| Basic Information | |
|---|---|
| Family ID | F096113 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 105 |
| Average Sequence Length | 42 residues |
| Representative Sequence | RRYPVASLPAVDLVVRAKRAAYAAPFAQLRAELAASVTRIT |
| Number of Associated Samples | 90 |
| Number of Associated Scaffolds | 105 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 0.00 % |
| % of genes from short scaffolds (< 2000 bps) | 0.00 % |
| Associated GOLD sequencing projects | 85 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.38 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (99.048 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (29.524 % of family members) |
| Environment Ontology (ENVO) | Unclassified (45.714 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (51.429 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 46.38% β-sheet: 0.00% Coil/Unstructured: 53.62% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.38 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 105 Family Scaffolds |
|---|---|---|
| PF01809 | YidD | 58.10 |
| PF14849 | YidC_periplas | 25.71 |
| PF12631 | MnmE_helical | 4.76 |
| PF00468 | Ribosomal_L34 | 3.81 |
| PF10396 | TrmE_N | 3.81 |
| PF00825 | Ribonuclease_P | 0.95 |
| PF13442 | Cytochrome_CBB3 | 0.95 |
| PF01661 | Macro | 0.95 |
| COG ID | Name | Functional Category | % Frequency in 105 Family Scaffolds |
|---|---|---|---|
| COG0759 | Membrane-anchored protein YidD, putatitve component of membrane protein insertase Oxa1/YidC/SpoIIIJ | Cell wall/membrane/envelope biogenesis [M] | 58.10 |
| COG0230 | Ribosomal protein L34 | Translation, ribosomal structure and biogenesis [J] | 3.81 |
| COG0594 | RNase P protein component | Translation, ribosomal structure and biogenesis [J] | 0.95 |
| COG2110 | O-acetyl-ADP-ribose deacetylase (regulator of RNase III), contains Macro domain | Translation, ribosomal structure and biogenesis [J] | 0.95 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 99.05 % |
| All Organisms | root | All Organisms | 0.95 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300026296|Ga0209235_1000195 | All Organisms → cellular organisms → Bacteria | 28934 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 29.52% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 19.05% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 14.29% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 12.38% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 5.71% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.90% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.90% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.90% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.90% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 1.90% |
| Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 0.95% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.95% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 0.95% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 0.95% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.95% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.95% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.95% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.95% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.95% |
| Soil | Environmental → Terrestrial → Soil → Loam → Unclassified → Soil | 0.95% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300002911 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm | Environmental | Open in IMG/M |
| 3300002916 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_20cm | Environmental | Open in IMG/M |
| 3300003999 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleA_D2 | Environmental | Open in IMG/M |
| 3300005181 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 | Environmental | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005451 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 | Environmental | Open in IMG/M |
| 3300005540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 | Environmental | Open in IMG/M |
| 3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
| 3300005568 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 | Environmental | Open in IMG/M |
| 3300005574 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143 | Environmental | Open in IMG/M |
| 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006794 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 | Environmental | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300006847 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
| 3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009822 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_30_40 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010140 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Wat_40_5_24_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010301 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09082015 | Environmental | Open in IMG/M |
| 3300010304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09182015 | Environmental | Open in IMG/M |
| 3300010320 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_11112015 | Environmental | Open in IMG/M |
| 3300010323 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_0_1 metaG | Environmental | Open in IMG/M |
| 3300010333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010336 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09082015 | Environmental | Open in IMG/M |
| 3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012226 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT400_2 | Environmental | Open in IMG/M |
| 3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012354 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012373 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_0_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012399 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_24_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012931 | Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaG | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015358 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300017657 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09212015 | Environmental | Open in IMG/M |
| 3300017930 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_5 | Environmental | Open in IMG/M |
| 3300018000 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5_coex | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300021086 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300024330 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300025159 | Soil microbial communities from Rifle, Colorado, USA - sediment 16ft 3 | Environmental | Open in IMG/M |
| 3300025325 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 13_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300026295 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026296 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026297 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026307 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123 (SPAdes) | Environmental | Open in IMG/M |
| 3300026310 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026313 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026314 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143 (SPAdes) | Environmental | Open in IMG/M |
| 3300026315 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 (SPAdes) | Environmental | Open in IMG/M |
| 3300026316 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 (SPAdes) | Environmental | Open in IMG/M |
| 3300026325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 (SPAdes) | Environmental | Open in IMG/M |
| 3300026331 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 (SPAdes) | Environmental | Open in IMG/M |
| 3300026335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 (SPAdes) | Environmental | Open in IMG/M |
| 3300026342 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 (SPAdes) | Environmental | Open in IMG/M |
| 3300026524 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 (SPAdes) | Environmental | Open in IMG/M |
| 3300026527 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 (SPAdes) | Environmental | Open in IMG/M |
| 3300026536 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 (SPAdes) | Environmental | Open in IMG/M |
| 3300026548 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 (SPAdes) | Environmental | Open in IMG/M |
| 3300027169 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_10_20 (SPAdes) | Environmental | Open in IMG/M |
| 3300027748 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 (SPAdes) | Environmental | Open in IMG/M |
| 3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300030829 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_357 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300032157 | Garden soil microbial communities collected in Santa Monica, California, United States - V. faba soil | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI25390J43892_101572981 | 3300002911 | Grasslands Soil | RRRVKEILRRDALPTLPAVDLVVRAKRAAYAVSFAVLRADVIDLVSRVT* |
| JGI25389J43894_11002981 | 3300002916 | Grasslands Soil | EILRRDALAKLPAIDLVVRAKRAAYAATFAALRAELADLVSRVT* |
| Ga0055469_100474541 | 3300003999 | Natural And Restored Wetlands | RLREILRRGILAAYPPVDVVVRARRGAYAAPFALLRDELADAGPRLQ* |
| Ga0066678_109181101 | 3300005181 | Soil | RRRVKEILRRDALPALPAVDLVVRAKRAAYAVSFAVLRADVMDLVSRVT* |
| Ga0070714_1011186413 | 3300005435 | Agricultural Soil | RRLREILRRNPLASLPVVDLVVRAKRAAYAAPFAALRADLTESVTRIT* |
| Ga0066681_105239493 | 3300005451 | Soil | ILRRYPVASLPAVDLVLRAKRAAYAARFVELRAELMAGVTRIA* |
| Ga0066697_105987701 | 3300005540 | Soil | PVALLPAVDLVVRAKRAAYAASFVELRAELTAGVTRIA* |
| Ga0066661_106662183 | 3300005554 | Soil | ALASLPAVDLVVRAKRTAYTASFADLRAELTGIVRRVT* |
| Ga0066703_103717513 | 3300005568 | Soil | REVLRRGPLHTLPPVDLVVRAKRTAYAASFAVLRAELTEATARIA* |
| Ga0066694_100289804 | 3300005574 | Soil | RVKEILRRDVLPTLPAVDLVVRAKRAAYAVSFAVLRADVIDLVSRVT* |
| Ga0070715_104525371 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | NPLATLPVVDLVVRAKRAAYAAPFPALRADLTESVTRIT* |
| Ga0070716_1000211581 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | YPVASLPVVDLVVRAKRAAYAAPFARLRSELTASVTRIT* |
| Ga0066658_101407111 | 3300006794 | Soil | RLREILRRYPVASLPAVDLVVRAKRAAYAARFVELRAELMAGVTRIA* |
| Ga0066665_100070751 | 3300006796 | Soil | ILRRHALPVLSPVDIVVRAKPSAYAAPFAVLRAELTAVVGRIT* |
| Ga0079221_102949941 | 3300006804 | Agricultural Soil | LATLPVVDLVVRAKRAAYDAPFAALRAELTESVTRVT* |
| Ga0075431_1017305731 | 3300006847 | Populus Rhizosphere | LREILRRDVLPFLQLPPIDVVIRAKRATYAAPFAALRAELTDVVSTLT* |
| Ga0075425_1005949871 | 3300006854 | Populus Rhizosphere | KEILRRYPVASLPIVDLVVRAKRTAYAAPFAQLRSELTASVTRIT* |
| Ga0075425_1007813373 | 3300006854 | Populus Rhizosphere | LRRYPVASLPIVDLVVRAKRTAYAAPFAQLRTELSASVTRIT* |
| Ga0075426_113876143 | 3300006903 | Populus Rhizosphere | EILRRDSLSLLPAIDLVVRARRAAYAAPFAVLRAELTDALARVS* |
| Ga0075436_1004266971 | 3300006914 | Populus Rhizosphere | PLATLPVVDLVVRAKRAAYDAPFAALRAELTESVTRVT* |
| Ga0079219_101750473 | 3300006954 | Agricultural Soil | LRRDVLRLPALTAVDLVVRAKRAAYAASFAALRAELTDLVSRIT* |
| Ga0099829_102291681 | 3300009038 | Vadose Zone Soil | RLKEILRRYPVASLPVVDLVVRAKRTAYAAPFAQLRTELTTSVTRIT* |
| Ga0099828_108824761 | 3300009089 | Vadose Zone Soil | RLKEILRRYPVASLPVVDLVVRAKRTAYAAPFALLRSELTTSVTRIT* |
| Ga0099827_100209235 | 3300009090 | Vadose Zone Soil | VREILRRHALASLPAVDLVVRVKRVAYAAPFAVLRAELGGVVRRIT* |
| Ga0099827_100241531 | 3300009090 | Vadose Zone Soil | ASLPVVDLVVRAKRTAYAAPFAQLRTELTASVTRIA* |
| Ga0099827_101885671 | 3300009090 | Vadose Zone Soil | RYPVASLPVVDLVVRAKRTAYAAPFAQLRTELTTSVTRIT* |
| Ga0099827_105750171 | 3300009090 | Vadose Zone Soil | KLPSVDLVVRAKRSAYAASFADLRAELTAYVSRVT* |
| Ga0066709_1009262023 | 3300009137 | Grasslands Soil | VREILRRHTLASLPPVDLVVRAKRVAYAASFAVLRAELTDVVRRIT* |
| Ga0066709_1032849431 | 3300009137 | Grasslands Soil | PLLPSVDLVVRPKRSAYAAPFAVLRAELTGGVSHIT* |
| Ga0075423_102000711 | 3300009162 | Populus Rhizosphere | PVASLPIVDLVVRAKRTAYAAPFAQLRTELSASVTRIT* |
| Ga0105066_10213591 | 3300009822 | Groundwater Sand | LRETLRRAALAALPSVDLVVRAKRVAYAVPFAVLRADAEVLVSHVS* |
| Ga0126384_114486183 | 3300010046 | Tropical Forest Soil | LRRDLLPGLPAIDLVVRTRRAAYAARFAVLRSELADGASRLS* |
| Ga0127456_11028023 | 3300010140 | Grasslands Soil | RHRVREILRRYALASLPAIDLVVRVKRLAYAASFAVLRAELSDVVRRVI* |
| Ga0134070_100521113 | 3300010301 | Grasslands Soil | HALASLPPVDLVGRAKRVAYAAPFAVLRAELTDVVRRIT* |
| Ga0134088_106889201 | 3300010304 | Grasslands Soil | RRYPVASLPAVDLVVRAKRAAYAAPFAQLRAELAASVTRIT* |
| Ga0134109_102021601 | 3300010320 | Grasslands Soil | VLSPVDIVVRAKPTAYAASFAVLRAELTAVVSRIT* |
| Ga0134086_102811321 | 3300010323 | Grasslands Soil | RLREILRRYPVASLPAVDLVVRAKRAAYAAPFAQLRAELAASVTRLT* |
| Ga0134064_102007551 | 3300010325 | Grasslands Soil | EILRRYALASLPAIDLVVRVKRLAYAASFAVLRAELSDVVRRVI* |
| Ga0134064_102292931 | 3300010325 | Grasslands Soil | LRRDALPSLPAVDLVVRPKRTAYAVSFATLRAELADLVSRVS* |
| Ga0134080_100724891 | 3300010333 | Grasslands Soil | LREILRRHGLPVLSPVDIVVRAKPTAYTVPFAVLRAELTDVVSRIT* |
| Ga0134071_100843181 | 3300010336 | Grasslands Soil | LPAIDLVVRAKRIAYAASFTVLRAELSSVVRRVT* |
| Ga0134123_122680351 | 3300010403 | Terrestrial Soil | REVLRRHPLARLPHIDLVVRARRSAYDAPFAVLHAEISEQVQRVT* |
| Ga0137389_107430321 | 3300012096 | Vadose Zone Soil | RRYPVASLPVVDLVVRAKRTAYAAPFAQLRTELTASVTRIT* |
| Ga0137388_112261773 | 3300012189 | Vadose Zone Soil | REVLRREALALLPSVDLVVRPKRSAYAAPFAVLRAELTGGVSHIT* |
| Ga0137364_103103271 | 3300012198 | Vadose Zone Soil | EILRRDALPTLPAVDLVVRAKRAAYAVSFAVLRADVIDLVSRVT* |
| Ga0137365_100350941 | 3300012201 | Vadose Zone Soil | LREILRRHALPVLSPVDIVVRAKPTAYAASFAVLRAELTGVVSQIT* |
| Ga0137399_101831423 | 3300012203 | Vadose Zone Soil | SLPVVDLVVRAKRTAYAAPFAQLRTELTASVTRIT* |
| Ga0137379_107397173 | 3300012209 | Vadose Zone Soil | VASLPIVDLVVRAKRTAYAAPFAQLRTELTTSVTRIT* |
| Ga0137378_115472973 | 3300012210 | Vadose Zone Soil | VKEILRRDALPSLPAVDLVVRAKRVAYAAPFAVLRAELTDVVRRIT* |
| Ga0137377_103140083 | 3300012211 | Vadose Zone Soil | ASLPIVDLVVRAKHTAYAAPFAQLRTELTTSVTRIT* |
| Ga0137447_10712913 | 3300012226 | Soil | LPPIDLVVRAKRAAYAATFAVLRAELTDVVSGLT* |
| Ga0137386_100706604 | 3300012351 | Vadose Zone Soil | EILRRDALASLPAIDLVVRAKRIAYAASFAMLRAELSSVVRRVT* |
| Ga0137386_100712891 | 3300012351 | Vadose Zone Soil | KLPSVDLVVRAKRSAYAASFADLRAELTACVSRVT* |
| Ga0137366_101451473 | 3300012354 | Vadose Zone Soil | ASLPAVDLVVRAKRVAYAAPFAVLRAELTDVVRRIT* |
| Ga0137360_105077851 | 3300012361 | Vadose Zone Soil | LPVVDLVVRAKRTAYAAPFAQLRTELTTSVTRIT* |
| Ga0134042_12042381 | 3300012373 | Grasslands Soil | VLSPVDIVVRAKPTAYTVPFAVLRAELTDVVSRIT* |
| Ga0134061_11110861 | 3300012399 | Grasslands Soil | VLSAVDIVVRAKPTAYAASFAVLRAELTAVVSRIT* |
| Ga0137398_101894591 | 3300012683 | Vadose Zone Soil | RRYPVASLPVVDLVVRAKRAAYAAPFAQLRSELTASVTRIT* |
| Ga0137396_106979021 | 3300012918 | Vadose Zone Soil | PVASLPVVDLVVRAKRTAYAAPFAQLRTELTTSVTRIT* |
| Ga0137413_114164121 | 3300012924 | Vadose Zone Soil | RDALARLPAIDVVVRARRGAYTAAFAVLRAELTDALARVS* |
| Ga0137407_118790981 | 3300012930 | Vadose Zone Soil | LKEILRRYPVASLPVVDLVVRAKRTAYAAAFAQLHTELTTSVTRIT* |
| Ga0153915_109915863 | 3300012931 | Freshwater Wetlands | IGSLPTVDLVVRAKRAAYAAPFAVLRAELTESVTRIT* |
| Ga0137410_102198383 | 3300012944 | Vadose Zone Soil | REALATLPPVDLVVRTKRIAYAATPSTLRAELTDGVRRVT* |
| Ga0137418_105896971 | 3300015241 | Vadose Zone Soil | RLKEILRRYPVASLPVVDLVVRAKRAAYAAPFARLRDELTASVTRIT* |
| Ga0137418_110896512 | 3300015241 | Vadose Zone Soil | VREILRRHALASLPAVDLVVRAKRVAYAAPFAVLRAEL |
| Ga0134089_101735021 | 3300015358 | Grasslands Soil | RLKEILRRYPVASLPIVDLVVRAKRTAYAAPFAQLRSELTTSVTRIT* |
| Ga0134074_11574533 | 3300017657 | Grasslands Soil | LRRELLARVPAIDLVVRAKRSAYAASFAGLRAELTGGVSHVT |
| Ga0187825_103839841 | 3300017930 | Freshwater Sediment | VLRREALAVLPPVDLVVRSKRAAYAASFAVLRAELTGGVRQVT |
| Ga0184604_100998543 | 3300018000 | Groundwater Sediment | RRRLREVLRREALATLPSVDLVVRTKRVAYGATPSRLRAELTDSVRHVT |
| Ga0066667_100160492 | 3300018433 | Grasslands Soil | VLSPVDIVVRAKPTAYAASFAVLRAELTAVVSRIT |
| Ga0066667_109657271 | 3300018433 | Grasslands Soil | RRRVREILRRDALASLAAVDLVVRAKRVAYAAPFAVLRAELSGVVRRIT |
| Ga0066662_121195321 | 3300018468 | Grasslands Soil | RLLREWLRRGLLARVPAIDLVVRAKRSASAASFAGLRAELTGGVSHVT |
| Ga0179596_101526043 | 3300021086 | Vadose Zone Soil | LRRYPVASLPVVDLVVRAKRTAYAAPFAQLRTELTASVTRIA |
| Ga0137417_10834501 | 3300024330 | Vadose Zone Soil | DVLPVLPTVDLVVRAKRSAYAAPFAALRAELTDAAARIA |
| Ga0209619_101631511 | 3300025159 | Soil | RRRLRETLRRAALAALPAVDLVVRAKRVAYGVPFAVLRGEAEVVVSRVT |
| Ga0209341_100881312 | 3300025325 | Soil | VLSGLPPIDLVVRAKRATYAAPFAVLRAELTDAVSKLT |
| Ga0209234_12048462 | 3300026295 | Grasslands Soil | VLRRGPLHTLPPVDLVVRAKRTAYAASFAVLRAELTEATARIA |
| Ga0209235_100019523 | 3300026296 | Grasslands Soil | VREILRRHTLASLPPVDLVVRAKRVAYAASFAVLRAELTDVVRRIT |
| Ga0209235_10840041 | 3300026296 | Grasslands Soil | REILRRYPVASLPAVDLVVRANRAAYAAPFARLRAEVAASVTRIT |
| Ga0209237_10084737 | 3300026297 | Grasslands Soil | VREILRRHALASLPAVDLVVRVKRVAYAAPFAVLRAELGGVVRRIT |
| Ga0209237_10588051 | 3300026297 | Grasslands Soil | SLPAVDLVVRANRAAYAAPFARLRAEVAASVTRIT |
| Ga0209237_10711421 | 3300026297 | Grasslands Soil | RRELLVKLPSVDLVVRAKRSAYAASFADLRAELTACVSRVT |
| Ga0209469_11454871 | 3300026307 | Soil | LRRRVREILRRDALASLPAIDLVVRAKRIAYAASFAVLRAEL |
| Ga0209239_10121135 | 3300026310 | Grasslands Soil | REILRRYPVASLPAVDLVVRAKRGEYAAPFTQLRAELTASVTRIT |
| Ga0209761_11521341 | 3300026313 | Grasslands Soil | RVREILRRDLLHRLPAVDLVVRAKRSAYAAPFAALRAELTDATARIA |
| Ga0209268_10765803 | 3300026314 | Soil | LRRHPVAALPPIDLVVRAKRGAYAVPFTELRAELAASVTRII |
| Ga0209686_12048441 | 3300026315 | Soil | LPVLSPVDIVVRAKPTAYAASFAVLRAELTAVVSRIT |
| Ga0209155_11572101 | 3300026316 | Soil | GPLLTLPPVDLVVRAKRTAYAASFAVLRAELTEATARIA |
| Ga0209152_104931151 | 3300026325 | Soil | RRELLGKLPSVDLVVRAKRSAYAASFADLRAELTACVSRVT |
| Ga0209267_10416491 | 3300026331 | Soil | KLPSVDLVVRAKRSAYAASFADLRAELTACVSRVT |
| Ga0209804_12214673 | 3300026335 | Soil | RGPLHTLPPVDLVVRAKRTAYAASFAVLRAELTEATARIA |
| Ga0209057_11893043 | 3300026342 | Soil | VLRRGPLLTLPPVDLVVRAKRTAYAASFAVLRAELTEATARIA |
| Ga0209690_10254784 | 3300026524 | Soil | ILRRELFGKLPSVDLVVRAKRSAYAASFADLRAELTACVSRVT |
| Ga0209059_12925663 | 3300026527 | Soil | VKEILRRDALPALPAVDLVVRAKRAAYAVSFAVLRADVMDLVSRVT |
| Ga0209058_12547083 | 3300026536 | Soil | EILRRYPVASLPAVDLVVRAKRAAYAAPFARLRAEVAASVTRIT |
| Ga0209161_101407013 | 3300026548 | Soil | ASLPAVDLVVRAKRVAYAAPFAVLRAELSGVVRRIT |
| Ga0209161_102301531 | 3300026548 | Soil | REALPLLPSVDLVVRPKRSAYAAPFAVLRAELTGGVSHIT |
| Ga0209897_10210193 | 3300027169 | Groundwater Sand | IVRRSVIATLPPIDVVVRAKRAAYDAPFAVLRAELADAGSRLR |
| Ga0209689_10600611 | 3300027748 | Soil | FGKLPSVDLVVRAKRSAYAASFADLRAELTACVSRVT |
| Ga0209590_100029711 | 3300027882 | Vadose Zone Soil | KEILRRYPVASLPVVDLVVRAKRTAYAAPFAQLRTELTASVTRIT |
| Ga0209590_104720561 | 3300027882 | Vadose Zone Soil | KLPSVDLVVRAKRSAYAASFADLRAELTAYVSRVT |
| Ga0209488_100958004 | 3300027903 | Vadose Zone Soil | EILRRYPVASLPVVDLVVRAKRTAYAAPFAQLRSELTASVTRIT |
| Ga0209488_103488671 | 3300027903 | Vadose Zone Soil | EILRRYPVASLPVVDLVVRAKRTAYAAPFAQLRTELTASVTRIA |
| Ga0308203_10421591 | 3300030829 | Soil | LRRDVLPLLQLPSIDVVIRAKRATYAAPFAALRAELTDVVSTLT |
| Ga0315912_108509483 | 3300032157 | Soil | REILRRGVLATFPPFDLVVRAKRIAYQAPFATLRAELSAAATQAR |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |