| Basic Information | |
|---|---|
| Family ID | F096044 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 105 |
| Average Sequence Length | 40 residues |
| Representative Sequence | QQREAGTELKESFKNVTQMGHNGTWTFKFSSPFYMWLLENLY |
| Number of Associated Samples | 97 |
| Number of Associated Scaffolds | 105 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 98.10 % |
| % of genes from short scaffolds (< 2000 bps) | 91.43 % |
| Associated GOLD sequencing projects | 91 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.20 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (83.810 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine (22.857 % of family members) |
| Environment Ontology (ENVO) | Unclassified (70.476 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (81.905 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 18.57% β-sheet: 0.00% Coil/Unstructured: 81.43% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.20 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 105 Family Scaffolds |
|---|---|---|
| PF01467 | CTP_transf_like | 24.76 |
| PF06941 | NT5C | 8.57 |
| PF00080 | Sod_Cu | 1.90 |
| PF03358 | FMN_red | 0.95 |
| COG ID | Name | Functional Category | % Frequency in 105 Family Scaffolds |
|---|---|---|---|
| COG4502 | 5'(3')-deoxyribonucleotidase | Nucleotide transport and metabolism [F] | 8.57 |
| COG2032 | Cu/Zn superoxide dismutase | Inorganic ion transport and metabolism [P] | 1.90 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 83.81 % |
| All Organisms | root | All Organisms | 16.19 % |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 22.86% |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 12.38% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 11.43% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 8.57% |
| Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 8.57% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 3.81% |
| Pelagic Marine | Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine | 3.81% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Aphotic Zone → Marine | 2.86% |
| Seawater | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater | 2.86% |
| Pelagic Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine | 2.86% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 1.90% |
| Surface Seawater | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Surface Seawater | 1.90% |
| Seawater | Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater | 1.90% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 1.90% |
| Seawater | Environmental → Aquatic → Marine → Pelagic → Unclassified → Seawater | 1.90% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 0.95% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 0.95% |
| Meromictic Pond | Environmental → Aquatic → Freshwater → Pond → Unclassified → Meromictic Pond | 0.95% |
| Seawater | Environmental → Aquatic → Marine → Oceanic → Unclassified → Seawater | 0.95% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 0.95% |
| Marine Water | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine Water | 0.95% |
| Microbial Mat | Environmental → Aquatic → Marine → Coastal → Sediment → Microbial Mat | 0.95% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 0.95% |
| Marine | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine | 0.95% |
| Saline Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Water | 0.95% |
| Pond Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Pond Water | 0.95% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000173 | Marine microbial communities from expanding oxygen minimum zones in Line P, North Pacific Ocean - February 2010 P16 500m | Environmental | Open in IMG/M |
