098042_108155913300006749MarineTTIKINVMNYDDWLVEQEHNYRGWNEPEDNCRYCDKPIHKGPYCSGACSEADML*
Ga0098048_105674023300006752MarineMDYDNWLVHMEHDYRGWNDKDYTCDHCEAPISSKGYCSDDCFEADLM*
Ga0098048_120075623300006752MarineMNYDDWLVHMEHEHRGWNTPDYECQHCEKPINKQGYCSDSCFEADMM*
Ga0098055_110605963300006793MarineMDYDNWLVHMEHDYRGWNDKDYTCDHCEAPISSKGYCSDDCF
Ga0070749_10002132173300006802AqueousMDYDNWLVNQEHDYRGWNNEHKCQCCEKPIDKKGYCSYDCFRADIL*
Ga0075467_10002440103300006803AqueousMNYDDWLVKQEHDFRGWNDSDYTCDHCEKPIHKKGYCSNNCFEADMM*
Ga0070748_100532643300006920AqueousMNYDDWLVHMEHEYRGWNEPDYVCQHCETPIHKQGYCSDNCFEADML*
Ga0114925_1075777633300009488Deep SubsurfaceMDYDSWLVWQEHEYRGWNDPDYTCMHCEKPIDKEGYCSDDCFRADLM*
Ga0115003_1015834733300009512MarineMNYDDWLVEQEHNFRGWNDPEYNCDHCEKPINKKGYCSNNCFEADMM*
Ga0115011_1005129143300009593MarineMDYDSWLVWQEHDYRGWNNEHKCQCCEKPIDKKGYCSDDCFQADLM*
Ga0098056_103897623300010150MarineMNYDNWLVHMEHEYRGWNDPDFTCSHCEKPIQKEGWCSDACFDADMM*
Ga0151677_108192223300011258MarineMEHDYRGWNDEEYTCDYCEQPIDKKGYCSNNCFEADLM*
Ga0151661_123228633300011261MarineMAYDSWLVWQAHDYRGWNNEHKCQCCEKLIDKEGYCSDDFFQADLM*
Ga0160423_1008133163300012920Surface SeawaterMDYDNWLVNQEHDYRGWNNEHKCKCCEKPIDKKGYCSYDCFRADIL*
Ga0163111_1215919213300012954Surface SeawaterDYDSWLVWQEHDYRGWNNQHKRQCCEKPIDKKGYCSDDCFQADLM*
Ga0164320_10000680173300013098Marine SedimentMDYDNWLVNQEHDYRGWNNEHKCQCCEKPIDKRGYCSYDCFRADIL*
Ga0164313_10001022223300013101Marine SedimentMDYDNWLVNQEHNYRGWNNEHKCQCCEKPIDKRGYCSYDCFRADIL*
Ga0164318_1091538313300013103Marine SedimentRLFMDYDNWLVHMEHDYRGWNDKDYTCDHCEAPISSKGYCSDDCFEADLM*
Ga0181401_1005506143300017727SeawaterMNYDDWLVQQEHDFRGWNDPEHECMHCGTPVEKKGSYCSMNCFDADML
Ga0181419_1000212113300017728SeawaterMDYDSWLVQMEHDYRGWNDEEYTCDYCEQPIDKKGYCSNNCFEADLM
Ga0181411_114871743300017755SeawaterMDYDSWLVQMEHDYRGWNDEEYTCDYCEQPIDKKGYCSN
Ga0181408_114087013300017760SeawaterYNNLFYISTMDYDNWLIWQEHDHRGWNEPDHTCMYCEKPIDRKGYCSDVCFEADLM
Ga0181422_111185623300017762SeawaterMNYDDWLVKMEHDYRGWNDPDYTCDHCEKPIHKKGYCSDGCFEADMM
Ga0181430_102527063300017772SeawaterDYDSWLVQMEHDYRGWNDEEYTCDYCEQPIDKKGYCSNNCFEADLM
