NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F096083

Metagenome Family F096083

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F096083
Family Type Metagenome
Number of Sequences 105
Average Sequence Length 43 residues
Representative Sequence LEVTRIEPGAYDEKVYGPGIGIVREQALTGTSEFAQLVSVTG
Number of Associated Samples 88
Number of Associated Scaffolds 105

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 4.95 %
% of genes near scaffold ends (potentially truncated) 88.57 %
% of genes from short scaffolds (< 2000 bps) 91.43 %
Associated GOLD sequencing projects 83
AlphaFold2 3D model prediction Yes
3D model pTM-score0.57

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (77.143 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere
(16.191 % of family members)
Environment Ontology (ENVO) Unclassified
(24.762 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(44.762 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 0.00%    β-sheet: 34.29%    Coil/Unstructured: 65.71%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.57
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 105 Family Scaffolds
PF02518HATPase_c 6.67
PF13581HATPase_c_2 4.76
PF00582Usp 2.86
PF00583Acetyltransf_1 2.86
PF04343DUF488 1.90
PF00211Guanylate_cyc 1.90
PF00005ABC_tran 1.90
PF01987AIM24 1.90
PF01728FtsJ 1.90
PF00072Response_reg 0.95
PF00106adh_short 0.95
PF00756Esterase 0.95
PF00497SBP_bac_3 0.95
PF07907YibE_F 0.95
PF06441EHN 0.95
PF09334tRNA-synt_1g 0.95
PF13462Thioredoxin_4 0.95
PF00282Pyridoxal_deC 0.95
PF00578AhpC-TSA 0.95
PF07681DoxX 0.95
PF13701DDE_Tnp_1_4 0.95
PF03176MMPL 0.95
PF02142MGS 0.95
PF01957NfeD 0.95
PF07969Amidohydro_3 0.95
PF04828GFA 0.95
PF00990GGDEF 0.95
PF06559DCD 0.95
PF00685Sulfotransfer_1 0.95
PF12704MacB_PCD 0.95
PF13487HD_5 0.95
PF01548DEDD_Tnp_IS110 0.95
PF11617Cu-binding_MopE 0.95
PF10604Polyketide_cyc2 0.95
PF00326Peptidase_S9 0.95
PF001982-oxoacid_dh 0.95
PF07040DUF1326 0.95

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 105 Family Scaffolds
COG029323S rRNA U2552 (ribose-2'-O)-methylase RlmE/FtsJTranslation, ribosomal structure and biogenesis [J] 1.90
COG1189Predicted rRNA methylase YqxC, contains S4 and FtsJ domainsTranslation, ribosomal structure and biogenesis [J] 1.90
COG2013AIM24 protein, required for mitochondrial respirationEnergy production and conversion [C] 1.90
COG2114Adenylate cyclase, class 3Signal transduction mechanisms [T] 1.90
COG3189Uncharacterized conserved protein YeaO, DUF488 familyFunction unknown [S] 1.90
COG0018Arginyl-tRNA synthetaseTranslation, ribosomal structure and biogenesis [J] 0.95
COG0060Isoleucyl-tRNA synthetaseTranslation, ribosomal structure and biogenesis [J] 0.95
COG0076Glutamate or tyrosine decarboxylase or a related PLP-dependent proteinAmino acid transport and metabolism [E] 0.95
COG0143Methionyl-tRNA synthetaseTranslation, ribosomal structure and biogenesis [J] 0.95
COG0215Cysteinyl-tRNA synthetaseTranslation, ribosomal structure and biogenesis [J] 0.95
COG0495Leucyl-tRNA synthetaseTranslation, ribosomal structure and biogenesis [J] 0.95
COG0508Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide acyltransferase (E2) componentEnergy production and conversion [C] 0.95
COG0525Valyl-tRNA synthetaseTranslation, ribosomal structure and biogenesis [J] 0.95
COG05962-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase MenH and related esterases, alpha/beta hydrolase foldCoenzyme transport and metabolism [H] 0.95
COG0717dCTP deaminaseNucleotide transport and metabolism [F] 0.95
COG1033Predicted exporter protein, RND superfamilyGeneral function prediction only [R] 0.95
COG2259Uncharacterized membrane protein YphA, DoxX/SURF4 familyFunction unknown [S] 0.95
COG2409Predicted lipid transporter YdfJ, MMPL/SSD domain, RND superfamilyGeneral function prediction only [R] 0.95
COG3547TransposaseMobilome: prophages, transposons [X] 0.95
COG3791Uncharacterized conserved proteinFunction unknown [S] 0.95
COG4270Uncharacterized membrane proteinFunction unknown [S] 0.95
COG5438Uncharacterized membrane proteinFunction unknown [S] 0.95
COG5588Uncharacterized conserved protein, DUF1326 domainFunction unknown [S] 0.95

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms77.14 %
UnclassifiedrootN/A22.86 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2170459002|FZY7DQ102H6398All Organisms → cellular organisms → Bacteria505Open in IMG/M
3300000956|JGI10216J12902_126376546All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria651Open in IMG/M
3300001431|F14TB_100540290Not Available532Open in IMG/M
3300005172|Ga0066683_10670080All Organisms → cellular organisms → Bacteria619Open in IMG/M
3300005177|Ga0066690_10567367All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia759Open in IMG/M
3300005180|Ga0066685_10077395All Organisms → cellular organisms → Bacteria → Proteobacteria2189Open in IMG/M
3300005181|Ga0066678_10494000All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia814Open in IMG/M
3300005187|Ga0066675_11169845All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria572Open in IMG/M
3300005436|Ga0070713_101988837All Organisms → cellular organisms → Bacteria564Open in IMG/M
3300005437|Ga0070710_10217596All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1214Open in IMG/M
3300005440|Ga0070705_101570851All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria553Open in IMG/M
3300005450|Ga0066682_10276885All Organisms → cellular organisms → Bacteria1082Open in IMG/M
3300005546|Ga0070696_100170299All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1609Open in IMG/M
3300005549|Ga0070704_100019752All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia4335Open in IMG/M
3300005554|Ga0066661_10246909All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1105Open in IMG/M
3300005560|Ga0066670_10974753All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia517Open in IMG/M
3300005561|Ga0066699_10993049All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia582Open in IMG/M
3300005569|Ga0066705_10550177All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia716Open in IMG/M
3300005713|Ga0066905_100692084All Organisms → cellular organisms → Bacteria874Open in IMG/M
3300005764|Ga0066903_101087939All Organisms → cellular organisms → Bacteria1472Open in IMG/M
3300005764|Ga0066903_103668539All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria826Open in IMG/M
3300005764|Ga0066903_106812361All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia594Open in IMG/M
3300005764|Ga0066903_108552699Not Available521Open in IMG/M
3300006032|Ga0066696_11066515All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia514Open in IMG/M
3300006058|Ga0075432_10338175All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia635Open in IMG/M
3300006163|Ga0070715_10911929All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria542Open in IMG/M
3300006194|Ga0075427_10019970All Organisms → cellular organisms → Bacteria1059Open in IMG/M
3300006804|Ga0079221_10272429All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales976Open in IMG/M
3300006847|Ga0075431_101114930All Organisms → cellular organisms → Bacteria753Open in IMG/M
3300006847|Ga0075431_101908755Not Available549Open in IMG/M
3300006852|Ga0075433_10753044All Organisms → cellular organisms → Bacteria852Open in IMG/M
3300006852|Ga0075433_10799245All Organisms → cellular organisms → Bacteria824Open in IMG/M
3300006852|Ga0075433_11709838All Organisms → cellular organisms → Bacteria542Open in IMG/M
3300006854|Ga0075425_102086114All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia633Open in IMG/M
3300006904|Ga0075424_100990099All Organisms → cellular organisms → Bacteria896Open in IMG/M
3300006914|Ga0075436_100477448All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia910Open in IMG/M
3300007255|Ga0099791_10587900All Organisms → cellular organisms → Bacteria544Open in IMG/M
3300009012|Ga0066710_101239519All Organisms → cellular organisms → Bacteria1156Open in IMG/M
3300009094|Ga0111539_10528450All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi1374Open in IMG/M
3300009137|Ga0066709_101179449All Organisms → cellular organisms → Bacteria → Terrabacteria group1127Open in IMG/M
3300009137|Ga0066709_101419910All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales1008Open in IMG/M
3300009137|Ga0066709_101559464All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria949Open in IMG/M
3300009147|Ga0114129_11329408Not Available890Open in IMG/M
3300009147|Ga0114129_12061159Not Available689Open in IMG/M
3300009156|Ga0111538_11739253All Organisms → cellular organisms → Bacteria785Open in IMG/M
3300009162|Ga0075423_10333497All Organisms → cellular organisms → Bacteria1590Open in IMG/M
3300009162|Ga0075423_11913322Not Available641Open in IMG/M
3300009162|Ga0075423_12702865All Organisms → cellular organisms → Bacteria543Open in IMG/M
3300009792|Ga0126374_10985033Not Available660Open in IMG/M
3300010043|Ga0126380_10898106All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → unclassified Myxococcales → Myxococcales bacterium736Open in IMG/M
3300010046|Ga0126384_10297166All Organisms → cellular organisms → Bacteria1326Open in IMG/M
3300010304|Ga0134088_10545612All Organisms → cellular organisms → Bacteria574Open in IMG/M
3300010337|Ga0134062_10279857All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium784Open in IMG/M
3300010337|Ga0134062_10296265All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium765Open in IMG/M
3300010360|Ga0126372_12356474Not Available582Open in IMG/M
3300010360|Ga0126372_12789989All Organisms → cellular organisms → Bacteria → Proteobacteria540Open in IMG/M
3300010362|Ga0126377_12668387Not Available575Open in IMG/M
3300010373|Ga0134128_10347235All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Patulibacteraceae → Patulibacter → Patulibacter americanus1658Open in IMG/M
3300010400|Ga0134122_10848792All Organisms → cellular organisms → Bacteria877Open in IMG/M
3300011119|Ga0105246_10274995Not Available1348Open in IMG/M
3300012198|Ga0137364_10094650All Organisms → cellular organisms → Bacteria2092Open in IMG/M
3300012207|Ga0137381_10423482All Organisms → cellular organisms → Bacteria1162Open in IMG/M
3300012208|Ga0137376_10023481All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia4776Open in IMG/M
3300012208|Ga0137376_10774634All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium826Open in IMG/M
3300012350|Ga0137372_10278956All Organisms → cellular organisms → Bacteria1303Open in IMG/M
3300012355|Ga0137369_10872705All Organisms → cellular organisms → Bacteria607Open in IMG/M
3300012923|Ga0137359_11319642Not Available610Open in IMG/M
3300012929|Ga0137404_10745858All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium887Open in IMG/M
3300012944|Ga0137410_11081510All Organisms → cellular organisms → Bacteria686Open in IMG/M
3300012944|Ga0137410_11695184All Organisms → cellular organisms → Bacteria556Open in IMG/M
3300012955|Ga0164298_10833275All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium663Open in IMG/M
3300013306|Ga0163162_12959701Not Available546Open in IMG/M
3300015245|Ga0137409_10947677Not Available697Open in IMG/M
3300015357|Ga0134072_10149768All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium767Open in IMG/M
3300015359|Ga0134085_10357600All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria650Open in IMG/M
3300015373|Ga0132257_100676027All Organisms → cellular organisms → Bacteria → Terrabacteria group1281Open in IMG/M
3300018052|Ga0184638_1295852All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium548Open in IMG/M
3300018071|Ga0184618_10396071Not Available585Open in IMG/M
3300018081|Ga0184625_10146322All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1234Open in IMG/M
3300018468|Ga0066662_11345626All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium735Open in IMG/M
3300018469|Ga0190270_11201732All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria796Open in IMG/M
3300018482|Ga0066669_11930140All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium550Open in IMG/M
3300021082|Ga0210380_10591888Not Available509Open in IMG/M
3300021363|Ga0193699_10298233All Organisms → cellular organisms → Bacteria672Open in IMG/M
3300022694|Ga0222623_10278443All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium643Open in IMG/M
3300022694|Ga0222623_10335215Not Available579Open in IMG/M
3300022756|Ga0222622_10036426All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2670Open in IMG/M
3300025922|Ga0207646_10690758All Organisms → cellular organisms → Bacteria913Open in IMG/M
3300025935|Ga0207709_11270381All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium608Open in IMG/M
3300026088|Ga0207641_12323574All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi536Open in IMG/M
3300026310|Ga0209239_1174127All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium820Open in IMG/M
3300026317|Ga0209154_1319737Not Available509Open in IMG/M
3300026335|Ga0209804_1284990All Organisms → cellular organisms → Bacteria572Open in IMG/M
3300028380|Ga0268265_11467844Not Available685Open in IMG/M
3300028536|Ga0137415_10353052Not Available1274Open in IMG/M
3300028708|Ga0307295_10172783All Organisms → cellular organisms → Bacteria606Open in IMG/M
3300028784|Ga0307282_10550497All Organisms → cellular organisms → Bacteria560Open in IMG/M
3300028828|Ga0307312_10539751All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium771Open in IMG/M
3300031716|Ga0310813_12354616Not Available505Open in IMG/M
3300032180|Ga0307471_103824071All Organisms → cellular organisms → Bacteria532Open in IMG/M
3300033412|Ga0310810_10848470All Organisms → cellular organisms → Bacteria814Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere16.19%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil13.33%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil12.38%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil8.57%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere8.57%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil6.67%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil5.71%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil4.76%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil4.76%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment2.86%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment2.86%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil1.90%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere1.90%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.90%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment0.95%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil0.95%
Grass SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil0.95%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil0.95%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil0.95%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere0.95%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.95%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.95%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2170459002Grass soil microbial communities from Rothamsted Park, UK - March 2009 direct MP BIO 1O1 lysis 0-21 cmEnvironmentalOpen in IMG/M
3300000956Soil microbial communities from Great Prairies - Kansas, Native Prairie soilEnvironmentalOpen in IMG/M
3300001431Amended soil microbial communities from Kansas Great Prairies, USA - BrdU F1.4TB clc assemlyEnvironmentalOpen in IMG/M
3300005172Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132EnvironmentalOpen in IMG/M
3300005177Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139EnvironmentalOpen in IMG/M
3300005180Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134EnvironmentalOpen in IMG/M
3300005181Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127EnvironmentalOpen in IMG/M
3300005187Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124EnvironmentalOpen in IMG/M
3300005436Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaGEnvironmentalOpen in IMG/M
3300005437Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaGEnvironmentalOpen in IMG/M
3300005440Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaGEnvironmentalOpen in IMG/M
3300005450Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131EnvironmentalOpen in IMG/M
3300005468Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaGEnvironmentalOpen in IMG/M
3300005546Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaGEnvironmentalOpen in IMG/M
3300005549Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaGEnvironmentalOpen in IMG/M
3300005554Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110EnvironmentalOpen in IMG/M
3300005560Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119EnvironmentalOpen in IMG/M
3300005561Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148EnvironmentalOpen in IMG/M
3300005569Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154EnvironmentalOpen in IMG/M
3300005713Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2)EnvironmentalOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300006032Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145EnvironmentalOpen in IMG/M
3300006058Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1Host-AssociatedOpen in IMG/M
3300006163Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaGEnvironmentalOpen in IMG/M
3300006194Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1Host-AssociatedOpen in IMG/M
3300006804Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200EnvironmentalOpen in IMG/M
3300006847Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5Host-AssociatedOpen in IMG/M
3300006852Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2Host-AssociatedOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300006904Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3Host-AssociatedOpen in IMG/M
3300006914Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5Host-AssociatedOpen in IMG/M
3300007255Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1EnvironmentalOpen in IMG/M
3300009012Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159EnvironmentalOpen in IMG/M
3300009094Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300009147Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2)Host-AssociatedOpen in IMG/M
3300009156Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009162Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2Host-AssociatedOpen in IMG/M
3300009792Tropical forest soil microbial communities from Panama - MetaG Plot_12EnvironmentalOpen in IMG/M
3300010043Tropical forest soil microbial communities from Panama - MetaG Plot_26EnvironmentalOpen in IMG/M
3300010046Tropical forest soil microbial communities from Panama - MetaG Plot_36EnvironmentalOpen in IMG/M
3300010304Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09182015EnvironmentalOpen in IMG/M
3300010337Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015EnvironmentalOpen in IMG/M
3300010360Tropical forest soil microbial communities from Panama - MetaG Plot_6EnvironmentalOpen in IMG/M
3300010362Tropical forest soil microbial communities from Panama - MetaG Plot_22EnvironmentalOpen in IMG/M
3300010373Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4EnvironmentalOpen in IMG/M
3300010400Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2EnvironmentalOpen in IMG/M
3300011119Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaGHost-AssociatedOpen in IMG/M
3300012198Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012207Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaGEnvironmentalOpen in IMG/M
3300012208Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012350Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaGEnvironmentalOpen in IMG/M
3300012355Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaGEnvironmentalOpen in IMG/M
3300012923Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaGEnvironmentalOpen in IMG/M
3300012929Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012944Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012955Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MGEnvironmentalOpen in IMG/M
3300013306Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaGHost-AssociatedOpen in IMG/M
3300015245Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300015357Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_0_1 metaGEnvironmentalOpen in IMG/M
3300015359Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09182015EnvironmentalOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300018052Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b2EnvironmentalOpen in IMG/M
3300018071Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_b1EnvironmentalOpen in IMG/M
3300018081Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b1EnvironmentalOpen in IMG/M
3300018468Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111EnvironmentalOpen in IMG/M
3300018469Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 TEnvironmentalOpen in IMG/M
3300018482Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118EnvironmentalOpen in IMG/M
3300021082Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_coex redoEnvironmentalOpen in IMG/M
3300021363Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3c2EnvironmentalOpen in IMG/M
3300022694Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_coexEnvironmentalOpen in IMG/M
3300022756Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1EnvironmentalOpen in IMG/M
3300025921Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025922Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025935Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026088Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026310Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm (SPAdes)EnvironmentalOpen in IMG/M
3300026317Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 (SPAdes)EnvironmentalOpen in IMG/M
3300026335Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 (SPAdes)EnvironmentalOpen in IMG/M
3300028380Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300028536Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300028708Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_152EnvironmentalOpen in IMG/M
3300028784Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121EnvironmentalOpen in IMG/M
3300028807Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_186EnvironmentalOpen in IMG/M
3300028828Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202EnvironmentalOpen in IMG/M
3300031716Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300033412Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NCEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
E1_035965902170459002Grass SoilTSLEATRIEPGLYDKKVYAAGIGIVLEVAVTGPTEIAQLVSMSG
JGI10216J12902_12637654613300000956SoilMLEATRIEPGAYDQKVYAPGIGIVQEKALTGTPEFAELVSVSG*
F14TB_10054029013300001431SoilLESTRIEPGAYDEKVYGPGIGIVSEHALTGDNEVAQLVSVSG*
Ga0066683_1067008013300005172SoilLRNTLTTLEATRVEPGLYDQKIYAPGIGMVLEQALTGPTEFAKLVSVTGP*
Ga0066690_1056736723300005177SoilTSLEATRIEPGAYDRKIYAPGIGMVREEALTGAPENAELVSVSG*
Ga0066685_1007739553300005180SoilLRNTLTTLEATRVEPGLYDQKIYAPGIGLVLEQALTGPTEFAKLVSVTGP*
Ga0066678_1049400023300005181SoilATRLEPGAYDQKVYAPGIGIAREQALTGAPEFAELVSVTG*
Ga0066675_1116984523300005187SoilLEATRLEPGAYDQKVYAPGIGIAREQALTGASEFAELVSVTG*
Ga0070713_10198883713300005436Corn, Switchgrass And Miscanthus RhizosphereNALTTLEATRLEPGAYDQKVYAPGLGIVREQALSGAPEFAELVSVTG*
Ga0070710_1021759613300005437Corn, Switchgrass And Miscanthus RhizosphereTRLEPGAYDQKVYAPGLGIVREQALTGAPEFAELVSVTG*
Ga0070705_10157085113300005440Corn, Switchgrass And Miscanthus RhizosphereNVLTSLEATRVEPGSYDKKVYGPGIGIVREQALTGTSEFAQLVSVSG*
Ga0066682_1027688513300005450SoilLRNTLTTLEATRIEPGLYDQKIYAPGVGLVVEQALTGPTEFAKLVRVTGP*
Ga0070707_10011287433300005468Corn, Switchgrass And Miscanthus RhizosphereVPYGTLKNVLTTLEATRLVPGAYDQKIYAPGIGIVREQALTGAQELAELVSISG*
Ga0070696_10017029933300005546Corn, Switchgrass And Miscanthus RhizosphereALTTLEATRLEPGAYDQKVYAPGLGIVREQALSGAPEFAELVSVTG*
Ga0070704_10001975263300005549Corn, Switchgrass And Miscanthus RhizosphereTRVEAGAYDEKVYGPGIGIVSERSLTGPAEVAQLVSVSG*
Ga0066661_1024690913300005554SoilVEPGIYDQKIYGPGLGIVVEQSLTGPTEYAKLVSVSG*
Ga0066670_1097475313300005560SoilFRHILVSLEFTRLEPRVIDQKIYAPGIGIVQEKALTGAPEFAELVSVSG*
Ga0066699_1099304913300005561SoilEPGAFDKKVYGPGIGIVLERALSGPPEVARLVSVQG*
Ga0066705_1055017723300005569SoilLEATRIEPGAYDRKVYAPGVGMIREEALTGATEYAELVGVSG*
Ga0066905_10069208433300005713Tropical Forest SoilEPGAYDEKVYGPGIGIVSERSLTGPMEFAQLVSMNG*
Ga0066903_10108793923300005764Tropical Forest SoilLTTLEATQIEAGAYDEKIYGPGIGIVSERSLTGSNEVAQLVSVSP*
Ga0066903_10366853923300005764Tropical Forest SoilVPDGTFKNVLTSLEATRIEPGAYDRKVYAPGIGMIREEALTGSPEFAELVSVGG*
Ga0066903_10681236123300005764Tropical Forest SoilTLEATRIEPGAYDRKVYAPGIGIVREQALTGAPETAELVSVTG*
Ga0066903_10855269923300005764Tropical Forest SoilTLESTRLEPGAYDEKIYGPGIGIVSERSLTGPNELAQLVSVSG*
Ga0066696_1106651523300006032SoilLTSLEATRIEPGAYDRKVYAPGVGMIREEALTGATEYAELVGVSG*
Ga0075432_1033817523300006058Populus RhizosphereLKNALTTLEATRLEPGAYDQKVYAAGLGIVREQALSGAPEFAELVSVTG*
Ga0070715_1091192923300006163Corn, Switchgrass And Miscanthus RhizosphereNALTTLEATRLEPGAYDQKVYAPGLGIVREQALSGAPEFAELVSVIG*
Ga0075427_1001997023300006194Populus RhizosphereHHVLTSLESTRVEPGAYDEKIYGLGIGIVRERALTGTSEFAQLVSVSG*
Ga0079221_1027242913300006804Agricultural SoilATRLEPGAYDQKVYAPGLGIVREQALSGAPEFAELVSVTG*
Ga0075431_10111493023300006847Populus RhizosphereVRNVLTTLEATRVEAGAYDEKVYGPGIGIVSERSLTGPAEFAQLVSVTG*
Ga0075431_10190875513300006847Populus RhizosphereVRNVLTTLEATRVEAGAYDEKVYGPGIGIVSERSLTGPAEVAQLVSVTG*
Ga0075433_1075304423300006852Populus RhizosphereKVRNVLTTLESTRLEPGGYDEKIYAPGIGIVSERSLTGNEVAQLVSVSG*
Ga0075433_1079924533300006852Populus RhizosphereLEATRIEPGAYDEKTYGPGIGIVSERSLTGPNEFAQLVSVSG*
Ga0075433_1170983813300006852Populus RhizosphereLTTLESTQLEPGAYDEKVYGPGIGIVSERSLTGPNELAQLVSVSR*
Ga0075425_10208611423300006854Populus RhizosphereEATRLEPGAYDQKVYGPGIGIVSEQSLTGPNEYATLVSVTG*
Ga0075424_10099009913300006904Populus RhizosphereLTTLESTRVEPGAYDEKIYGPGIGIVRERALTGTSEFAQLVSVSG*
Ga0075436_10047744823300006914Populus RhizosphereRIEPKVVDQKVYAPGIGIVFERALSGPPEIAKLVSVTG*
Ga0099791_1058790013300007255Vadose Zone SoilLEATRLEPGAYDQKAYAPGIGIVLEQSLTGANEFARLESVSGP*
Ga0066710_10123951923300009012Grasslands SoilVRGVLTTLEATRVEPGAYDQKIYGRGIGIVVEHALTGEPEIAKLVSMTG
Ga0111539_1052845043300009094Populus RhizosphereRIEPGAYDQKVYAPGIGIVSEQSLTGPNEFAQLVSVSG*
Ga0066709_10117944913300009137Grasslands SoilTSLEFARIEPGVVDQKIYGPGIGIVSETALTGPQEIAKLVSMTG*
Ga0066709_10141991013300009137Grasslands SoilTLEATQVEPGIYDQKIYGPGIVIVVEQSLTGPNEYAKLVSVTG*
Ga0066709_10155946413300009137Grasslands SoilRLEPGAYDQKVYAPGIGIAREQALIGAPEFAELVSVTG*
Ga0114129_1132940823300009147Populus RhizosphereEPGAYDQKVYGPGLGIVLEQALSGPPEVAKLVSISGP*
Ga0114129_1206115923300009147Populus RhizosphereAGAYDEKVYGPGIGIVSERSLTGPAEVAQLVSVTG*
Ga0111538_1173925313300009156Populus RhizosphereLEATAVEPGAYDQKVYGPGLGIVLEQALSGPPEVAKLVSVSGP*
Ga0075423_1033349713300009162Populus RhizosphereEPGAYDEKIYAPGIGIVSERSLTGSNEFAQLVSASN*
Ga0075423_1191332223300009162Populus RhizosphereGAYDEKVYGPGIGIVSERSLTGPAEVAQLVSVTG*
Ga0075423_1270286513300009162Populus RhizosphereEPGSYDLKIYAPGIGIVLEQSLSGPNETAKLVSITGP*
Ga0126374_1098503313300009792Tropical Forest SoilEPGAYDEKVYGPGIGIVTEKALTGPAEFAQLVSVSP*
Ga0126380_1089810623300010043Tropical Forest SoilLRNVLTTLEATQLEPGSYDEKVYGLGIGIVSERSLTGPSEVAQLVSVSG*
Ga0126384_1029716613300010046Tropical Forest SoilKVRNVLTTLEATRIEPGAYDEKIYGPGIGIVSERSLTGSNEVAQLVSVSQ*
Ga0134088_1054561213300010304Grasslands SoilLYDQKIYARGVGIVLEQSLTGPTEIAKLVSVSGP*
Ga0134062_1027985733300010337Grasslands SoilTLEATRLEPGAYDQKVYAPGIGIAREQALTGTPEFAELVSVNG*
Ga0134062_1029626513300010337Grasslands SoilRLKNVLTTLEATQLEPGAYDQKVYAPGLGIVREQALTGAAEFAELVSVSG*
Ga0126372_1235647413300010360Tropical Forest SoilTLESTQLEAGAYDEKVYGPGIGIVSERALTGEPETAQLVSVSG*
Ga0126372_1278998913300010360Tropical Forest SoilTLESTRLEPGAYDEKVYGPGIGIVSERALTGPTETAQLVSISG*
Ga0126377_1266838723300010362Tropical Forest SoilESTRLEPGAYDEKVYGPGIGIVSERSLTGPTEYALLVSVSG*
Ga0134128_1034723533300010373Terrestrial SoilEATRLEPGAYDQKVYAPGLGIVREQALSGAPEFAELVSVTG*
Ga0134122_1084879213300010400Terrestrial SoilTRIEPGAYDEKVYGTGIGIVSERALTGDTEVAQLVSVSG*
Ga0105246_1027499513300011119Miscanthus RhizosphereGAYDEKVYGPGIGIVSEHALTGDNEVAKLVSVSG*
Ga0137364_1009465013300012198Vadose Zone SoilVEPGIYDQKIYGPGIGIVVEQSLTGPNEYAKLVSVTG*
Ga0137381_1042348213300012207Vadose Zone SoilLEAARIEPGHYDLKIYAPGIGIVLEQALTGPTETAQLVSVTGP*
Ga0137376_1002348113300012208Vadose Zone SoilGAYDHKVYAPGVGMIREEALTGATEYAELVSVSG*
Ga0137376_1077463423300012208Vadose Zone SoilEAGAYDQKVYAPGIGIVREQALTGAPEFAELVSVSG*
Ga0137372_1027895613300012350Vadose Zone SoilRLEPGAYDQKVYAPGIGIAREQALTGEPEFAELVSVTG*
Ga0137369_1087270533300012355Vadose Zone SoilNVLTTLEATQIEPGAYDQKVYGPGIGIVSEQSLTGPNEVAQLVSVTG*
Ga0137359_1131964213300012923Vadose Zone SoilRNALTTLEATQVEPGSYDRKVYAPGIGIALEEAITGTPERAELVSVTGP*
Ga0137404_1074585813300012929Vadose Zone SoilPGAYDEKIYGPGIGIVIERSLTGPSEYAQLVSVSG*
Ga0137410_1108151023300012944Vadose Zone SoilLEATRIEPGAYDQKIYAPGIGIVLEQSLTGPTEIAQLVSVTGP*
Ga0137410_1169518413300012944Vadose Zone SoilLVTLEATRIEPGAYDQKIYAPGIGIVLEQALTGGPETAVLVSISGP*
Ga0164298_1083327513300012955SoilTRVEPGSYDEKVYGPGIGIVREQALTGTSEFAQLVSVSG*
Ga0163162_1295970123300013306Switchgrass RhizosphereIEPGAYDEKVYGPGIGIVSEHALTGDHEVARLVSVSG*
Ga0137409_1094767733300015245Vadose Zone SoilTQVEPGSYDRKVYAPGIGIVLELALTGTPESAQLVSVTGP*
Ga0134072_1014976823300015357Grasslands SoilKLKNVLTTLEATQLEPGAYDQKVYAPGIGIVREQALTGAAEFAELVSVSG*
Ga0134085_1035760023300015359Grasslands SoilRLEPGAYDLKVYAPGIGIAREQALTGTPEFAELVSVTG*
Ga0132257_10067602713300015373Arabidopsis RhizosphereHVLTTLESTRIEPGGYDEKVYGPGIGIVSEHALTGDHEVARLVSVSG*
Ga0184638_129585213300018052Groundwater SedimentTTLEATRIEAGAYDEKVYGPGIGIVSEQSLTGPNEFAQLVSVSG
Ga0184618_1039607113300018071Groundwater SedimentIEPGAYDEKVYGPGIGIVSERALTGTSEVAQLVSVTG
Ga0184625_1014632213300018081Groundwater SedimentVRDVLSTLEATRIEPGAYDEKVYGPGIGIVREQALTGTSEFAQLVSVTG
Ga0066662_1134562613300018468Grasslands SoilVEPGSYDEKVYSPGIGIVREQALTGTSEFAQLVSVTG
Ga0190270_1120173233300018469SoilIEPGAFDEKVYGPGIGIVSERALSGDNEVAQLVSVSA
Ga0066669_1193014023300018482Grasslands SoilVEMRDGKVYAPGVGIVREQALTGETEVAELVSVTG
Ga0210380_1059188823300021082Groundwater SedimentVQHVLTTLESTRIEPGAYDEKVYGPGIGIVSEHALTGDNEVAKLVSVSR
Ga0193699_1029823333300021363SoilLEATQLEPGAYDEKVYGLGIGIVTEKSLAGPNEFAELVSVSG
Ga0222623_1027844323300022694Groundwater SedimentVRSVLTTLEATQIEPGAYDEKVYGPGVGIVSEQSLTGPNEFAQLVSVTG
Ga0222623_1033521523300022694Groundwater SedimentVQHVLSTLESTRIEPGAYDEKVYGPGIGIVSERALTGTSEVAQLVSVTG
Ga0222622_1003642613300022756Groundwater SedimentLEVTRIEPGAYDEKVYGPGIGIVREQALTGTSEFAQLVSVTG
Ga0207652_1054749723300025921Corn RhizosphereGKVRNVLTSLEATRVEPGSYDEKVYGPGIGIVRERALTGTSEFAQLVSVTG
Ga0207646_1006331123300025922Corn, Switchgrass And Miscanthus RhizosphereVPYGTLKNVLTTLEATRLVPGAYDQKIYAPGIGIVREQALTGAQELAELVSISG
Ga0207646_1069075823300025922Corn, Switchgrass And Miscanthus RhizosphereEATRVEPGSYDEKVYGPGIGIVREQALTGTSEFAQLVSVSG
Ga0207709_1127038113300025935Miscanthus RhizosphereLTSLEATRVEPGSYDEKVYGPGIGIVRERALTGTSEFAQLVSVTG
Ga0207641_1232357413300026088Switchgrass RhizosphereTIHHKLSTLEATRIEPGAYDLKVYGPGLGIVLERALSGPPEVARLVRVIEP
Ga0209239_117412723300026310Grasslands SoilTRLEPGAYDLKVYAPGIGIAREQALSGTPEFAELVSVTG
Ga0209154_131973723300026317SoilIEPGAYDRKIYAPGIGMVREEALTGAPENAELVSVSG
Ga0209804_128499023300026335SoilTSLEATRIEPGAYDRKIYAPGIGMVREEALTGAPENAELVSVSG
Ga0268265_1146784423300028380Switchgrass RhizosphereSTRVEPGAYDEKIYGLGIGIVRERALTGTSEFAQLVSVSG
Ga0137415_1035305223300028536Vadose Zone SoilVRFRTREIEPGLYDLKIYAPGIGIVLEQSLTGPTEIARLVSVTGP
Ga0307295_1017278313300028708SoilLEATRLEPGAYDQKIYAPGIGIVREQALTGAPEVAELVSING
Ga0307282_1055049723300028784SoilGRVRNVLTTLEATRLEPGAYDQKVYGPGIGIVLEQSLTGDPEVAKLESVSGP
Ga0307305_1012931913300028807SoilTVRNVLTTLEATQVEPDVYDQKIYGPGIGIVVEQSLTGPNEYAKLVSVTG
Ga0307312_1053975123300028828SoilTRLEAGAYDQKVYAPGIGIVREQALTGTPEFAELVSVSG
Ga0310813_1235461623300031716SoilTTLESTRIEPGAYDEKVYGPGIGIVSEHALTGDNEVARLVSVSG
Ga0307471_10382407113300032180Hardwood Forest SoilIEAGAYDEKIYGPGIGIVSERSLTGPAEFAQLVSVSG
Ga0310810_1084847013300033412SoilTRIEPGAYDQKIYAPGIGIALEKSLTGPTEIAQLVSVTGP

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.