| 3300001344 | Pelagic Microbial community sample from North Sea - COGITO 998_met_02 | Environmental | Open in IMG/M |
| 3300001355 | Pelagic Microbial community sample from North Sea - COGITO 998_met_08 | Environmental | Open in IMG/M |
| 3300001450 | Marine viral communities from the Pacific Ocean - LP-53 | Environmental | Open in IMG/M |
| 3300001460 | Marine viral communities from the Pacific Ocean - LP-28 | Environmental | Open in IMG/M |
| 3300001935 | Marine microbial communities from Northern Gulf of Maine, Canada - GS007 | Environmental | Open in IMG/M |
| 3300001969 | Marine microbial communities from Yucatan Channel, Mexico - GS017 | Environmental | Open in IMG/M |
| 3300002484 | Marine viral communities from the Pacific Ocean - ETNP_2_130 | Environmental | Open in IMG/M |
| 3300005057 | Marine water microbial communities from the East Sea, Korea with extracellular vesicles - East-Sea-0.2um | Environmental | Open in IMG/M |
| 3300005520 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP2014F10-02SV251 | Environmental | Open in IMG/M |
| 3300006165 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG006-DNA | Environmental | Open in IMG/M |
| 3300006310 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT229_3_0500m | Environmental | Open in IMG/M |
| 3300006338 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT232_1_0770m | Environmental | Open in IMG/M |
| 3300006637 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006751 | Marine viral communities from the Subarctic Pacific Ocean - 7_ETSP_OMZ_AT15161 metaG | Environmental | Open in IMG/M |
| 3300006916 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 | Environmental | Open in IMG/M |
| 3300007234 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_<0.8_DNA | Environmental | Open in IMG/M |
| 3300009001 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_C_H2O_MG | Environmental | Open in IMG/M |
| 3300009152 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaG | Environmental | Open in IMG/M |
| 3300009183 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG | Environmental | Open in IMG/M |
| 3300009423 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100423 | Environmental | Open in IMG/M |
| 3300009512 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_88 | Environmental | Open in IMG/M |
| 3300009706 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_86 | Environmental | Open in IMG/M |
| 3300009785 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_130 | Environmental | Open in IMG/M |
| 3300009911 | Aquatic microbial communities from different depth of meromictic Siders Pond, Falmouth, Massachusetts; Cast 6, surface; RNA IDBA-UD | Environmental | Open in IMG/M |
| 3300010354 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNA | Environmental | Open in IMG/M |
| 3300010883 | western Arctic Ocean co-assembly | Environmental | Open in IMG/M |
| 3300012928 | Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St17 metaG | Environmental | Open in IMG/M |
| 3300012936 | Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St13 metaG | Environmental | Open in IMG/M |
| 3300012952 | Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Atlantic ANT 4 Metagenome | Environmental | Open in IMG/M |
| 3300016771 | Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 071412BT metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300017718 | Marine viral communities from the Subarctic Pacific Ocean - Lowphox_11 viral metaG | Environmental | Open in IMG/M |