Ga0181380_120475713300017782SeawaterKFRIMNYDDWLVHQEHEFRGWNTPDYECQHCEKPIDKKGYCSDNCFEADML
Ga0181583_1049605213300017952Salt MarshMNYDNWLVHMEHEYRGWNKKPYKCKECEKPIAHEGYCSWQCNEASNL
Ga0181592_1068894033300018421Salt MarshMNYDNWLVHMEHEYRGWNKKPYKCKECEKPIAHEGYCS
Ga0206128_106781423300020166SeawaterMNYDDWLVHMEHEYRGWNEPPYECQHCEKPINKNGYCSDDCFEADML
Ga0206131_1001543563300020185SeawaterMNYDDWLVHMEHEYRGWNEPDYECQHCEKPINKNGYCSDDCFEADML
Ga0206131_1015310713300020185SeawaterMNYDDWLVHMEHEHRGWNTPDYECQHCEKPINKNGYCSDDCFNADML
Ga0211687_1004577643300020396MarineMNYDDWLVQMEHDYRGWNTPDYECQHCEKPIDKEGYCSDNCFEADMM
Ga0211532_1003867293300020403MarineMDYDSWLVWQEHEYRGWNDPDYTCMHCEKPIAKEGYCSDDCFRADLM
Ga0206677_1031846723300021085SeawaterMNYDDWLVHQEHEFRGWNTPDYECMHCEKPIDKKGYCSDNCFEADML
Ga0213867_100185543300021335SeawaterMDYDNWLVWQEHDHRGWNEPEHTCMHCEKPIDRKGYCSDACFEADLM
Ga0190303_101321683300021512Hydrothermal Vent SedimentMDYDNWLVNQEHDYRGWNNEHKCQCCEKPIDKRGYCSYDCFRADIL
Ga0222717_1001079953300021957Estuarine WaterMNYDDWLVHQEHEFRGWNTPEYECMHCEKPIDKKGYCSDNCFEADML
Ga0222715_1008131563300021960Estuarine WaterMNYDDWLVHQEHEFRGWNTPEYECMHCEKPIDKKGYCSDN
Ga0212023_100051063300022061AqueousMNYDDWLVKQEHDFRGWNDPDYTCDHCEKPIHKKGYCSNNCFEADMM
Ga0196889_101257953300022072AqueousGMNYDDWLVKQEHDFRGWNDPDYTCDHCEKPIHKKGYCSNNCFEADMM
Ga0210003_118955833300024262Deep SubsurfaceMNYDDWLVEQEHNFRGWNDPDYNCDHCEKPIHKKGYCSDNCFEADMM
Ga0207905_100327923300025048MarineMGYDDWLVKQEHDYRGWNDKEYTCDHCEKPIDKKGYCSNNCFEADMM
Ga0207896_1000019153300025071MarineMDYDSWLVQMEHDYRGWNDEDYTCDYCEQPIDKKGYCSNNCFEADLM
Ga0207896_100271233300025071MarineMDYDSWLVHMEHEYRGWNTPDYVCQHCEKPIERDGYCSDNCFEADMM
Ga0207890_105769423300025079MarineMNYDDWIVEQEHNFRGWNDLEHTCDHCEKPINKKGYCSDNCFEADMM
Ga0208157_1000534193300025086MarineMNYDDWLVQMEHDYRGWNDPDYTCDHCEKPIHKKGYCSSNCFEADMM
Ga0208157_102146533300025086MarineMNYDDWLVHMEHEHRGWNTPDYECQHCEKPIDKEGYCSDSCFEADMM
Ga0208669_105903313300025099MarineMNYDDWLVQMEHDYRGWNDADYTCDHCEKPIHKKGYCSSNCFEADMM
Ga0208159_100002993300025101MarineMDYDNWLVWQEHDQRGWNEPDHTCMHCEKPIDRKGYCSDACFEADLM
Ga0208793_106967613300025108MarineMDYDNWLVHMEHDYRGWNDKDYTCDHCEAPISSKGYCSDDCFEA
Ga0209535_100182763300025120MarineMNYDDWLVEMEHNYRGWNDPDYTCDHCEKPIHQKGYCSNGCFEADMM
Ga0209535_100979843300025120MarineMDYDSWLVHMEHEYRGWNTPDYVCQHCEKPIEIDGYCSDNCFEADMM
Ga0209535_104238433300025120MarineMNYDDWLVKSEHDFRGWNDPEFSCDHCEKPIDKKGYCSNNCFEADMM
Ga0209535_110682613300025120MarineMNYDDWLVEQEHNYRGWNDPEFNCDHCEKPINKKGYCSSNCFEADMM
Ga0209232_100456193300025132MarineMDYDNWLVHMEHDYRGWNDKDYTCDHCEAPISSKGYCSDDCFEADLM
Ga0209336_1000181483300025137MarineMSYDDWLVEQEHNFRGWNDPEHACDHCEKPIDKKGYCSDNCFEADMM
Ga0209336_1002108023300025137MarineMGYDDWLVKQEHDYRGWNDKEYTCDHCEKPIDKEGYCSNNCFEADMM
Ga0209634_104494813300025138MarineKKFRVMMGYDDWLVKQEHDYRGWNDKEYTCDHCEKPIDKKGYCSNNCFEADMM
Ga0209634_116790713300025138MarineMGYDDWLVKQEHDYRGWNDKEYTCDHCEKPIDKKG
Ga0209337_110427423300025168MarineMNYDDWLVEQEHNFRGWNDPDYTCDHCEKPIHKKGYCSNNCFEADMM
Ga0209337_115241613300025168MarineMNYDDWLVEQEHNYRGWNDTEFNCDHCEKPINKKGYCSSNCFEADMM
Ga0208148_111332313300025508AqueousMNYDDWLVKQEHDFRGWNDSDYTCDHCEKPIHKKGYCS
Ga0208303_100155883300025543AqueousMNYDDWLVKQEHDFRGWNDSDYTCDHCEKPIHKKGYCSNNCFEADMM
Ga0208643_102183313300025645AqueousMNYDDWLVQMEHDYRGWNDPDYTCDHCEKPIHKKGYCSDGCFE
Ga0208134_100170543300025652AqueousMNYDDWLVHMEHEYRGWNEPDYVCQHCETPIHKQGYCSDNCFEADML
Ga0208134_1005691103300025652AqueousMNYDDWLVQMEHDYRGWNDPDYTCDHCEKPIHKKGYCSDGCFEADMM
Ga0208162_105607123300025674AqueousMDYDNWLVNQEHDYRGWNNEHKCQCCEKPIDKKGYCSYDCFRADIL
Ga0208899_120211213300025759AqueousDDWLVKQEHDFRGWNDSDYTCDHCEKPIHKKGYCSNNCFEADMM
Ga0208545_111878933300025806AqueousKYCINLFYISTMDYDNWLVWQEHDHRGWNEPEHTCMHCEKPIDRKGYCSDACFEADLM
Ga0209404_1002078563300027906MarineMDYDSWLVWQEHDYRGWNNEHKCQCCEKPIDKKGYCSDDCFQADLM
(restricted) Ga0233413_1000240653300027996SeawaterMNYDDWLVHQEHEFRGWNTPDYECQHCEKPIDKKGYCSDNCFEADML
Ga0135212_100092363300029306Marine HarborMDYDNWLINQEHDYRGWNNEHKCKCCEKPIDKKGYCSYDCFKADIL
Ga0314858_031258_599_7423300033742Sea-Ice BrineMNYDDWLVEQEHNFRGWNDPEYNCDHCEKPINKKGYCSNNCFEADMM
Ga0348336_022824_2283_24263300034375AqueousMNYDDWLVKQEHDFIGWNDSDYTCDHCEKPIHKKGYCSNNCFEADMM

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.