


| Basic Information | |
|---|---|
| Family ID | F096083 |
| Family Type | Metagenome |
| Number of Sequences | 105 |
| Average Sequence Length | 43 residues |
| Representative Sequence | LEVTRIEPGAYDEKVYGPGIGIVREQALTGTSEFAQLVSVTG |
| Number of Associated Samples | 88 |
| Number of Associated Scaffolds | 105 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 4.95 % |
| % of genes near scaffold ends (potentially truncated) | 88.57 % |
| % of genes from short scaffolds (< 2000 bps) | 91.43 % |
| Associated GOLD sequencing projects | 83 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.57 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (77.143 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere (16.191 % of family members) |
| Environment Ontology (ENVO) | Unclassified (24.762 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (44.762 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 34.29% Coil/Unstructured: 65.71% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.57 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 105 Family Scaffolds |
|---|---|---|
| PF02518 | HATPase_c | 6.67 |
| PF13581 | HATPase_c_2 | 4.76 |
| PF00582 | Usp | 2.86 |
| PF00583 | Acetyltransf_1 | 2.86 |
| PF04343 | DUF488 | 1.90 |
| PF00211 | Guanylate_cyc | 1.90 |
| PF00005 | ABC_tran | 1.90 |
| PF01987 | AIM24 | 1.90 |
| PF01728 | FtsJ | 1.90 |
| PF00072 | Response_reg | 0.95 |
| PF00106 | adh_short | 0.95 |
| PF00756 | Esterase | 0.95 |
| PF00497 | SBP_bac_3 | 0.95 |
| PF07907 | YibE_F | 0.95 |
| PF06441 | EHN | 0.95 |
| PF09334 | tRNA-synt_1g | 0.95 |
| PF13462 | Thioredoxin_4 | 0.95 |
| PF00282 | Pyridoxal_deC | 0.95 |
| PF00578 | AhpC-TSA | 0.95 |
| PF07681 | DoxX | 0.95 |
| PF13701 | DDE_Tnp_1_4 | 0.95 |
| PF03176 | MMPL | 0.95 |
| PF02142 | MGS | 0.95 |
| PF01957 | NfeD | 0.95 |
| PF07969 | Amidohydro_3 | 0.95 |
| PF04828 | GFA | 0.95 |
| PF00990 | GGDEF | 0.95 |
| PF06559 | DCD | 0.95 |
| PF00685 | Sulfotransfer_1 | 0.95 |
| PF12704 | MacB_PCD | 0.95 |
| PF13487 | HD_5 | 0.95 |
| PF01548 | DEDD_Tnp_IS110 | 0.95 |
| PF11617 | Cu-binding_MopE | 0.95 |
| PF10604 | Polyketide_cyc2 | 0.95 |
| PF00326 | Peptidase_S9 | 0.95 |
| PF00198 | 2-oxoacid_dh | 0.95 |
| PF07040 | DUF1326 | 0.95 |
| COG ID | Name | Functional Category | % Frequency in 105 Family Scaffolds |
|---|---|---|---|
| COG0293 | 23S rRNA U2552 (ribose-2'-O)-methylase RlmE/FtsJ | Translation, ribosomal structure and biogenesis [J] | 1.90 |
| COG1189 | Predicted rRNA methylase YqxC, contains S4 and FtsJ domains | Translation, ribosomal structure and biogenesis [J] | 1.90 |
| COG2013 | AIM24 protein, required for mitochondrial respiration | Energy production and conversion [C] | 1.90 |
| COG2114 | Adenylate cyclase, class 3 | Signal transduction mechanisms [T] | 1.90 |
| COG3189 | Uncharacterized conserved protein YeaO, DUF488 family | Function unknown [S] | 1.90 |
| COG0018 | Arginyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 0.95 |
| COG0060 | Isoleucyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 0.95 |
| COG0076 | Glutamate or tyrosine decarboxylase or a related PLP-dependent protein | Amino acid transport and metabolism [E] | 0.95 |
| COG0143 | Methionyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 0.95 |
| COG0215 | Cysteinyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 0.95 |
| COG0495 | Leucyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 0.95 |
| COG0508 | Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide acyltransferase (E2) component | Energy production and conversion [C] | 0.95 |
| COG0525 | Valyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 0.95 |
| COG0596 | 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase MenH and related esterases, alpha/beta hydrolase fold | Coenzyme transport and metabolism [H] | 0.95 |
| COG0717 | dCTP deaminase | Nucleotide transport and metabolism [F] | 0.95 |
| COG1033 | Predicted exporter protein, RND superfamily | General function prediction only [R] | 0.95 |
| COG2259 | Uncharacterized membrane protein YphA, DoxX/SURF4 family | Function unknown [S] | 0.95 |
| COG2409 | Predicted lipid transporter YdfJ, MMPL/SSD domain, RND superfamily | General function prediction only [R] | 0.95 |
| COG3547 | Transposase | Mobilome: prophages, transposons [X] | 0.95 |
| COG3791 | Uncharacterized conserved protein | Function unknown [S] | 0.95 |
| COG4270 | Uncharacterized membrane protein | Function unknown [S] | 0.95 |
| COG5438 | Uncharacterized membrane protein | Function unknown [S] | 0.95 |
| COG5588 | Uncharacterized conserved protein, DUF1326 domain | Function unknown [S] | 0.95 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 77.14 % |
| Unclassified | root | N/A | 22.86 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2170459002|FZY7DQ102H6398 | All Organisms → cellular organisms → Bacteria | 505 | Open in IMG/M |
| 3300000956|JGI10216J12902_126376546 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 651 | Open in IMG/M |
| 3300001431|F14TB_100540290 | Not Available | 532 | Open in IMG/M |
| 3300005172|Ga0066683_10670080 | All Organisms → cellular organisms → Bacteria | 619 | Open in IMG/M |
| 3300005177|Ga0066690_10567367 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 759 | Open in IMG/M |
| 3300005180|Ga0066685_10077395 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2189 | Open in IMG/M |
| 3300005181|Ga0066678_10494000 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 814 | Open in IMG/M |
| 3300005187|Ga0066675_11169845 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 572 | Open in IMG/M |
| 3300005436|Ga0070713_101988837 | All Organisms → cellular organisms → Bacteria | 564 | Open in IMG/M |
| 3300005437|Ga0070710_10217596 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1214 | Open in IMG/M |
| 3300005440|Ga0070705_101570851 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 553 | Open in IMG/M |
| 3300005450|Ga0066682_10276885 | All Organisms → cellular organisms → Bacteria | 1082 | Open in IMG/M |
| 3300005546|Ga0070696_100170299 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1609 | Open in IMG/M |
| 3300005549|Ga0070704_100019752 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 4335 | Open in IMG/M |
| 3300005554|Ga0066661_10246909 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1105 | Open in IMG/M |
| 3300005560|Ga0066670_10974753 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 517 | Open in IMG/M |
| 3300005561|Ga0066699_10993049 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 582 | Open in IMG/M |
| 3300005569|Ga0066705_10550177 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 716 | Open in IMG/M |
| 3300005713|Ga0066905_100692084 | All Organisms → cellular organisms → Bacteria | 874 | Open in IMG/M |
| 3300005764|Ga0066903_101087939 | All Organisms → cellular organisms → Bacteria | 1472 | Open in IMG/M |
| 3300005764|Ga0066903_103668539 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 826 | Open in IMG/M |
| 3300005764|Ga0066903_106812361 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 594 | Open in IMG/M |
| 3300005764|Ga0066903_108552699 | Not Available | 521 | Open in IMG/M |
| 3300006032|Ga0066696_11066515 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 514 | Open in IMG/M |
| 3300006058|Ga0075432_10338175 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 635 | Open in IMG/M |
| 3300006163|Ga0070715_10911929 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 542 | Open in IMG/M |
| 3300006194|Ga0075427_10019970 | All Organisms → cellular organisms → Bacteria | 1059 | Open in IMG/M |
| 3300006804|Ga0079221_10272429 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 976 | Open in IMG/M |
| 3300006847|Ga0075431_101114930 | All Organisms → cellular organisms → Bacteria | 753 | Open in IMG/M |
| 3300006847|Ga0075431_101908755 | Not Available | 549 | Open in IMG/M |
| 3300006852|Ga0075433_10753044 | All Organisms → cellular organisms → Bacteria | 852 | Open in IMG/M |
| 3300006852|Ga0075433_10799245 | All Organisms → cellular organisms → Bacteria | 824 | Open in IMG/M |
| 3300006852|Ga0075433_11709838 | All Organisms → cellular organisms → Bacteria | 542 | Open in IMG/M |
| 3300006854|Ga0075425_102086114 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 633 | Open in IMG/M |
| 3300006904|Ga0075424_100990099 | All Organisms → cellular organisms → Bacteria | 896 | Open in IMG/M |
| 3300006914|Ga0075436_100477448 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 910 | Open in IMG/M |
| 3300007255|Ga0099791_10587900 | All Organisms → cellular organisms → Bacteria | 544 | Open in IMG/M |
| 3300009012|Ga0066710_101239519 | All Organisms → cellular organisms → Bacteria | 1156 | Open in IMG/M |
| 3300009094|Ga0111539_10528450 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 1374 | Open in IMG/M |
| 3300009137|Ga0066709_101179449 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1127 | Open in IMG/M |
| 3300009137|Ga0066709_101419910 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1008 | Open in IMG/M |
| 3300009137|Ga0066709_101559464 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 949 | Open in IMG/M |
| 3300009147|Ga0114129_11329408 | Not Available | 890 | Open in IMG/M |
| 3300009147|Ga0114129_12061159 | Not Available | 689 | Open in IMG/M |
| 3300009156|Ga0111538_11739253 | All Organisms → cellular organisms → Bacteria | 785 | Open in IMG/M |
| 3300009162|Ga0075423_10333497 | All Organisms → cellular organisms → Bacteria | 1590 | Open in IMG/M |
| 3300009162|Ga0075423_11913322 | Not Available | 641 | Open in IMG/M |
| 3300009162|Ga0075423_12702865 | All Organisms → cellular organisms → Bacteria | 543 | Open in IMG/M |
| 3300009792|Ga0126374_10985033 | Not Available | 660 | Open in IMG/M |
| 3300010043|Ga0126380_10898106 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium | 736 | Open in IMG/M |
| 3300010046|Ga0126384_10297166 | All Organisms → cellular organisms → Bacteria | 1326 | Open in IMG/M |
| 3300010304|Ga0134088_10545612 | All Organisms → cellular organisms → Bacteria | 574 | Open in IMG/M |
| 3300010337|Ga0134062_10279857 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 784 | Open in IMG/M |
| 3300010337|Ga0134062_10296265 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 765 | Open in IMG/M |
| 3300010360|Ga0126372_12356474 | Not Available | 582 | Open in IMG/M |
| 3300010360|Ga0126372_12789989 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 540 | Open in IMG/M |
| 3300010362|Ga0126377_12668387 | Not Available | 575 | Open in IMG/M |
| 3300010373|Ga0134128_10347235 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Patulibacteraceae → Patulibacter → Patulibacter americanus | 1658 | Open in IMG/M |
| 3300010400|Ga0134122_10848792 | All Organisms → cellular organisms → Bacteria | 877 | Open in IMG/M |
| 3300011119|Ga0105246_10274995 | Not Available | 1348 | Open in IMG/M |
| 3300012198|Ga0137364_10094650 | All Organisms → cellular organisms → Bacteria | 2092 | Open in IMG/M |
| 3300012207|Ga0137381_10423482 | All Organisms → cellular organisms → Bacteria | 1162 | Open in IMG/M |
| 3300012208|Ga0137376_10023481 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 4776 | Open in IMG/M |
| 3300012208|Ga0137376_10774634 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 826 | Open in IMG/M |
| 3300012350|Ga0137372_10278956 | All Organisms → cellular organisms → Bacteria | 1303 | Open in IMG/M |
| 3300012355|Ga0137369_10872705 | All Organisms → cellular organisms → Bacteria | 607 | Open in IMG/M |
| 3300012923|Ga0137359_11319642 | Not Available | 610 | Open in IMG/M |
| 3300012929|Ga0137404_10745858 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 887 | Open in IMG/M |
| 3300012944|Ga0137410_11081510 | All Organisms → cellular organisms → Bacteria | 686 | Open in IMG/M |
| 3300012944|Ga0137410_11695184 | All Organisms → cellular organisms → Bacteria | 556 | Open in IMG/M |
| 3300012955|Ga0164298_10833275 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 663 | Open in IMG/M |
| 3300013306|Ga0163162_12959701 | Not Available | 546 | Open in IMG/M |
| 3300015245|Ga0137409_10947677 | Not Available | 697 | Open in IMG/M |
| 3300015357|Ga0134072_10149768 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 767 | Open in IMG/M |
| 3300015359|Ga0134085_10357600 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 650 | Open in IMG/M |
| 3300015373|Ga0132257_100676027 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1281 | Open in IMG/M |
| 3300018052|Ga0184638_1295852 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 548 | Open in IMG/M |
| 3300018071|Ga0184618_10396071 | Not Available | 585 | Open in IMG/M |
| 3300018081|Ga0184625_10146322 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1234 | Open in IMG/M |
| 3300018468|Ga0066662_11345626 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 735 | Open in IMG/M |
| 3300018469|Ga0190270_11201732 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 796 | Open in IMG/M |
| 3300018482|Ga0066669_11930140 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 550 | Open in IMG/M |
| 3300021082|Ga0210380_10591888 | Not Available | 509 | Open in IMG/M |
| 3300021363|Ga0193699_10298233 | All Organisms → cellular organisms → Bacteria | 672 | Open in IMG/M |
| 3300022694|Ga0222623_10278443 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 643 | Open in IMG/M |
| 3300022694|Ga0222623_10335215 | Not Available | 579 | Open in IMG/M |
| 3300022756|Ga0222622_10036426 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2670 | Open in IMG/M |
| 3300025922|Ga0207646_10690758 | All Organisms → cellular organisms → Bacteria | 913 | Open in IMG/M |
| 3300025935|Ga0207709_11270381 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 608 | Open in IMG/M |
| 3300026088|Ga0207641_12323574 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 536 | Open in IMG/M |
| 3300026310|Ga0209239_1174127 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 820 | Open in IMG/M |
| 3300026317|Ga0209154_1319737 | Not Available | 509 | Open in IMG/M |
| 3300026335|Ga0209804_1284990 | All Organisms → cellular organisms → Bacteria | 572 | Open in IMG/M |
| 3300028380|Ga0268265_11467844 | Not Available | 685 | Open in IMG/M |
| 3300028536|Ga0137415_10353052 | Not Available | 1274 | Open in IMG/M |
| 3300028708|Ga0307295_10172783 | All Organisms → cellular organisms → Bacteria | 606 | Open in IMG/M |
| 3300028784|Ga0307282_10550497 | All Organisms → cellular organisms → Bacteria | 560 | Open in IMG/M |
| 3300028828|Ga0307312_10539751 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 771 | Open in IMG/M |
| 3300031716|Ga0310813_12354616 | Not Available | 505 | Open in IMG/M |
| 3300032180|Ga0307471_103824071 | All Organisms → cellular organisms → Bacteria | 532 | Open in IMG/M |
| 3300033412|Ga0310810_10848470 | All Organisms → cellular organisms → Bacteria | 814 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 16.19% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 13.33% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 12.38% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 8.57% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 8.57% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 6.67% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 5.71% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 4.76% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 4.76% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 2.86% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 2.86% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.90% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.90% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.90% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.95% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.95% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 0.95% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.95% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.95% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.95% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.95% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.95% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2170459002 | Grass soil microbial communities from Rothamsted Park, UK - March 2009 direct MP BIO 1O1 lysis 0-21 cm | Environmental | Open in IMG/M |
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001431 | Amended soil microbial communities from Kansas Great Prairies, USA - BrdU F1.4TB clc assemly | Environmental | Open in IMG/M |
| 3300005172 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 | Environmental | Open in IMG/M |
| 3300005177 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 | Environmental | Open in IMG/M |
| 3300005180 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 | Environmental | Open in IMG/M |
| 3300005181 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 | Environmental | Open in IMG/M |
| 3300005187 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 | Environmental | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
| 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
| 3300005450 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 | Environmental | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
| 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Environmental | Open in IMG/M |
| 3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
| 3300005560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119 | Environmental | Open in IMG/M |
| 3300005561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 | Environmental | Open in IMG/M |
| 3300005569 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 | Environmental | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006032 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 | Environmental | Open in IMG/M |
| 3300006058 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Host-Associated | Open in IMG/M |
| 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
| 3300006194 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 | Host-Associated | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300006847 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Host-Associated | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
| 3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09182015 | Environmental | Open in IMG/M |
| 3300010337 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Host-Associated | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012350 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012355 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaG | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012955 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG | Environmental | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300015245 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015357 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_0_1 metaG | Environmental | Open in IMG/M |
| 3300015359 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09182015 | Environmental | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300018052 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b2 | Environmental | Open in IMG/M |
| 3300018071 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_b1 | Environmental | Open in IMG/M |
| 3300018081 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b1 | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300018469 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300021082 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_coex redo | Environmental | Open in IMG/M |
| 3300021363 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3c2 | Environmental | Open in IMG/M |
| 3300022694 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_coex | Environmental | Open in IMG/M |
| 3300022756 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1 | Environmental | Open in IMG/M |
| 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026310 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026317 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 (SPAdes) | Environmental | Open in IMG/M |
| 3300026335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 (SPAdes) | Environmental | Open in IMG/M |
| 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300028708 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_152 | Environmental | Open in IMG/M |
| 3300028784 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121 | Environmental | Open in IMG/M |
| 3300028807 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_186 | Environmental | Open in IMG/M |
| 3300028828 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202 | Environmental | Open in IMG/M |
| 3300031716 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300033412 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| E1_03596590 | 2170459002 | Grass Soil | TSLEATRIEPGLYDKKVYAAGIGIVLEVAVTGPTEIAQLVSMSG |
| JGI10216J12902_1263765461 | 3300000956 | Soil | MLEATRIEPGAYDQKVYAPGIGIVQEKALTGTPEFAELVSVSG* |
| F14TB_1005402901 | 3300001431 | Soil | LESTRIEPGAYDEKVYGPGIGIVSEHALTGDNEVAQLVSVSG* |
| Ga0066683_106700801 | 3300005172 | Soil | LRNTLTTLEATRVEPGLYDQKIYAPGIGMVLEQALTGPTEFAKLVSVTGP* |
| Ga0066690_105673672 | 3300005177 | Soil | TSLEATRIEPGAYDRKIYAPGIGMVREEALTGAPENAELVSVSG* |
| Ga0066685_100773955 | 3300005180 | Soil | LRNTLTTLEATRVEPGLYDQKIYAPGIGLVLEQALTGPTEFAKLVSVTGP* |
| Ga0066678_104940002 | 3300005181 | Soil | ATRLEPGAYDQKVYAPGIGIAREQALTGAPEFAELVSVTG* |
| Ga0066675_111698452 | 3300005187 | Soil | LEATRLEPGAYDQKVYAPGIGIAREQALTGASEFAELVSVTG* |
| Ga0070713_1019888371 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | NALTTLEATRLEPGAYDQKVYAPGLGIVREQALSGAPEFAELVSVTG* |
| Ga0070710_102175961 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | TRLEPGAYDQKVYAPGLGIVREQALTGAPEFAELVSVTG* |
| Ga0070705_1015708511 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | NVLTSLEATRVEPGSYDKKVYGPGIGIVREQALTGTSEFAQLVSVSG* |
| Ga0066682_102768851 | 3300005450 | Soil | LRNTLTTLEATRIEPGLYDQKIYAPGVGLVVEQALTGPTEFAKLVRVTGP* |
| Ga0070707_1001128743 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | VPYGTLKNVLTTLEATRLVPGAYDQKIYAPGIGIVREQALTGAQELAELVSISG* |
| Ga0070696_1001702993 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | ALTTLEATRLEPGAYDQKVYAPGLGIVREQALSGAPEFAELVSVTG* |
| Ga0070704_1000197526 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | TRVEAGAYDEKVYGPGIGIVSERSLTGPAEVAQLVSVSG* |
| Ga0066661_102469091 | 3300005554 | Soil | VEPGIYDQKIYGPGLGIVVEQSLTGPTEYAKLVSVSG* |
| Ga0066670_109747531 | 3300005560 | Soil | FRHILVSLEFTRLEPRVIDQKIYAPGIGIVQEKALTGAPEFAELVSVSG* |
| Ga0066699_109930491 | 3300005561 | Soil | EPGAFDKKVYGPGIGIVLERALSGPPEVARLVSVQG* |
| Ga0066705_105501772 | 3300005569 | Soil | LEATRIEPGAYDRKVYAPGVGMIREEALTGATEYAELVGVSG* |
| Ga0066905_1006920843 | 3300005713 | Tropical Forest Soil | EPGAYDEKVYGPGIGIVSERSLTGPMEFAQLVSMNG* |
| Ga0066903_1010879392 | 3300005764 | Tropical Forest Soil | LTTLEATQIEAGAYDEKIYGPGIGIVSERSLTGSNEVAQLVSVSP* |
| Ga0066903_1036685392 | 3300005764 | Tropical Forest Soil | VPDGTFKNVLTSLEATRIEPGAYDRKVYAPGIGMIREEALTGSPEFAELVSVGG* |
| Ga0066903_1068123612 | 3300005764 | Tropical Forest Soil | TLEATRIEPGAYDRKVYAPGIGIVREQALTGAPETAELVSVTG* |
| Ga0066903_1085526992 | 3300005764 | Tropical Forest Soil | TLESTRLEPGAYDEKIYGPGIGIVSERSLTGPNELAQLVSVSG* |
| Ga0066696_110665152 | 3300006032 | Soil | LTSLEATRIEPGAYDRKVYAPGVGMIREEALTGATEYAELVGVSG* |
| Ga0075432_103381752 | 3300006058 | Populus Rhizosphere | LKNALTTLEATRLEPGAYDQKVYAAGLGIVREQALSGAPEFAELVSVTG* |
| Ga0070715_109119292 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | NALTTLEATRLEPGAYDQKVYAPGLGIVREQALSGAPEFAELVSVIG* |
| Ga0075427_100199702 | 3300006194 | Populus Rhizosphere | HHVLTSLESTRVEPGAYDEKIYGLGIGIVRERALTGTSEFAQLVSVSG* |
| Ga0079221_102724291 | 3300006804 | Agricultural Soil | ATRLEPGAYDQKVYAPGLGIVREQALSGAPEFAELVSVTG* |
| Ga0075431_1011149302 | 3300006847 | Populus Rhizosphere | VRNVLTTLEATRVEAGAYDEKVYGPGIGIVSERSLTGPAEFAQLVSVTG* |
| Ga0075431_1019087551 | 3300006847 | Populus Rhizosphere | VRNVLTTLEATRVEAGAYDEKVYGPGIGIVSERSLTGPAEVAQLVSVTG* |
| Ga0075433_107530442 | 3300006852 | Populus Rhizosphere | KVRNVLTTLESTRLEPGGYDEKIYAPGIGIVSERSLTGNEVAQLVSVSG* |
| Ga0075433_107992453 | 3300006852 | Populus Rhizosphere | LEATRIEPGAYDEKTYGPGIGIVSERSLTGPNEFAQLVSVSG* |
| Ga0075433_117098381 | 3300006852 | Populus Rhizosphere | LTTLESTQLEPGAYDEKVYGPGIGIVSERSLTGPNELAQLVSVSR* |
| Ga0075425_1020861142 | 3300006854 | Populus Rhizosphere | EATRLEPGAYDQKVYGPGIGIVSEQSLTGPNEYATLVSVTG* |
| Ga0075424_1009900991 | 3300006904 | Populus Rhizosphere | LTTLESTRVEPGAYDEKIYGPGIGIVRERALTGTSEFAQLVSVSG* |
| Ga0075436_1004774482 | 3300006914 | Populus Rhizosphere | RIEPKVVDQKVYAPGIGIVFERALSGPPEIAKLVSVTG* |
| Ga0099791_105879001 | 3300007255 | Vadose Zone Soil | LEATRLEPGAYDQKAYAPGIGIVLEQSLTGANEFARLESVSGP* |
| Ga0066710_1012395192 | 3300009012 | Grasslands Soil | VRGVLTTLEATRVEPGAYDQKIYGRGIGIVVEHALTGEPEIAKLVSMTG |
| Ga0111539_105284504 | 3300009094 | Populus Rhizosphere | RIEPGAYDQKVYAPGIGIVSEQSLTGPNEFAQLVSVSG* |
| Ga0066709_1011794491 | 3300009137 | Grasslands Soil | TSLEFARIEPGVVDQKIYGPGIGIVSETALTGPQEIAKLVSMTG* |
| Ga0066709_1014199101 | 3300009137 | Grasslands Soil | TLEATQVEPGIYDQKIYGPGIVIVVEQSLTGPNEYAKLVSVTG* |
| Ga0066709_1015594641 | 3300009137 | Grasslands Soil | RLEPGAYDQKVYAPGIGIAREQALIGAPEFAELVSVTG* |
| Ga0114129_113294082 | 3300009147 | Populus Rhizosphere | EPGAYDQKVYGPGLGIVLEQALSGPPEVAKLVSISGP* |
| Ga0114129_120611592 | 3300009147 | Populus Rhizosphere | AGAYDEKVYGPGIGIVSERSLTGPAEVAQLVSVTG* |
| Ga0111538_117392531 | 3300009156 | Populus Rhizosphere | LEATAVEPGAYDQKVYGPGLGIVLEQALSGPPEVAKLVSVSGP* |
| Ga0075423_103334971 | 3300009162 | Populus Rhizosphere | EPGAYDEKIYAPGIGIVSERSLTGSNEFAQLVSASN* |
| Ga0075423_119133222 | 3300009162 | Populus Rhizosphere | GAYDEKVYGPGIGIVSERSLTGPAEVAQLVSVTG* |
| Ga0075423_127028651 | 3300009162 | Populus Rhizosphere | EPGSYDLKIYAPGIGIVLEQSLSGPNETAKLVSITGP* |
| Ga0126374_109850331 | 3300009792 | Tropical Forest Soil | EPGAYDEKVYGPGIGIVTEKALTGPAEFAQLVSVSP* |
| Ga0126380_108981062 | 3300010043 | Tropical Forest Soil | LRNVLTTLEATQLEPGSYDEKVYGLGIGIVSERSLTGPSEVAQLVSVSG* |
| Ga0126384_102971661 | 3300010046 | Tropical Forest Soil | KVRNVLTTLEATRIEPGAYDEKIYGPGIGIVSERSLTGSNEVAQLVSVSQ* |
| Ga0134088_105456121 | 3300010304 | Grasslands Soil | LYDQKIYARGVGIVLEQSLTGPTEIAKLVSVSGP* |
| Ga0134062_102798573 | 3300010337 | Grasslands Soil | TLEATRLEPGAYDQKVYAPGIGIAREQALTGTPEFAELVSVNG* |
| Ga0134062_102962651 | 3300010337 | Grasslands Soil | RLKNVLTTLEATQLEPGAYDQKVYAPGLGIVREQALTGAAEFAELVSVSG* |
| Ga0126372_123564741 | 3300010360 | Tropical Forest Soil | TLESTQLEAGAYDEKVYGPGIGIVSERALTGEPETAQLVSVSG* |
| Ga0126372_127899891 | 3300010360 | Tropical Forest Soil | TLESTRLEPGAYDEKVYGPGIGIVSERALTGPTETAQLVSISG* |
| Ga0126377_126683872 | 3300010362 | Tropical Forest Soil | ESTRLEPGAYDEKVYGPGIGIVSERSLTGPTEYALLVSVSG* |
| Ga0134128_103472353 | 3300010373 | Terrestrial Soil | EATRLEPGAYDQKVYAPGLGIVREQALSGAPEFAELVSVTG* |
| Ga0134122_108487921 | 3300010400 | Terrestrial Soil | TRIEPGAYDEKVYGTGIGIVSERALTGDTEVAQLVSVSG* |
| Ga0105246_102749951 | 3300011119 | Miscanthus Rhizosphere | GAYDEKVYGPGIGIVSEHALTGDNEVAKLVSVSG* |
| Ga0137364_100946501 | 3300012198 | Vadose Zone Soil | VEPGIYDQKIYGPGIGIVVEQSLTGPNEYAKLVSVTG* |
| Ga0137381_104234821 | 3300012207 | Vadose Zone Soil | LEAARIEPGHYDLKIYAPGIGIVLEQALTGPTETAQLVSVTGP* |
| Ga0137376_100234811 | 3300012208 | Vadose Zone Soil | GAYDHKVYAPGVGMIREEALTGATEYAELVSVSG* |
| Ga0137376_107746342 | 3300012208 | Vadose Zone Soil | EAGAYDQKVYAPGIGIVREQALTGAPEFAELVSVSG* |
| Ga0137372_102789561 | 3300012350 | Vadose Zone Soil | RLEPGAYDQKVYAPGIGIAREQALTGEPEFAELVSVTG* |
| Ga0137369_108727053 | 3300012355 | Vadose Zone Soil | NVLTTLEATQIEPGAYDQKVYGPGIGIVSEQSLTGPNEVAQLVSVTG* |
| Ga0137359_113196421 | 3300012923 | Vadose Zone Soil | RNALTTLEATQVEPGSYDRKVYAPGIGIALEEAITGTPERAELVSVTGP* |
| Ga0137404_107458581 | 3300012929 | Vadose Zone Soil | PGAYDEKIYGPGIGIVIERSLTGPSEYAQLVSVSG* |
| Ga0137410_110815102 | 3300012944 | Vadose Zone Soil | LEATRIEPGAYDQKIYAPGIGIVLEQSLTGPTEIAQLVSVTGP* |
| Ga0137410_116951841 | 3300012944 | Vadose Zone Soil | LVTLEATRIEPGAYDQKIYAPGIGIVLEQALTGGPETAVLVSISGP* |
| Ga0164298_108332751 | 3300012955 | Soil | TRVEPGSYDEKVYGPGIGIVREQALTGTSEFAQLVSVSG* |
| Ga0163162_129597012 | 3300013306 | Switchgrass Rhizosphere | IEPGAYDEKVYGPGIGIVSEHALTGDHEVARLVSVSG* |
| Ga0137409_109476773 | 3300015245 | Vadose Zone Soil | TQVEPGSYDRKVYAPGIGIVLELALTGTPESAQLVSVTGP* |
| Ga0134072_101497682 | 3300015357 | Grasslands Soil | KLKNVLTTLEATQLEPGAYDQKVYAPGIGIVREQALTGAAEFAELVSVSG* |
| Ga0134085_103576002 | 3300015359 | Grasslands Soil | RLEPGAYDLKVYAPGIGIAREQALTGTPEFAELVSVTG* |
| Ga0132257_1006760271 | 3300015373 | Arabidopsis Rhizosphere | HVLTTLESTRIEPGGYDEKVYGPGIGIVSEHALTGDHEVARLVSVSG* |
| Ga0184638_12958521 | 3300018052 | Groundwater Sediment | TTLEATRIEAGAYDEKVYGPGIGIVSEQSLTGPNEFAQLVSVSG |
| Ga0184618_103960711 | 3300018071 | Groundwater Sediment | IEPGAYDEKVYGPGIGIVSERALTGTSEVAQLVSVTG |
| Ga0184625_101463221 | 3300018081 | Groundwater Sediment | VRDVLSTLEATRIEPGAYDEKVYGPGIGIVREQALTGTSEFAQLVSVTG |
| Ga0066662_113456261 | 3300018468 | Grasslands Soil | VEPGSYDEKVYSPGIGIVREQALTGTSEFAQLVSVTG |
| Ga0190270_112017323 | 3300018469 | Soil | IEPGAFDEKVYGPGIGIVSERALSGDNEVAQLVSVSA |
| Ga0066669_119301402 | 3300018482 | Grasslands Soil | VEMRDGKVYAPGVGIVREQALTGETEVAELVSVTG |
| Ga0210380_105918882 | 3300021082 | Groundwater Sediment | VQHVLTTLESTRIEPGAYDEKVYGPGIGIVSEHALTGDNEVAKLVSVSR |
| Ga0193699_102982333 | 3300021363 | Soil | LEATQLEPGAYDEKVYGLGIGIVTEKSLAGPNEFAELVSVSG |
| Ga0222623_102784432 | 3300022694 | Groundwater Sediment | VRSVLTTLEATQIEPGAYDEKVYGPGVGIVSEQSLTGPNEFAQLVSVTG |
| Ga0222623_103352152 | 3300022694 | Groundwater Sediment | VQHVLSTLESTRIEPGAYDEKVYGPGIGIVSERALTGTSEVAQLVSVTG |
| Ga0222622_100364261 | 3300022756 | Groundwater Sediment | LEVTRIEPGAYDEKVYGPGIGIVREQALTGTSEFAQLVSVTG |
| Ga0207652_105474972 | 3300025921 | Corn Rhizosphere | GKVRNVLTSLEATRVEPGSYDEKVYGPGIGIVRERALTGTSEFAQLVSVTG |
| Ga0207646_100633112 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | VPYGTLKNVLTTLEATRLVPGAYDQKIYAPGIGIVREQALTGAQELAELVSISG |
| Ga0207646_106907582 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | EATRVEPGSYDEKVYGPGIGIVREQALTGTSEFAQLVSVSG |
| Ga0207709_112703811 | 3300025935 | Miscanthus Rhizosphere | LTSLEATRVEPGSYDEKVYGPGIGIVRERALTGTSEFAQLVSVTG |
| Ga0207641_123235741 | 3300026088 | Switchgrass Rhizosphere | TIHHKLSTLEATRIEPGAYDLKVYGPGLGIVLERALSGPPEVARLVRVIEP |
| Ga0209239_11741272 | 3300026310 | Grasslands Soil | TRLEPGAYDLKVYAPGIGIAREQALSGTPEFAELVSVTG |
| Ga0209154_13197372 | 3300026317 | Soil | IEPGAYDRKIYAPGIGMVREEALTGAPENAELVSVSG |
| Ga0209804_12849902 | 3300026335 | Soil | TSLEATRIEPGAYDRKIYAPGIGMVREEALTGAPENAELVSVSG |
| Ga0268265_114678442 | 3300028380 | Switchgrass Rhizosphere | STRVEPGAYDEKIYGLGIGIVRERALTGTSEFAQLVSVSG |
| Ga0137415_103530522 | 3300028536 | Vadose Zone Soil | VRFRTREIEPGLYDLKIYAPGIGIVLEQSLTGPTEIARLVSVTGP |
| Ga0307295_101727831 | 3300028708 | Soil | LEATRLEPGAYDQKIYAPGIGIVREQALTGAPEVAELVSING |
| Ga0307282_105504972 | 3300028784 | Soil | GRVRNVLTTLEATRLEPGAYDQKVYGPGIGIVLEQSLTGDPEVAKLESVSGP |
| Ga0307305_101293191 | 3300028807 | Soil | TVRNVLTTLEATQVEPDVYDQKIYGPGIGIVVEQSLTGPNEYAKLVSVTG |
| Ga0307312_105397512 | 3300028828 | Soil | TRLEAGAYDQKVYAPGIGIVREQALTGTPEFAELVSVSG |
| Ga0310813_123546162 | 3300031716 | Soil | TTLESTRIEPGAYDEKVYGPGIGIVSEHALTGDNEVARLVSVSG |
| Ga0307471_1038240711 | 3300032180 | Hardwood Forest Soil | IEAGAYDEKIYGPGIGIVSERSLTGPAEFAQLVSVSG |
| Ga0310810_108484701 | 3300033412 | Soil | TRIEPGAYDQKIYAPGIGIALEKSLTGPTEIAQLVSVTGP |
| ⦗Top⦘ |