NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F096111

Metagenome Family F096111

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F096111
Family Type Metagenome
Number of Sequences 105
Average Sequence Length 42 residues
Representative Sequence MKRTWMWCLIGLLSFGSVAWSQAQTTGGTEKAVAALEQQWLQS
Number of Associated Samples 90
Number of Associated Scaffolds 105

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 95.24 %
% of genes near scaffold ends (potentially truncated) 93.33 %
% of genes from short scaffolds (< 2000 bps) 88.57 %
Associated GOLD sequencing projects 84
AlphaFold2 3D model prediction Yes
3D model pTM-score0.32

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (61.905 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil
(22.857 % of family members)
Environment Ontology (ENVO) Unclassified
(27.619 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(45.714 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: Yes Secondary Structure distribution: α-helix: 57.75%    β-sheet: 0.00%    Coil/Unstructured: 42.25%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.32
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 105 Family Scaffolds
PF00589Phage_integrase 3.81
PF14534DUF4440 2.86
PF08843AbiEii 1.90
PF00903Glyoxalase 1.90
PF01593Amino_oxidase 1.90
PF01402RHH_1 1.90
PF08327AHSA1 1.90
PF10067DUF2306 1.90
PF00719Pyrophosphatase 0.95
PF13432TPR_16 0.95
PF03795YCII 0.95
PF13426PAS_9 0.95
PF00080Sod_Cu 0.95
PF05170AsmA 0.95
PF13180PDZ_2 0.95
PF05173DapB_C 0.95
PF03544TonB_C 0.95
PF01609DDE_Tnp_1 0.95
PF03237Terminase_6N 0.95
PF00266Aminotran_5 0.95
PF01740STAS 0.95
PF06271RDD 0.95
PF01939NucS 0.95
PF06884DUF1264 0.95
PF07719TPR_2 0.95
PF13936HTH_38 0.95
PF00069Pkinase 0.95
PF00881Nitroreductase 0.95
PF00291PALP 0.95
PF07689KaiB 0.95

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 105 Family Scaffolds
COG0515Serine/threonine protein kinaseSignal transduction mechanisms [T] 3.81
COG2253Predicted nucleotidyltransferase component of viral defense systemDefense mechanisms [V] 1.90
COG0221Inorganic pyrophosphataseEnergy production and conversion [C] 0.95
COG02894-hydroxy-tetrahydrodipicolinate reductaseAmino acid transport and metabolism [E] 0.95
COG0810Periplasmic protein TonB, links inner and outer membranesCell wall/membrane/envelope biogenesis [M] 0.95
COG1637Endonuclease NucS, RecB familyReplication, recombination and repair [L] 0.95
COG1714Uncharacterized membrane protein YckC, RDD familyFunction unknown [S] 0.95
COG2032Cu/Zn superoxide dismutaseInorganic ion transport and metabolism [P] 0.95
COG2350YciI superfamily enzyme, includes 5-CHQ dehydrochlorinase, contains active-site pHisSecondary metabolites biosynthesis, transport and catabolism [Q] 0.95
COG2982Uncharacterized conserved protein AsmA involved in outer membrane biogenesisCell wall/membrane/envelope biogenesis [M] 0.95
COG3039Transposase and inactivated derivatives, IS5 familyMobilome: prophages, transposons [X] 0.95
COG3293TransposaseMobilome: prophages, transposons [X] 0.95
COG3385IS4 transposase InsGMobilome: prophages, transposons [X] 0.95
COG5421TransposaseMobilome: prophages, transposons [X] 0.95
COG5433Predicted transposase YbfD/YdcC associated with H repeatsMobilome: prophages, transposons [X] 0.95
COG5659SRSO17 transposaseMobilome: prophages, transposons [X] 0.95

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms61.90 %
UnclassifiedrootN/A38.10 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2228664022|INPgaii200_c0639387Not Available611Open in IMG/M
3300000364|INPhiseqgaiiFebDRAFT_101629823All Organisms → cellular organisms → Bacteria918Open in IMG/M
3300001154|JGI12636J13339_1036621Not Available634Open in IMG/M
3300005175|Ga0066673_10186593All Organisms → cellular organisms → Bacteria → Acidobacteria1176Open in IMG/M
3300005175|Ga0066673_10878642All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium510Open in IMG/M
3300005179|Ga0066684_10945328Not Available560Open in IMG/M
3300005332|Ga0066388_100740613All Organisms → cellular organisms → Bacteria → Proteobacteria1584Open in IMG/M
3300005436|Ga0070713_100536857All Organisms → cellular organisms → Bacteria → Acidobacteria1106Open in IMG/M
3300005436|Ga0070713_100598752All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1047Open in IMG/M
3300005437|Ga0070710_10925383Not Available631Open in IMG/M
3300005467|Ga0070706_100670005Not Available963Open in IMG/M
3300005467|Ga0070706_100751397All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium903Open in IMG/M
3300005471|Ga0070698_101853388Not Available556Open in IMG/M
3300005526|Ga0073909_10467784All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium605Open in IMG/M
3300005537|Ga0070730_10009547All Organisms → cellular organisms → Bacteria → Proteobacteria8039Open in IMG/M
3300005549|Ga0070704_100193692Not Available1636Open in IMG/M
3300005554|Ga0066661_10542931All Organisms → cellular organisms → Bacteria → Acidobacteria697Open in IMG/M
3300005561|Ga0066699_10457858All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium913Open in IMG/M
3300005563|Ga0068855_101968198All Organisms → cellular organisms → Bacteria → Acidobacteria591Open in IMG/M
3300005598|Ga0066706_11060267All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium621Open in IMG/M
3300006028|Ga0070717_11197955All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium691Open in IMG/M
3300006032|Ga0066696_10708806All Organisms → cellular organisms → Bacteria → Acidobacteria646Open in IMG/M
3300006163|Ga0070715_10491778All Organisms → cellular organisms → Bacteria700Open in IMG/M
3300006163|Ga0070715_10510014All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium690Open in IMG/M
3300006173|Ga0070716_100437409All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium950Open in IMG/M
3300006173|Ga0070716_100725037Not Available762Open in IMG/M
3300006174|Ga0075014_100947930Not Available518Open in IMG/M
3300006175|Ga0070712_100937469Not Available747Open in IMG/M
3300006175|Ga0070712_101821729Not Available533Open in IMG/M
3300006794|Ga0066658_10270972All Organisms → cellular organisms → Bacteria909Open in IMG/M
3300006796|Ga0066665_10997839Not Available642Open in IMG/M
3300006854|Ga0075425_102462976All Organisms → cellular organisms → Bacteria → Acidobacteria577Open in IMG/M
3300006881|Ga0068865_100809809Not Available809Open in IMG/M
3300006893|Ga0073928_10044352All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia4075Open in IMG/M
3300007076|Ga0075435_100919060Not Available763Open in IMG/M
3300009012|Ga0066710_101466879All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium 13_1_20CM_4_60_61055Open in IMG/M
3300009038|Ga0099829_10089734All Organisms → cellular organisms → Bacteria → Acidobacteria2371Open in IMG/M
3300009038|Ga0099829_10733759All Organisms → cellular organisms → Bacteria821Open in IMG/M
3300009089|Ga0099828_10353808Not Available1323Open in IMG/M
3300009089|Ga0099828_10487943All Organisms → cellular organisms → Bacteria1111Open in IMG/M
3300009162|Ga0075423_10562584All Organisms → cellular organisms → Bacteria1201Open in IMG/M
3300010401|Ga0134121_11351251All Organisms → cellular organisms → Bacteria721Open in IMG/M
3300011270|Ga0137391_10983618Not Available687Open in IMG/M
3300012096|Ga0137389_10389795All Organisms → cellular organisms → Bacteria1189Open in IMG/M
3300012096|Ga0137389_11255496Not Available634Open in IMG/M
3300012189|Ga0137388_10339844Not Available1383Open in IMG/M
3300012189|Ga0137388_10946352Not Available796Open in IMG/M
3300012201|Ga0137365_10809559All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium684Open in IMG/M
3300012202|Ga0137363_11238474Not Available633Open in IMG/M
3300012205|Ga0137362_10101406All Organisms → cellular organisms → Bacteria → Acidobacteria2424Open in IMG/M
3300012207|Ga0137381_11683610Not Available525Open in IMG/M
3300012211|Ga0137377_11006915All Organisms → cellular organisms → Bacteria → Acidobacteria764Open in IMG/M
3300012349|Ga0137387_10012720All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae5004Open in IMG/M
3300012349|Ga0137387_10290117All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1182Open in IMG/M
3300012359|Ga0137385_10914369All Organisms → cellular organisms → Bacteria → Acidobacteria725Open in IMG/M
3300012362|Ga0137361_10523486Not Available1089Open in IMG/M
3300012582|Ga0137358_10402690All Organisms → cellular organisms → Bacteria925Open in IMG/M
3300012917|Ga0137395_11060813All Organisms → cellular organisms → Bacteria → Acidobacteria577Open in IMG/M
3300015054|Ga0137420_1025477All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae2382Open in IMG/M
3300017659|Ga0134083_10006620All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis3733Open in IMG/M
3300018016|Ga0187880_1326907Not Available655Open in IMG/M
3300018026|Ga0187857_10037946All Organisms → cellular organisms → Bacteria → Acidobacteria2538Open in IMG/M
3300018431|Ga0066655_10267927All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1099Open in IMG/M
3300020580|Ga0210403_10912371Not Available692Open in IMG/M
3300020583|Ga0210401_11423979Not Available550Open in IMG/M
3300021170|Ga0210400_10483611Not Available1022Open in IMG/M
3300021171|Ga0210405_10828013All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium707Open in IMG/M
3300021180|Ga0210396_11583127Not Available536Open in IMG/M
3300021344|Ga0193719_10239484Not Available769Open in IMG/M
3300021401|Ga0210393_11038255Not Available663Open in IMG/M
3300021432|Ga0210384_10234076All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1653Open in IMG/M
3300021475|Ga0210392_10386915All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → unclassified Anaerolineae → Anaerolineae bacterium1017Open in IMG/M
3300021559|Ga0210409_10277499All Organisms → cellular organisms → Bacteria1514Open in IMG/M
3300024330|Ga0137417_1321557All Organisms → cellular organisms → Bacteria → Acidobacteria1335Open in IMG/M
3300024331|Ga0247668_1005289All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae2768Open in IMG/M
3300025320|Ga0209171_10394127Not Available711Open in IMG/M
3300025906|Ga0207699_10120415All Organisms → cellular organisms → Bacteria1696Open in IMG/M
3300025910|Ga0207684_10447210All Organisms → cellular organisms → Bacteria1110Open in IMG/M
3300025916|Ga0207663_10166818All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1560Open in IMG/M
3300025916|Ga0207663_11123173Not Available632Open in IMG/M
3300025949|Ga0207667_11868833Not Available563Open in IMG/M
3300026318|Ga0209471_1063305All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1676Open in IMG/M
3300026333|Ga0209158_1007334All Organisms → cellular organisms → Bacteria5705Open in IMG/M
3300027061|Ga0209729_1031830Not Available656Open in IMG/M
3300027535|Ga0209734_1056367All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium744Open in IMG/M
3300027663|Ga0208990_1148218Not Available622Open in IMG/M
3300027671|Ga0209588_1234823All Organisms → cellular organisms → Bacteria564Open in IMG/M
3300027846|Ga0209180_10105454Not Available1609Open in IMG/M
3300027857|Ga0209166_10001747All Organisms → cellular organisms → Bacteria17487Open in IMG/M
3300027895|Ga0209624_10413263All Organisms → cellular organisms → Bacteria899Open in IMG/M
3300031057|Ga0170834_103631197All Organisms → cellular organisms → Bacteria → Proteobacteria585Open in IMG/M
3300031234|Ga0302325_12171657Not Available677Open in IMG/M
3300031474|Ga0170818_112703602Not Available1717Open in IMG/M
3300031715|Ga0307476_10279237All Organisms → cellular organisms → Bacteria1223Open in IMG/M
3300031715|Ga0307476_11005605All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium614Open in IMG/M
3300031718|Ga0307474_10477194All Organisms → cellular organisms → Bacteria976Open in IMG/M
3300031718|Ga0307474_10945039Not Available682Open in IMG/M
3300031718|Ga0307474_11282498All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium578Open in IMG/M
3300031753|Ga0307477_10011218All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae6138Open in IMG/M
3300031754|Ga0307475_10196558All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1611Open in IMG/M
3300031823|Ga0307478_10651147All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella → Granulicella aggregans882Open in IMG/M
3300031908|Ga0310900_11857813Not Available513Open in IMG/M
3300031945|Ga0310913_10768704All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium680Open in IMG/M
3300031962|Ga0307479_11819959Not Available560Open in IMG/M
3300032180|Ga0307471_103962542All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium523Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil22.86%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere17.14%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil10.48%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil10.48%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil9.52%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil4.76%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil2.86%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere2.86%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland1.90%
Iron-Sulfur Acid SpringEnvironmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring1.90%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil1.90%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil1.90%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil1.90%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere1.90%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds0.95%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.95%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil0.95%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil0.95%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil0.95%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil0.95%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa0.95%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere0.95%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2228664022Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300000364Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300001154Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M1EnvironmentalOpen in IMG/M
3300005175Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122EnvironmentalOpen in IMG/M
3300005179Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133EnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005436Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaGEnvironmentalOpen in IMG/M
3300005437Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaGEnvironmentalOpen in IMG/M
3300005467Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaGEnvironmentalOpen in IMG/M
3300005471Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaGEnvironmentalOpen in IMG/M
3300005526Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1EnvironmentalOpen in IMG/M
3300005537Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1EnvironmentalOpen in IMG/M
3300005549Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaGEnvironmentalOpen in IMG/M
3300005554Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110EnvironmentalOpen in IMG/M
3300005561Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148EnvironmentalOpen in IMG/M
3300005563Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2Host-AssociatedOpen in IMG/M
3300005598Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155EnvironmentalOpen in IMG/M
3300006028Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaGEnvironmentalOpen in IMG/M
3300006032Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145EnvironmentalOpen in IMG/M
3300006163Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaGEnvironmentalOpen in IMG/M
3300006173Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaGEnvironmentalOpen in IMG/M
3300006174Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014EnvironmentalOpen in IMG/M
3300006175Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaGEnvironmentalOpen in IMG/M
3300006794Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107EnvironmentalOpen in IMG/M
3300006796Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114EnvironmentalOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300006881Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2Host-AssociatedOpen in IMG/M
3300006893Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaGEnvironmentalOpen in IMG/M
3300007076Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4Host-AssociatedOpen in IMG/M
3300009012Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159EnvironmentalOpen in IMG/M
3300009038Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaGEnvironmentalOpen in IMG/M
3300009089Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaGEnvironmentalOpen in IMG/M
3300009162Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2Host-AssociatedOpen in IMG/M
3300010401Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1EnvironmentalOpen in IMG/M
3300011270Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaGEnvironmentalOpen in IMG/M
3300012096Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaGEnvironmentalOpen in IMG/M
3300012189Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaGEnvironmentalOpen in IMG/M
3300012201Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaGEnvironmentalOpen in IMG/M
3300012202Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaGEnvironmentalOpen in IMG/M
3300012205Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaGEnvironmentalOpen in IMG/M
3300012207Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaGEnvironmentalOpen in IMG/M
3300012211Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaGEnvironmentalOpen in IMG/M
3300012349Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaGEnvironmentalOpen in IMG/M
3300012359Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaGEnvironmentalOpen in IMG/M
3300012362Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaGEnvironmentalOpen in IMG/M
3300012582Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaGEnvironmentalOpen in IMG/M
3300012917Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaGEnvironmentalOpen in IMG/M
3300015054Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (PacBio error correction)EnvironmentalOpen in IMG/M
3300017659Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300018016Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_40EnvironmentalOpen in IMG/M
3300018026Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_100EnvironmentalOpen in IMG/M
3300018431Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104EnvironmentalOpen in IMG/M
3300020580Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-MEnvironmentalOpen in IMG/M
3300020583Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-MEnvironmentalOpen in IMG/M
3300021170Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-MEnvironmentalOpen in IMG/M
3300021171Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-MEnvironmentalOpen in IMG/M
3300021180Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-OEnvironmentalOpen in IMG/M
3300021344Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2a2EnvironmentalOpen in IMG/M
3300021401Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-OEnvironmentalOpen in IMG/M
3300021432Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-MEnvironmentalOpen in IMG/M
3300021475Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-OEnvironmentalOpen in IMG/M
3300021559Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-MEnvironmentalOpen in IMG/M
3300024330Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (PacBio error correction)EnvironmentalOpen in IMG/M
3300024331Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK09EnvironmentalOpen in IMG/M
3300025320Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025906Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025910Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025916Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025949Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026318Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 (SPAdes)EnvironmentalOpen in IMG/M
3300026333Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 (SPAdes)EnvironmentalOpen in IMG/M
3300027061Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM1H0_M3 (SPAdes)EnvironmentalOpen in IMG/M
3300027535Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M2 (SPAdes)EnvironmentalOpen in IMG/M
3300027663Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA Ref_M3 (SPAdes)EnvironmentalOpen in IMG/M
3300027671Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes)EnvironmentalOpen in IMG/M
3300027846Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027857Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027895Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 (SPAdes)EnvironmentalOpen in IMG/M
3300031057Oak Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031234Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2EnvironmentalOpen in IMG/M
3300031474Fir Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031715Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05EnvironmentalOpen in IMG/M
3300031718Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05EnvironmentalOpen in IMG/M
3300031753Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515EnvironmentalOpen in IMG/M
3300031754Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515EnvironmentalOpen in IMG/M
3300031823Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05EnvironmentalOpen in IMG/M
3300031908Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D1EnvironmentalOpen in IMG/M
3300031945Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082EnvironmentalOpen in IMG/M
3300031962Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
INPgaii200_063938712228664022SoilMKRALLCSLIGFVLLSSAASSRAQTTGDTEKAVAALEQQWLQS
INPhiseqgaiiFebDRAFT_10162982323300000364SoilMKRTLLCCLIGFVLLSSAALSQAQTTEGTEKAVAALE
JGI12636J13339_103662113300001154Forest SoilMKRTWILCLIGLLSLGSAAWSQAQTTGGTEKAVAALEQQWL
Ga0066673_1018659333300005175SoilMNRTWMWCLVGLLSFGSAALSQNSTAGSGTEKAVAALEQQWLQ
Ga0066673_1087864213300005175SoilMKRTLILYLVGLLSWGIATRSQAQTTGGTEKAVAAREQQWLQSQKI
Ga0066684_1094532813300005179SoilMKRTWMWCLIGLLSFASVAWSQAQTTGGTEKAVAALEQQWLQ
Ga0066388_10074061313300005332Tropical Forest SoilMTKSLMWCLVGLLLLGSASWSQAQTIGETEKAVAALEQQW
Ga0070713_10053685723300005436Corn, Switchgrass And Miscanthus RhizosphereMKRTWMWCLVGLLSLGSAALSQDSTAGSGTEKAVAALEQQWLQSQ
Ga0070713_10059875223300005436Corn, Switchgrass And Miscanthus RhizosphereMKRTWMWCLIGLLSLGSAAWSQDKKASGGTEKAVAALEQQWLQ
Ga0070710_1092538323300005437Corn, Switchgrass And Miscanthus RhizosphereMKKLWMGCLIGVLLMGTAALSRAQKTGATEKAVAALEEQWLQAQ
Ga0070706_10067000513300005467Corn, Switchgrass And Miscanthus RhizosphereMKKSLMWCLIGLLSLGSAARSQAQTNSGTEKAVAALEQQWLQSQKTNN
Ga0070706_10075139723300005467Corn, Switchgrass And Miscanthus RhizosphereMKRFWTVCLIVLLSLGSASLLQAQTGTEKSVAALEQQWLQSQKTN
Ga0070698_10185338813300005471Corn, Switchgrass And Miscanthus RhizosphereMKRFWTVCLIVLLSLGSASLLQAQTGTEKSVAALEQQWLQSQKT
Ga0073909_1046778423300005526Surface SoilMKRTWMWCLIGLLSLGSAAWSQDKKDGGGTEKAVAA
Ga0070730_1000954743300005537Surface SoilMWCLVGLSQDSTAGGGTEKAVAALEQQWLQIAEDK*
Ga0070704_10019369223300005549Corn, Switchgrass And Miscanthus RhizosphereMKKTLTWCLLGLFSLGSAAWSQDKQPGGGTEKAVAVLEQQWLQSQKT
Ga0066661_1054293113300005554SoilMKRTWMWCLVGLLSLGSAALSQDSTAGSGTEKAVAALEQQWLQSQKTNNP
Ga0066699_1045785833300005561SoilMKRTWMWCLIGLFSLGSTAWSQNEQAGGGTEKAVAALEQQWLQSQK
Ga0068855_10196819813300005563Corn RhizosphereMSKTSIWCLVGLLSLVSAALSQDSTAGNGTEKAVAALEQQWLQS
Ga0066706_1106026723300005598SoilMKSTWMWCLISLLSVGSAAWSQDKKPDGGTEKAVAALEQQWLQS*
Ga0070717_1119795513300006028Corn, Switchgrass And Miscanthus RhizosphereMKRFWTVCLIVLLSLGSASLLQAQTGTEKSVAALEQQWLQSQK
Ga0066696_1070880613300006032SoilMFMNRTWMWCLVGLLSFGSAALSQNSTAGSGTEKAVAALEQQWLQSQKTNNP
Ga0070715_1049177833300006163Corn, Switchgrass And Miscanthus RhizosphereMKKTLMWCLIGLISLGSAARSQAQQTGATEKAVAALEEQWLQSQK
Ga0070715_1051001413300006163Corn, Switchgrass And Miscanthus RhizosphereMKRTWILFLAGLFSLGIATRSQAQTTGGTEKAVAA
Ga0070716_10043740913300006173Corn, Switchgrass And Miscanthus RhizosphereMKKTWMWCLIGVLLLGSAARSQAQTNGGTEKAVAA
Ga0070716_10072503723300006173Corn, Switchgrass And Miscanthus RhizosphereMKRTWMWCLVGLLSLGSAALSEGMQAGGGTEKAVAALEQQWLQSQ
Ga0075014_10094793013300006174WatershedsMKKIMMWCLIGLLSLVSVAWSQTQMTGGTEKAVAALEQQWIQAMKSNN
Ga0070712_10093746913300006175Corn, Switchgrass And Miscanthus RhizosphereMKKTCTFFLVGLLSLVAAVSARAQTTGGTEKAVAALEQQWLQSQ
Ga0070712_10182172913300006175Corn, Switchgrass And Miscanthus RhizosphereMKRTWMWCLVGLFSVGSTGLSQEKRTGGGTEKAVAALEQQW
Ga0066658_1027097233300006794SoilMNRNWTWCLIGVLLLASAGWSKDKNAGGGTEDAVAALEQKWPQSQK
Ga0066665_1099783913300006796SoilMKKSLMWCLIGLLSLASAARSQAQANGGTEKAVAALEQ
Ga0075425_10246297623300006854Populus RhizosphereMKRMWMWCLVGLLSLGSAALSQDNSARSGTEKAVAALEQQWLQSQKTN
Ga0068865_10080980923300006881Miscanthus RhizosphereMKKLWMGCLIGVLLLGSAARSHAQKTGATEKAVAAL
Ga0073928_1004435273300006893Iron-Sulfur Acid SpringMKRTLTWCLVGFVLLVSTAWSQAQMTGGTEKAVAAL
Ga0075435_10091906013300007076Populus RhizosphereMKKTLMCCLIGLLSLGSAAWLQAQQTGGTEKAVAALEQQWLQSQK
Ga0066710_10146687923300009012Grasslands SoilMKRTWTWCLIGLLALGSAAWSQDKKTGGGTEKAVAALEQQWLQ
Ga0099829_1008973433300009038Vadose Zone SoilMKRTWMWCLIGLLSFGSVAWSQAQTTGGTEKAVAALEQQWLQS
Ga0099829_1073375913300009038Vadose Zone SoilMKRTWISSLIGLLLLGSAAWSQAQRPGGTEKAVAA
Ga0099828_1035380813300009089Vadose Zone SoilMKKTLMWCLICFFLLGNAAWSQAQTTGGTERAVAALEQQ
Ga0099828_1048794313300009089Vadose Zone SoilMKRTWILCVIGLLSLGSAAWSQAQTTGGTEKAVAA
Ga0075423_1056258423300009162Populus RhizosphereMWCLISLLSVGSAAWSQAQTTGATEKAVAALEQQWLQSQKTNNP
Ga0134121_1135125123300010401Terrestrial SoilMKRTWLWCLIALLSVGTAAWSQNASGGTEKAVAALEQQWLQS
Ga0137391_1098361813300011270Vadose Zone SoilMKKTLMWCLIGLLSLGSAARSQAQQTGATEKAVAALEEQ
Ga0137389_1038979513300012096Vadose Zone SoilMKKTGIWCLLVLLLLLSAAWSQNKQSGSGTEKAVAALEQQ
Ga0137389_1125549623300012096Vadose Zone SoilVKKTWIWCSLVLLSVVSAAWSQAQTTGGIEKAVAALEQ
Ga0137388_1033984423300012189Vadose Zone SoilMKKTFMWCLSTLLLLGSAAWLQAQQTGATEKAVAALE
Ga0137388_1094635223300012189Vadose Zone SoilMKKTLMWCLICFFLLGNAAWSQAQTTGGTERAVAALEQHWLQSQ
Ga0137365_1080955913300012201Vadose Zone SoilMKRTCILFIVALLSLVSAASAQAQTTGGTEKAVAALEQQWL
Ga0137363_1123847413300012202Vadose Zone SoilMWCLIGLLSFGSVAWSQAQTTGGTEKAVAALEQQW
Ga0137362_1010140643300012205Vadose Zone SoilMKKTLMWCFIGLLSLGSVAWSQAQTTGGTEKAVAALEQQ*
Ga0137381_1168361013300012207Vadose Zone SoilMKKSLMWCLIGLLSLGSAARSQAQTNGATEKAVAALEQQWL
Ga0137377_1100691523300012211Vadose Zone SoilMWCLVGLLSFGSAALSQDSTAGSGTEKALAALEQQWLQSQKT
Ga0137387_1001272043300012349Vadose Zone SoilMKKTWMWCLIGVLLLGSTARSQAQMTGGTEKAAAALEEQ*
Ga0137387_1029011723300012349Vadose Zone SoilMKRTCILFIVALLSLVSAASAQAQTTGGTEKAVAALEQQWLQSQ
Ga0137385_1091436933300012359Vadose Zone SoilGMAMKKTWMWCLIGVLLLGSTARSQAQMTGGTEKAAAALEEQ*
Ga0137361_1052348613300012362Vadose Zone SoilMWCLVALLSLGSFAWSQAGGGAEKAVAALEQQWLQSQKTN
Ga0137358_1040269033300012582Vadose Zone SoilMWCLISLLSLGSAAWLQAQQIGGTEKAVAALEQQWLQSQ
Ga0137395_1106081313300012917Vadose Zone SoilMWFLISLLSVGSAAWAQDKKAGGGTEKAVAALEQQWLQSQKTNNPD
Ga0137420_102547713300015054Vadose Zone SoilMKRTWILCLIGLFYLGSVASSQAQQTGGIEKAVAALEEQWLQSQKKQWL
Ga0134083_1000662013300017659Grasslands SoilMKSAWMWFLISLLSVGSAAWAQDKKAGGGTEKAVAALEQQWLQS
Ga0187880_132690713300018016PeatlandMKKTWMSCLVGLLLVGSLAWSQDKKAGGGTEKAVAALE
Ga0187857_1003794633300018026PeatlandMKKSLMWGLLGFCLLVSAAWSQAQKTGETEKAIVALEQQWQE
Ga0066655_1026792733300018431Grasslands SoilMKKTWMWCLIGVLLLGSAARSPAQTTGGTEKTVAALEEQWLQAQKTN
Ga0210403_1091237113300020580SoilMKKSLMWCLVGLLSLGSAAWSQAQTNGGTEKAVAALEQQWLESQKTNN
Ga0210401_1142397913300020583SoilMKKSLMWCLVGLLSLGSAAWSQAQTTGGTEKAVATLEQQWLESQKT
Ga0210400_1048361113300021170SoilMKKSLMWCLVGLLSLGSAAWSQAQTNGGTEKAVAALEQQ
Ga0210405_1082801313300021171SoilMDRTWTWCLIAVLSLASAAWSQEKKAGGTEGAVAALEQQ
Ga0210396_1158312713300021180SoilMKRICIVCVMVLFSLGSAALSQAQATGATAKNVAALEQQWLQSQKTN
Ga0193719_1023948413300021344SoilMKRTWMWCLIGLVSLASALSQEGGTEKAVAALEQQ
Ga0210393_1103825513300021401SoilMKKLWMGCLIGVLLLGSAARSHAQNTGATEKAVAALEEQ
Ga0210384_1023407613300021432SoilMNRTWTWCLIAVLSLASAAWSQEKKAGGTEGAVAALEQQWLQS
Ga0210392_1038691533300021475SoilMKKMLMFCLVCLISLGSAAWSQAQQTGGAEKAVAALEEQ
Ga0210409_1027749913300021559SoilMKRTWIWCLIGLFSFGNAARLQAQTTDGTEKAVAALEQQWLQSQ
Ga0137417_132155733300024330Vadose Zone SoilMKKTLIWCFLGLLSLMSAAWSQAQQTSETEKAVAALEEKWLQA
Ga0247668_100528913300024331SoilMKKTLMWCFIGLLSLGSAAWSQAQTTSGTEKAVAALEQQWLQSQKTNN
Ga0209171_1039412723300025320Iron-Sulfur Acid SpringMKKTLMWCFIGLLSLGSAAWSQAQTTGGTEKSVAALEDQ
Ga0207699_1012041513300025906Corn, Switchgrass And Miscanthus RhizosphereMKRTWMWCLVGLFLLGNAAWSQDKMGGDTEKAVVAL
Ga0207684_1044721023300025910Corn, Switchgrass And Miscanthus RhizosphereMKKTLMWCLIGLISLGSAARSQAQQTGATEKAVAALEE
Ga0207663_1016681813300025916Corn, Switchgrass And Miscanthus RhizosphereMKKTLMWCLIGLISLGSATRSQAQQTGATEKAVAALEEQWLQSQKTN
Ga0207663_1112317313300025916Corn, Switchgrass And Miscanthus RhizosphereMKKTLVWCFIGLLSLGSAAWSQAQTTGGTEKAVAALEQQWL
Ga0207667_1186883323300025949Corn RhizosphereMKRIWLWCLIALLSVGNAAWSQDSSGGTEKAVTALEQQWLQSQKT
Ga0209471_106330513300026318SoilMKKTWMWCLVGLLSLVSSAFSQDKQAGGGTEKAVAALEQQWLQSQKTNNP
Ga0209158_100733463300026333SoilMKRTLILYLVGLLSWGIATRSQAQTTGGTEKAVAAREQQWLQSQKINN
Ga0209729_103183013300027061Forest SoilMKRTWMWCLIGLLSLGSVAWAQAQKTGGIEKAVAAQEE
Ga0209734_105636713300027535Forest SoilMKRTWMWCLVALLSLGTTMRLQAQTTGGTEKAVAALEQQWVQS
Ga0208990_114821813300027663Forest SoilMKKTWMWCLVGVLLLGSAARSQAQMTGGTEKAVAALEQ
Ga0209588_123482313300027671Vadose Zone SoilMKRTWISSLIGLLLLGSAAWSQAQRPGGTEKAVAALEQQWLQSQ
Ga0209180_1010545413300027846Vadose Zone SoilMKRTWMWCLIGLLSFGSVAWSQAQTTGGTEKAVAALEQQWLQSQKTNN
Ga0209166_1000174793300027857Surface SoilMWCLVGLSQDSTAGGGTEKAVAALEQQWLQIAEDK
Ga0209624_1041326323300027895Forest SoilMWCLAGLLSMGSAAWLQDNKASGTEKAVAALEQQWL
Ga0170834_10363119713300031057Forest SoilMKKILMWCLIGLISVGSAARSQAQQTGATEKAVAALEEQWLQSQKTNNPEQ
Ga0302325_1217165713300031234PalsaMRRIVASCFLGLVLLAGCAWSQAQTGTEKAVAALEEQWLK
Ga0170818_11270360213300031474Forest SoilMKRTWLWCLIAVVSVGNAAWSSDAKGGTEKAVAALEQQWLQ
Ga0307476_1027923713300031715Hardwood Forest SoilVKKTWMWCLIGLLSLGSAALSRAQETGGTEKAVAALE
Ga0307476_1100560523300031715Hardwood Forest SoilMNRTWMWCLIGLISLGSAALSQAQTTGDTEKTVAALEQKWLEA
Ga0307474_1047719413300031718Hardwood Forest SoilMKKLWMGCLIGVLLLGSAARSHAQNTGATEKAVAALEEQWLQAQ
Ga0307474_1094503913300031718Hardwood Forest SoilMKRTWMWCVIGLLSLGSVAWAQAQKTGGIEKAVAAQEE
Ga0307474_1128249813300031718Hardwood Forest SoilMRKVWMWCLIGMLSLGSAAMAPAQQAGETEKVVAALENQWLQ
Ga0307477_1001121813300031753Hardwood Forest SoilMKRTWMWCLVGLLSLGSVAWAQDKQAGGGTEKAVAALEQQWLQS
Ga0307475_1019655833300031754Hardwood Forest SoilMKRTWMWCLIGLLSLGSVAWAQAQKTGGIEKAVAAQEEQWLQAM
Ga0307478_1065114723300031823Hardwood Forest SoilMKKTLMWCLIGLLSLGSVARSQAQQTGATEKAVAALE
Ga0310900_1185781323300031908SoilMKKLWMWCLIGVLLLGSAASSYAQKTGATEKAVAALEEKWLQAQKTNN
Ga0310913_1076870413300031945SoilDVDLIGVLLLGSAARSQAQTTGGTERAVVALEEQWLQETKDK
Ga0307479_1181995913300031962Hardwood Forest SoilMKRTWMWCLIGLLSLGSAAWSQAQTTGGTEKAVAALEEQWLQALKTNNPD
Ga0307471_10396254223300032180Hardwood Forest SoilMKRTWMWCLIGLLSLGSAAWSQDKKASGGTEKAVAALEQQWLQSQKTN

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.