| 3300017723 | Freshwater viral communities from Lake Michigan, USA - Su13.ND.MM110.S.N | Environmental | Open in IMG/M |
| 3300017725 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 21 SPOT_SRF_2011-04-29 | Environmental | Open in IMG/M |
| 3300017731 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 39 SPOT_SRF_2013-01-16 | Environmental | Open in IMG/M |
| 3300017738 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 51 SPOT_SRF_2014-02-12 | Environmental | Open in IMG/M |
| 3300017749 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 15 SPOT_SRF_2010-09-15 | Environmental | Open in IMG/M |
| 3300017751 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 13 SPOT_SRF_2010-07-21 (version 2) | Environmental | Open in IMG/M |
| 3300017759 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 37 SPOT_SRF_2012-11-28 | Environmental | Open in IMG/M |
| 3300017771 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 48 SPOT_SRF_2013-11-13 | Environmental | Open in IMG/M |
| 3300017773 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 9 SPOT_SRF_2010-03-24 | Environmental | Open in IMG/M |
| 3300017779 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 18 SPOT_SRF_2010-12-16 | Environmental | Open in IMG/M |
| 3300017818 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101401AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017824 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011501BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017956 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071403BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017962 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071404AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300017985 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101412BT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018413 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011509CT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300018426 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101402AT metaG (megahit assembly) | Environmental | Open in IMG/M |
| 3300020185 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160517_1 | Environmental | Open in IMG/M |
| 3300020222 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015034 Kigoma Deep Cast 250m | Environmental | Open in IMG/M |
| 3300020343 | Marine microbial communities from Tara Oceans - TARA_B100000475 (ERX555975-ERR599174) | Environmental | Open in IMG/M |
| 3300020363 | Marine microbial communities from Tara Oceans - TARA_B000000475 (ERX555958-ERR599173) | Environmental | Open in IMG/M |
| 3300020367 | Marine microbial communities from Tara Oceans - TARA_B100000508 (ERX556112-ERR599005) | Environmental | Open in IMG/M |
| 3300020397 | Marine microbial communities from Tara Oceans - TARA_B100000123 (ERX556052-ERR599075) | Environmental | Open in IMG/M |
| 3300020416 | Marine microbial communities from Tara Oceans - TARA_B100001109 (ERX556137-ERR599039) | Environmental | Open in IMG/M |
| 3300020422 | Marine prokaryotic communities collected during Tara Oceans survey from station TARA_076 - TARA_B100000513 (ERX555999-ERR599126) | Environmental | Open in IMG/M |
| 3300020428 | Marine microbial communities from Tara Oceans - TARA_E500000331 (ERX556032-ERR599094) | Environmental | Open in IMG/M |
| 3300020436 | Marine microbial communities from Tara Oceans - TARA_B100000424 (ERX556009-ERR598984) | Environmental | Open in IMG/M |
| 3300020441 | Marine prokaryotic communities collected during Tara Oceans survey from station TARA_078 - TARA_B100000524 (ERX556088-ERR599006) | Environmental | Open in IMG/M |
| 3300020467 | Marine microbial communities from Tara Oceans - TARA_B100000945 (ERX555966-ERR598957) | Environmental | Open in IMG/M |
| 3300021364 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO304 | Environmental | Open in IMG/M |
| 3300021365 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160316_1 | Environmental | Open in IMG/M |
| 3300021959 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_13D | Environmental | Open in IMG/M |
| 3300021963 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657D | Environmental | Open in IMG/M |
| 3300022183 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 (v3) | Environmental | Open in IMG/M |
| 3300022198 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (v3) | Environmental | Open in IMG/M |
| 3300022867 | Saline water microbial communities from Ace Lake, Antarctica - #1 | Environmental | Open in IMG/M |
| 3300022928 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011513CT metaG | Environmental | Open in IMG/M |
| 3300022937 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071404AT metaG | Environmental | Open in IMG/M |
| 3300023105 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101408AT metaG | Environmental | Open in IMG/M |
| 3300024297 | Seawater microbial communities from Monterey Bay, California, United States - 71D | Environmental | Open in IMG/M |
| 3300025120 | Marine viral communities from the Pacific Ocean - LP-28 (SPAdes) | Environmental | Open in IMG/M |
| 3300025543 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025610 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025632 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100413 (SPAdes) | Environmental | Open in IMG/M |
| 3300025704 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120524 (SPAdes) | Environmental | Open in IMG/M |
| 3300025809 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110523 (SPAdes) | Environmental | Open in IMG/M |
| 3300025876 | Pelagic Microbial community sample from North Sea - COGITO 998_met_06 (SPAdes) | Environmental | Open in IMG/M |
| 3300025889 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 (SPAdes) | Environmental | Open in IMG/M |
| 3300026136 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201306PF45B (SPAdes) | Environmental | Open in IMG/M |
| 3300026204 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201306SV47 (SPAdes) | Environmental | Open in IMG/M |
| 3300027728 (restricted) | Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_14m | Environmental | Open in IMG/M |
| 3300027771 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG006-DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300027782 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027788 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_88 (SPAdes) | Environmental | Open in IMG/M |
| 3300027838 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_150 (SPAdes) | Environmental | Open in IMG/M |
| 3300027892 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300028192 | Marine microbial communities from Northeast Subartic Pacific Ocean, Canada - LP_J_2011_P26_500m | Environmental | Open in IMG/M |
| 3300031597 | Marine microbial communities from Western Arctic Ocean, Canada - AG5_SCM | Environmental | Open in IMG/M |
| 3300031605 | Marine microbial communities from Western Arctic Ocean, Canada - CB9_32.1 | Environmental | Open in IMG/M |
| 3300031621 | Marine microbial communities from Western Arctic Ocean, Canada - AG5_Surface | Environmental | Open in IMG/M |
| 3300031676 | Marine microbial communities from Western Arctic Ocean, Canada - CBN3_20m | Environmental | Open in IMG/M |
| 3300031774 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 60m 34915 | Environmental | Open in IMG/M |
| 3300032011 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 60m 3416 | Environmental | Open in IMG/M |
| 3300032277 | Microbial mat bacterial communities from mineral coupon in-situ incubated in ocean water Damariscotta River, Maine, United States - 3-month pyrrhotite | Environmental | Open in IMG/M |
| 3300032360 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 500m 34915 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| LPfeb10P16500mDRAFT_10204352 | 3300000173 | Marine | LPETLKNVTQMGHNGTWTFTFDSPFYMWLLENLY* |
| JGI20152J14361_101150462 | 3300001344 | Pelagic Marine | PWAARQRESGAELPEFFKNVTQLGHEGEWKFTFASPFYMWLLENLY* |
| JGI20158J14315_102346602 | 3300001355 | Pelagic Marine | RESGVELPESFKNVTKMGHDGEWIFTFASPFYMWLLENLY* |
| JGI24006J15134_100118688 | 3300001450 | Marine | SQQVTAGNTPEKSXKNVTSMGHNGTWKIQFQSPFYMWLLENLY* |
| JGI24006J15134_100815243 | 3300001450 | Marine | ELKESFKNVTQIGHNGTWRFKFSSPFYMWLLENLY* |
| JGI24003J15210_100382295 | 3300001460 | Marine | QQREAGNELLESFKMVTSMGHHGEWRLKFASPFYMWLLENLY* |
| JGI24003J15210_100822863 | 3300001460 | Marine | PWAARQRESGAELPESFKNVTQLGHEGEWKFTFASPFYMWLLENLY* |
| JGI24003J15210_101578522 | 3300001460 | Marine | QQKDANIELKKSFTNVTQMGFNGTWTFSFESPFYMWLLDNLY* |
| GOS2223_10213381 | 3300001935 | Marine | ELPESFTNVTSMGHNGKWRFKFESPFYMWLLENLY* |
| GOS2233_11099593 | 3300001969 | Marine | AGRTPVESYKNVTAMGHNGDWKWTFSSPFYMWLLENLY* |
| JGI25129J35166_10713973 | 3300002484 | Marine | TQQTEAGNKPPETLKNVTLMGHNGTWTFTFESPFYMWLLENLY* |
| Ga0068511_11001361 | 3300005057 | Marine Water | ANAGVELPKSFTNVTSMGHNGTWQLTFETPFYMWLLENLY* |
| Ga0066864_100168816 | 3300005520 | Marine | WASQQTEAGNKLPESYKNVTQMGHNGTWTFTFESPFYMWLLENLY* |
| Ga0075443_101739831 | 3300006165 | Marine | QQREAGTELKESFKNVTQMGHNGTWTFKFSSPFYMWLLENLY* |
| Ga0068471_13874543 | 3300006310 | Marine | AGNKLPETLKNVTKIGHNGTWTFTFESPFYIWLLENLY* |
| Ga0068482_15586971 | 3300006338 | Marine | EPWASEQIKKGIKLPESLKNSPDLGHNGVWTFTFESPFYMWLLEHLY* |
| Ga0075461_101555443 | 3300006637 | Aqueous | ATEQKTAGIELPTFIKNTTSLGHNGRWELEFSSPFYLWLLENLY* |
| Ga0098040_10748341 | 3300006751 | Marine | AGNKLPETLKNVTKIGHNGTWTFTFSSPFYIWLLENLY* |
| Ga0070750_100838911 | 3300006916 | Aqueous | IELRHSFKNVTQIGHDGEWKLAFSSPFYMWLLENLY* |
| Ga0070750_103351293 | 3300006916 | Aqueous | ESGQDLKDSFKNVTQMGFNGEWRFTFESPFYMWLLENLY* |
| Ga0075460_101851071 | 3300007234 | Aqueous | TQQREKGNELPVKFKSVVCMGHNGKWHLDFDSPFYMWLLENLY* |
| Ga0102963_13574061 | 3300009001 | Pond Water | TQQREAGVELQKSFKNVTQMGHDGEWKFKFGSPFYMWLLENLY* |
| Ga0114980_102165551 | 3300009152 | Freshwater Lake | AKAGNKLPESFKNVTAMGHNGRWELEFTSPFYMWLLENLY* |
| Ga0114980_103501864 | 3300009152 | Freshwater Lake | AGNKLPESFKNVTAMGHNGRWELEFTSPFYMWLLENLY* |
| Ga0114974_102801161 | 3300009183 | Freshwater Lake | KLPESFKNVTAMGHNGRWELEFTSPFYMWLLENLY* |
| Ga0115548_10307051 | 3300009423 | Pelagic Marine | QQRESGAKLQESFKNVTAMGHNGTWQFKFTSPFYMWLLENLY* |
| Ga0115003_109165911 | 3300009512 | Marine | GTELKESFKNVTAMGHNGTWRFKFESPFYMWLLEHLY* |
| Ga0115002_110611911 | 3300009706 | Marine | QQQQAGNELPKTLKNVLQMGHDGKWCLEFRSPFYMWLLENLY* |
| Ga0115001_101312371 | 3300009785 | Marine | QEPWASQQREAGTELKESFKNVTAMGHDGTWRFKFESPFYMWLLENLY* |
| Ga0132221_10092281 | 3300009911 | Meromictic Pond | TAGIELPTFIKNTTSLGHNGRWELEFSSPFYLWLLENLY* |
| Ga0129333_108634611 | 3300010354 | Freshwater To Marine Saline Gradient | KNAGIELPKSFKNVTSMGHNGVWELRFSSPFYMWLLENLY* |
| Ga0133547_114097511 | 3300010883 | Marine | EPWASQQREAGTELKESFKNVTAMGHDGTWRFKFESPFYMWLLEHLY* |
| Ga0163110_103587891 | 3300012928 | Surface Seawater | QQRDAGQELEESFKNVTKMGHNGNWTFTFESPFYMWLLENLY* |
| Ga0163109_109851293 | 3300012936 | Surface Seawater | WATQQKDAGVELKKSFTNATQMGFNGTWTFSFKSPFYMWLLDNLY* |
| Ga0163180_117228091 | 3300012952 | Seawater | REAGVDLPKTLKNVTQMGHNGTWSLGFSSPFYIWLLENLY* |
| Ga0182082_14501221 | 3300016771 | Salt Marsh | TQQREASKDLKDSFKNVTKMGFNGEWKFTFSSPFYMWLLENLY |
| Ga0181375_10488961 | 3300017718 | Marine | QTKAGNKLPETLKNVTQMGHNGTWTFSFTSPFYMWLLENLY |
| Ga0181362_10980021 | 3300017723 | Freshwater Lake | SQQRSAGNTLPESFKNVTTIGHNGRWELGFASPFYMWLLENLY |
| Ga0181398_10901303 | 3300017725 | Seawater | AGAELQEEFKNVTQMGHNGTWSFKFESPFYMWLLENLY |
| Ga0181416_10209143 | 3300017731 | Seawater | ELEESFKNVTRMGHNGTWTFSFESPFYMWLLENLY |
| Ga0181428_10563751 | 3300017738 | Seawater | TQQKKAGVELEKSFTNVTQIGHNGTWEFKFATPFYMWLLENLY |
| Ga0181392_10926751 | 3300017749 | Seawater | WATQMAESGRELKESFTNVSQMGHNGEWKFTFSTPFYMWLLENLY |
| Ga0187219_12049321 | 3300017751 | Seawater | AGQELEESFKNVTKMGHNGNWTFKFESPFYMWLLENLY |
| Ga0181414_12074952 | 3300017759 | Seawater | ELQEEFKNVTQMGHNGTWSFKFESPFYMWLLENLY |
| Ga0181425_12084411 | 3300017771 | Seawater | GKELQKSFKNVTQMGHDGEWQFKFASPFYMWLLENLY |
| Ga0181386_11236791 | 3300017773 | Seawater | QRQNGNNLEESFKNASRLGHNGTWKLTFQSPFYMWLLENLY |
| Ga0181395_11088273 | 3300017779 | Seawater | TQQREEGVELRNSFKNVTQIGHDGEWRLAFSSPFYMWLLANLY |
| Ga0181565_103814791 | 3300017818 | Salt Marsh | IGNELEQSFKNVTAMGHNGEWRFRFASPFYMWLLENLY |
| Ga0181552_104735191 | 3300017824 | Salt Marsh | DLKDSFKNVTQMGFNGTWNLKFASPFYMWLLENLY |
| Ga0181580_108129551 | 3300017956 | Salt Marsh | GHTPDKTFKNVTAMGHNGTWTLAFESPFYMWLFENLY |
| Ga0181580_110043292 | 3300017956 | Salt Marsh | WATQQRESGNDLKDSFKNVTKMGFNGTWNFKFESPFYMWLLENLY |
| Ga0181581_105627941 | 3300017962 | Salt Marsh | AGIELRHSFKNVTQIGHDGEWKLAFSSPFYMWLLENLY |
| Ga0181576_101663021 | 3300017985 | Salt Marsh | PEPWYSQQVEMGKTPPNSFKNVTAMGHNGTWQLKFQSPFYMWLLENLY |
| Ga0181560_103285701 | 3300018413 | Salt Marsh | QHRESGNDLKDSFKNVTTMGFNGEWKFRFASPFYMWLLENLY |
| Ga0181560_104764052 | 3300018413 | Salt Marsh | WLLAGNDLPETLKNVTIMGHDGEWKFTFSSPFYMWLLENLY |
| Ga0181566_103772721 | 3300018426 | Salt Marsh | DLKDSFMNVTQMGFDGEWKFTFSSPFYMWLLENLY |
| Ga0206131_103514643 | 3300020185 | Seawater | PEPWAARQRESGAELPEFFKNVTQLGHEGEWKFTFASPFYMWLLENLY |
| Ga0194125_106468921 | 3300020222 | Freshwater Lake | KTLPESFKNATIIGHNGRWVLSFESPFYMWLLENLY |
| Ga0211626_11515722 | 3300020343 | Marine | GEDLPKTLKNVTVMGHNGTWHLSFTSPFYMWLLENLY |
| Ga0211493_11831462 | 3300020363 | Marine | ELQESFKNVTSMGHNGVWDFKFESPFYMWLLENLY |
| Ga0211703_101960781 | 3300020367 | Marine | WATQQRESGNDLRDSFKNVTKMGFDGEWRFTFSSPFYMWLLENLY |
| Ga0211583_101165983 | 3300020397 | Marine | TQQRNEGITLKEEFKNVTQMGFNGAWRFKFSSPFYMWLLENLY |
| Ga0211644_100130897 | 3300020416 | Marine | ATQMAESGKELRESFTNVTQMGHNGQWKFTFTTPFYMWLLENLY |
| Ga0211702_101808941 | 3300020422 | Marine | KQLEESFDNVVKMGHNGTWKFKFASPFYMWLLENLY |
| Ga0211521_103243121 | 3300020428 | Marine | QIKAGVELPKTQKFVTEMGHNGTWTFTFRSPLYMWLLENLY |
| Ga0211708_100537481 | 3300020436 | Marine | TQQLEKGNELRESFKNVTQMGHNGEWRFGFGSPFYMWLLENLY |
| Ga0211695_103261772 | 3300020441 | Marine | TQQRDAGQELEESFKNVTKMGHNGNWTFTFESPFYMWLLENLY |
| Ga0211713_101930791 | 3300020467 | Marine | PEPWKSEQIKAGVELPETKKFVTEMGHNGTWTFSFTSPLYMWLLNNLY |
| Ga0213859_104028873 | 3300021364 | Seawater | SGQDLKDSFKNVTHMGFNGRWNFKFESPFYMWLLENLY |
| Ga0206123_104616402 | 3300021365 | Seawater | VELPESFKNVTTMGHNGQWKLSFESPFYMWLLENLY |
| Ga0222716_102237363 | 3300021959 | Estuarine Water | AEPWASQQRQNGVELPETFKNVTEMGHNGTWTFTFESPFYMWLLENLY |
| Ga0222712_103498061 | 3300021963 | Estuarine Water | AGNALPVAVKNVTSMGHNGRWELTFTSPFYMWLLENLY |
| Ga0196891_10893241 | 3300022183 | Aqueous | WATQHRESGNDLKDSFKNVTTMGFNGEWKFRFASPFYMWLLENLY |
| Ga0196905_11389322 | 3300022198 | Aqueous | EQRSAGKDLPEYIKNVTSMGHNGRWELEFTSPFYMWLLENLY |
| Ga0222629_10739152 | 3300022867 | Saline Water | GQELPVSFKNVNTIGHNGVWQLQFASPFYMWLLENLY |
| Ga0255758_103482093 | 3300022928 | Salt Marsh | GNELPKTFKNVTQIGHNGEWRFTFESPFYQWLLENLY |
| Ga0255770_104550611 | 3300022937 | Salt Marsh | ELPETLKNVTRMGHNGTWTFKFESPFYMWLLENLY |
| Ga0255782_104380711 | 3300023105 | Salt Marsh | KDNKIPPKTFKNVTVMGHNGSWEFEFSAPFYMWLLENLY |
| Ga0228658_10147275 | 3300024297 | Seawater | EPWASQQREAGVELQESFKNVSQIGHNGEWRFEFASPFYMWLLENLY |
| Ga0209535_100933813 | 3300025120 | Marine | TELKESFKNVTTMGHNGTWRFKFTSPFYMWLLENLY |
| Ga0209535_12043031 | 3300025120 | Marine | WATQMAESGKELRESFTNVTQMGHNGEWKFTFTTPFYMWLLENLY |
| Ga0208303_10593383 | 3300025543 | Aqueous | NDLKDSFKNVTHMGFNGEWKFTFSSPFYMWLLENLY |
| Ga0208149_10584101 | 3300025610 | Aqueous | QQRESGNDLKDSFKNVTQMGFDGEWKFTFSSPFYMWLLENLY |
| Ga0209194_11257183 | 3300025632 | Pelagic Marine | ESGVELQESFKNVTAMGHNGTWRFKFSSPFYMWLLENLY |
| Ga0209602_100625314 | 3300025704 | Pelagic Marine | TELPESFKNVTQMGHNGEWQLSFKSPFYMWLLENLY |
| Ga0209199_11231291 | 3300025809 | Pelagic Marine | ATQQREAGMELKESFKNVTAMGHDGTWRFKFHSPFYMWLLENLY |
| Ga0209223_100902984 | 3300025876 | Pelagic Marine | ESGAKLQESFKNVTAMGHNGTWQFKFTSPFYMWLLENLY |
| Ga0208644_10987121 | 3300025889 | Aqueous | GNTPEKSFKNVTTMGHNGTWTLAFESPFYMWLLENLY |
| Ga0208763_10189981 | 3300026136 | Marine | AGKDLQKSFKNVTQMGHNGEWRLKFSSPFYMWLLENLY |
| Ga0208521_10479633 | 3300026204 | Marine | ATQQTKAGNKLPETLKNVTQMGHNGTWTFSFTSPFYMWLLENLY |
| (restricted) Ga0247836_10673101 | 3300027728 | Freshwater | TEQAAAGHKLPESFKNVTAMGHNGRWEFQFSSPFYMWLLENLY |
| Ga0209279_101159851 | 3300027771 | Marine | QQREAGTELKESFKNVTQMGHNGTWTFKFSSPFYMWLLENLY |
| Ga0209500_102322443 | 3300027782 | Freshwater Lake | NKLPESFKNVTAMGHNGRWELEFTSPFYMWLLENLY |
| Ga0209711_101591373 | 3300027788 | Marine | SQQRQAGVELQESFKNVTSIGHDGTWKFKFESPFYMWLLENLY |
| Ga0209089_105793381 | 3300027838 | Marine | TELRESFKNVTAMGHNGTWRFKFTSPFYMWLLENLY |
| Ga0209550_101497601 | 3300027892 | Freshwater Lake | TPQYPQPWATEQAAAGNKLPESFKNVTAMGHNGRWEFKFSSPFYMWLLENLY |
| Ga0257107_10500761 | 3300028192 | Marine | WASQQAEKGNKLPETLKNVTQMGHNGTWTFTFTSPFYMWLLENLY |
| Ga0302116_11785133 | 3300031597 | Marine | SGAKLQESFKNVTAMGHNGTWQFKFTSPFYMWLLENLY |
| Ga0302132_101325481 | 3300031605 | Marine | KQDGIDLPKTFKNVTQMGHNGTWTFSFESPFYMWLLENLY |
| Ga0302114_101824311 | 3300031621 | Marine | ELPESFKNVIQMGHDGTWRFKFESPFYMWLLENLY |
| Ga0302136_10728521 | 3300031676 | Marine | GTELKESFKNVTLMGHDGKWRFKFESPFYVWLLENLY |
| Ga0315331_102831643 | 3300031774 | Seawater | TQMAESGRELRESFTNVTQMGHNGEWKFTFTTPFYMWLLENLY |
| Ga0315316_116108761 | 3300032011 | Seawater | ASQQAEKGNKPPKIIKNSTDLGHNGTWTFSFGTPFYMWLLENLY |
| Ga0316202_100383676 | 3300032277 | Microbial Mat | GAELSESFKNVTQLGHEGEWKLTFSSPFYMWLLENLY |
| Ga0315334_119278652 | 3300032360 | Seawater | PWASQQAKTGNKLPETFKNVTEMGHNGTWTFTFNSPFYMWLLENLY |
| ⦗Top⦘ |
 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |