


| Basic Information | |
|---|---|
| Family ID | F095992 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 105 |
| Average Sequence Length | 45 residues |
| Representative Sequence | MDAVTAPEGLRCAPGFVSLAALPPGTRGCVVSVGSSAAPLSALERRL |
| Number of Associated Samples | 94 |
| Number of Associated Scaffolds | 105 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 17.14 % |
| % of genes near scaffold ends (potentially truncated) | 100.00 % |
| % of genes from short scaffolds (< 2000 bps) | 88.57 % |
| Associated GOLD sequencing projects | 91 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.26 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (46.667 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (28.571 % of family members) |
| Environment Ontology (ENVO) | Unclassified (27.619 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (50.476 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Fibrous | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 10.67% β-sheet: 0.00% Coil/Unstructured: 89.33% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.26 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 105 Family Scaffolds |
|---|---|---|
| PF00005 | ABC_tran | 58.10 |
| PF02275 | CBAH | 1.90 |
| PF00436 | SSB | 0.95 |
| PF07883 | Cupin_2 | 0.95 |
| PF13676 | TIR_2 | 0.95 |
| PF13432 | TPR_16 | 0.95 |
| PF03551 | PadR | 0.95 |
| PF14559 | TPR_19 | 0.95 |
| PF07519 | Tannase | 0.95 |
| PF00999 | Na_H_Exchanger | 0.95 |
| COG ID | Name | Functional Category | % Frequency in 105 Family Scaffolds |
|---|---|---|---|
| COG3049 | Penicillin V acylase or related amidase, Ntn superfamily | Cell wall/membrane/envelope biogenesis [M] | 1.90 |
| COG4927 | Predicted choloylglycine hydrolase | General function prediction only [R] | 1.90 |
| COG0025 | NhaP-type Na+/H+ or K+/H+ antiporter | Inorganic ion transport and metabolism [P] | 0.95 |
| COG0475 | Kef-type K+ transport system, membrane component KefB | Inorganic ion transport and metabolism [P] | 0.95 |
| COG0629 | Single-stranded DNA-binding protein | Replication, recombination and repair [L] | 0.95 |
| COG1695 | DNA-binding transcriptional regulator, PadR family | Transcription [K] | 0.95 |
| COG1733 | DNA-binding transcriptional regulator, HxlR family | Transcription [K] | 0.95 |
| COG1846 | DNA-binding transcriptional regulator, MarR family | Transcription [K] | 0.95 |
| COG2965 | Primosomal replication protein N | Replication, recombination and repair [L] | 0.95 |
| COG3004 | Na+/H+ antiporter NhaA | Energy production and conversion [C] | 0.95 |
| COG3263 | NhaP-type Na+/H+ and K+/H+ antiporter with C-terminal TrkAC and CorC domains | Energy production and conversion [C] | 0.95 |
| COG4651 | Predicted Kef-type K+ transport protein, K+/H+ antiporter domain | Inorganic ion transport and metabolism [P] | 0.95 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 53.33 % |
| Unclassified | root | N/A | 46.67 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000651|AP72_2010_repI_A10DRAFT_1031024 | Not Available | 687 | Open in IMG/M |
| 3300000955|JGI1027J12803_100441282 | All Organisms → cellular organisms → Bacteria | 629 | Open in IMG/M |
| 3300001089|JGI12683J13190_1018584 | Not Available | 609 | Open in IMG/M |
| 3300001174|JGI12679J13547_1001657 | Not Available | 1189 | Open in IMG/M |
| 3300004091|Ga0062387_100111071 | Not Available | 1498 | Open in IMG/M |
| 3300005181|Ga0066678_10583920 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 742 | Open in IMG/M |
| 3300005332|Ga0066388_108222291 | All Organisms → cellular organisms → Bacteria | 521 | Open in IMG/M |
| 3300005437|Ga0070710_10741842 | All Organisms → cellular organisms → Bacteria | 696 | Open in IMG/M |
| 3300005538|Ga0070731_11043805 | All Organisms → cellular organisms → Bacteria | 541 | Open in IMG/M |
| 3300005553|Ga0066695_10320848 | All Organisms → cellular organisms → Eukaryota | 975 | Open in IMG/M |
| 3300005764|Ga0066903_104953834 | All Organisms → cellular organisms → Bacteria | 707 | Open in IMG/M |
| 3300005764|Ga0066903_105579921 | All Organisms → cellular organisms → Bacteria | 662 | Open in IMG/M |
| 3300005842|Ga0068858_100068300 | All Organisms → cellular organisms → Bacteria | 3293 | Open in IMG/M |
| 3300005921|Ga0070766_10931199 | All Organisms → cellular organisms → Bacteria | 596 | Open in IMG/M |
| 3300006172|Ga0075018_10382427 | All Organisms → cellular organisms → Bacteria | 712 | Open in IMG/M |
| 3300007258|Ga0099793_10007802 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 4013 | Open in IMG/M |
| 3300007788|Ga0099795_10545345 | Not Available | 546 | Open in IMG/M |
| 3300009101|Ga0105247_10397743 | Not Available | 981 | Open in IMG/M |
| 3300009137|Ga0066709_103327817 | Not Available | 585 | Open in IMG/M |
| 3300009177|Ga0105248_10736699 | All Organisms → cellular organisms → Eukaryota | 1112 | Open in IMG/M |
| 3300010048|Ga0126373_10051537 | All Organisms → cellular organisms → Bacteria | 3660 | Open in IMG/M |
| 3300010335|Ga0134063_10048906 | Not Available | 1841 | Open in IMG/M |
| 3300010358|Ga0126370_10954141 | Not Available | 779 | Open in IMG/M |
| 3300010359|Ga0126376_12328409 | Not Available | 582 | Open in IMG/M |
| 3300010361|Ga0126378_13068243 | Not Available | 532 | Open in IMG/M |
| 3300010376|Ga0126381_103425493 | Not Available | 624 | Open in IMG/M |
| 3300012385|Ga0134023_1285817 | Not Available | 531 | Open in IMG/M |
| 3300012683|Ga0137398_10563480 | Not Available | 786 | Open in IMG/M |
| 3300012918|Ga0137396_11028609 | All Organisms → cellular organisms → Bacteria | 594 | Open in IMG/M |
| 3300012927|Ga0137416_11466011 | All Organisms → cellular organisms → Bacteria | 619 | Open in IMG/M |
| 3300012929|Ga0137404_10059431 | Not Available | 2961 | Open in IMG/M |
| 3300012971|Ga0126369_12134937 | Not Available | 648 | Open in IMG/M |
| 3300014166|Ga0134079_10162961 | Not Available | 909 | Open in IMG/M |
| 3300014968|Ga0157379_10042020 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 4080 | Open in IMG/M |
| 3300016270|Ga0182036_10476494 | Not Available | 985 | Open in IMG/M |
| 3300016270|Ga0182036_10536801 | Not Available | 931 | Open in IMG/M |
| 3300017657|Ga0134074_1157158 | Not Available | 796 | Open in IMG/M |
| 3300017930|Ga0187825_10065837 | Not Available | 1234 | Open in IMG/M |
| 3300017970|Ga0187783_10805796 | All Organisms → cellular organisms → Bacteria | 677 | Open in IMG/M |
| 3300017972|Ga0187781_10058443 | Not Available | 2654 | Open in IMG/M |
| 3300017975|Ga0187782_10044197 | Not Available | 3244 | Open in IMG/M |
| 3300018058|Ga0187766_10254414 | Not Available | 1124 | Open in IMG/M |
| 3300018058|Ga0187766_11483707 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 500 | Open in IMG/M |
| 3300018089|Ga0187774_10384870 | Not Available | 848 | Open in IMG/M |
| 3300020581|Ga0210399_10415598 | All Organisms → cellular organisms → Eukaryota | 1121 | Open in IMG/M |
| 3300021178|Ga0210408_10414843 | Not Available | 1072 | Open in IMG/M |
| 3300021178|Ga0210408_11441997 | Not Available | 517 | Open in IMG/M |
| 3300021407|Ga0210383_10151995 | Not Available | 1967 | Open in IMG/M |
| 3300021407|Ga0210383_11725897 | All Organisms → cellular organisms → Bacteria | 512 | Open in IMG/M |
| 3300021420|Ga0210394_11086260 | All Organisms → cellular organisms → Bacteria | 690 | Open in IMG/M |
| 3300021560|Ga0126371_11936342 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 708 | Open in IMG/M |
| 3300024182|Ga0247669_1014240 | Not Available | 1417 | Open in IMG/M |
| 3300025899|Ga0207642_10089857 | All Organisms → cellular organisms → Bacteria | 1514 | Open in IMG/M |
| 3300025906|Ga0207699_11393473 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 519 | Open in IMG/M |
| 3300025941|Ga0207711_12124032 | Not Available | 504 | Open in IMG/M |
| 3300026317|Ga0209154_1260745 | All Organisms → cellular organisms → Bacteria | 590 | Open in IMG/M |
| 3300026322|Ga0209687_1052691 | Not Available | 1319 | Open in IMG/M |
| 3300026341|Ga0257151_1007273 | Not Available | 1148 | Open in IMG/M |
| 3300027645|Ga0209117_1022515 | Not Available | 2023 | Open in IMG/M |
| 3300027703|Ga0207862_1075613 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → campanulids → Asterales → Asteraceae → Asteroideae → Anthemideae → Anthemidinae → Tanacetum → Tanacetum cinerariifolium | 1013 | Open in IMG/M |
| 3300027829|Ga0209773_10242158 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Rhabditina → Rhabditomorpha → Rhabditoidea → Rhabditidae → Rhabditidae incertae sedis → Diploscapter → Diploscapter pachys | 753 | Open in IMG/M |
| 3300027853|Ga0209274_10261753 | Not Available | 886 | Open in IMG/M |
| 3300027889|Ga0209380_10083850 | Not Available | 1831 | Open in IMG/M |
| 3300027986|Ga0209168_10600845 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Rhabditina → Rhabditomorpha → Rhabditoidea → Rhabditidae → Rhabditidae incertae sedis → Diploscapter → Diploscapter pachys | 526 | Open in IMG/M |
| 3300029999|Ga0311339_10117473 | All Organisms → cellular organisms → Bacteria | 3223 | Open in IMG/M |
| 3300031525|Ga0302326_11285886 | Not Available | 998 | Open in IMG/M |
| 3300031525|Ga0302326_11445018 | All Organisms → cellular organisms → Bacteria | 925 | Open in IMG/M |
| 3300031525|Ga0302326_13589650 | All Organisms → cellular organisms → Bacteria | 513 | Open in IMG/M |
| 3300031545|Ga0318541_10202974 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1097 | Open in IMG/M |
| 3300031545|Ga0318541_10679796 | All Organisms → cellular organisms → Bacteria | 575 | Open in IMG/M |
| 3300031564|Ga0318573_10504486 | All Organisms → cellular organisms → Bacteria | 651 | Open in IMG/M |
| 3300031680|Ga0318574_10068010 | Not Available | 1916 | Open in IMG/M |
| 3300031718|Ga0307474_11420534 | Not Available | 547 | Open in IMG/M |
| 3300031719|Ga0306917_11067574 | All Organisms → cellular organisms → Bacteria | 629 | Open in IMG/M |
| 3300031720|Ga0307469_12335866 | All Organisms → cellular organisms → Bacteria | 522 | Open in IMG/M |
| 3300031744|Ga0306918_10432624 | All Organisms → cellular organisms → Bacteria | 1027 | Open in IMG/M |
| 3300031753|Ga0307477_10478911 | Not Available | 847 | Open in IMG/M |
| 3300031753|Ga0307477_10607735 | Not Available | 737 | Open in IMG/M |
| 3300031769|Ga0318526_10140170 | Not Available | 981 | Open in IMG/M |
| 3300031779|Ga0318566_10066010 | Not Available | 1742 | Open in IMG/M |
| 3300031780|Ga0318508_1128002 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → campanulids → Asterales → Asteraceae → Asteroideae → Anthemideae → Anthemidinae → Tanacetum → Tanacetum cinerariifolium | 715 | Open in IMG/M |
| 3300031782|Ga0318552_10118283 | All Organisms → cellular organisms → Bacteria | 1318 | Open in IMG/M |
| 3300031782|Ga0318552_10667552 | All Organisms → cellular organisms → Bacteria | 530 | Open in IMG/M |
| 3300031792|Ga0318529_10568886 | All Organisms → cellular organisms → Bacteria | 526 | Open in IMG/M |
| 3300031795|Ga0318557_10075184 | All Organisms → cellular organisms → Bacteria | 1465 | Open in IMG/M |
| 3300031796|Ga0318576_10184291 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 980 | Open in IMG/M |
| 3300031823|Ga0307478_11531953 | Not Available | 551 | Open in IMG/M |
| 3300031835|Ga0318517_10328142 | All Organisms → cellular organisms → Bacteria | 691 | Open in IMG/M |
| 3300031879|Ga0306919_11465037 | All Organisms → cellular organisms → Bacteria | 514 | Open in IMG/M |
| 3300031890|Ga0306925_10423669 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1425 | Open in IMG/M |
| 3300031894|Ga0318522_10314357 | Not Available | 593 | Open in IMG/M |
| 3300031947|Ga0310909_10219295 | Not Available | 1584 | Open in IMG/M |
| 3300031981|Ga0318531_10004954 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4654 | Open in IMG/M |
| 3300032010|Ga0318569_10420107 | All Organisms → cellular organisms → Bacteria | 624 | Open in IMG/M |
| 3300032054|Ga0318570_10138206 | Not Available | 1085 | Open in IMG/M |
| 3300032055|Ga0318575_10388507 | All Organisms → cellular organisms → Bacteria | 708 | Open in IMG/M |
| 3300032059|Ga0318533_10624750 | All Organisms → cellular organisms → Bacteria | 790 | Open in IMG/M |
| 3300032068|Ga0318553_10106072 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Salmonella → Salmonella enterica → Salmonella enterica subsp. enterica | 1435 | Open in IMG/M |
| 3300032068|Ga0318553_10158122 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1175 | Open in IMG/M |
| 3300032076|Ga0306924_11207371 | Not Available | 818 | Open in IMG/M |
| 3300032174|Ga0307470_10311914 | Not Available | 1072 | Open in IMG/M |
| 3300032805|Ga0335078_10275003 | Not Available | 2281 | Open in IMG/M |
| 3300032828|Ga0335080_11851070 | All Organisms → cellular organisms → Bacteria | 588 | Open in IMG/M |
| 3300033158|Ga0335077_11186220 | All Organisms → cellular organisms → Bacteria | 748 | Open in IMG/M |
| 3300033486|Ga0316624_10009594 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 4867 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 28.57% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 6.67% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 6.67% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 5.71% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 5.71% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 5.71% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 4.76% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 3.81% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 3.81% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 3.81% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 3.81% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 2.86% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 2.86% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 2.86% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 1.90% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.90% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.90% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.95% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.95% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.95% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.95% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.95% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.95% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.95% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000651 | Forest soil microbial communities from Amazon forest - Pasture72 2010 replicate I A10 | Environmental | Open in IMG/M |
| 3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001089 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M3 | Environmental | Open in IMG/M |
| 3300001174 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M1 | Environmental | Open in IMG/M |
| 3300004091 | Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300005181 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
| 3300005538 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 | Environmental | Open in IMG/M |
| 3300005553 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
| 3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
| 3300006172 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014 | Environmental | Open in IMG/M |
| 3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
| 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Environmental | Open in IMG/M |
| 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300012385 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_2_4_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300014166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09182015 | Environmental | Open in IMG/M |
| 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300017657 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09212015 | Environmental | Open in IMG/M |
| 3300017930 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_5 | Environmental | Open in IMG/M |
| 3300017970 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017972 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018058 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MG | Environmental | Open in IMG/M |
| 3300018089 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_20_MG | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300024182 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK10 | Environmental | Open in IMG/M |
| 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026317 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 (SPAdes) | Environmental | Open in IMG/M |
| 3300026322 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 (SPAdes) | Environmental | Open in IMG/M |
| 3300026341 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-17-A | Environmental | Open in IMG/M |
| 3300027645 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027703 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 81 (SPAdes) | Environmental | Open in IMG/M |
| 3300027829 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027853 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027889 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes) | Environmental | Open in IMG/M |
| 3300027986 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300029999 | I_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300031525 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3 | Environmental | Open in IMG/M |
| 3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
| 3300031564 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21 | Environmental | Open in IMG/M |
| 3300031680 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22 | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
| 3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
| 3300031769 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f24 | Environmental | Open in IMG/M |
| 3300031779 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f22 | Environmental | Open in IMG/M |
| 3300031780 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f21 | Environmental | Open in IMG/M |
| 3300031782 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f20 | Environmental | Open in IMG/M |
| 3300031792 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f23 | Environmental | Open in IMG/M |
| 3300031795 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f19 | Environmental | Open in IMG/M |
| 3300031796 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f24 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031835 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f21 | Environmental | Open in IMG/M |
| 3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031894 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f18 | Environmental | Open in IMG/M |
| 3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
| 3300031981 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f25 | Environmental | Open in IMG/M |
| 3300032010 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f22 | Environmental | Open in IMG/M |
| 3300032054 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f23 | Environmental | Open in IMG/M |
| 3300032055 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f23 | Environmental | Open in IMG/M |
| 3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
| 3300032068 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f21 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
| 3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
| 3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
| 3300033486 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_N3_C1_D5_A | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| AP72_2010_repI_A10DRAFT_10310242 | 3300000651 | Forest Soil | MDAVTSPKGVLCAPGFVSLAALPPGTKGSVVSVGSSAAPLSALERRLLEFGFV |
| JGI1027J12803_1004412822 | 3300000955 | Soil | MDAVTSPKGVLCAPGFVSLAALPPGTKGSVVSVGSSAAPLS |
| JGI12683J13190_10185841 | 3300001089 | Forest Soil | MDAVAAPEGLAFEPGFVSLAALPPGTTARVVGVGSI |
| JGI12679J13547_10016572 | 3300001174 | Forest Soil | MDAVAAPEGLAFEPGFVSLAALPPGTTARVVGVGSIASA |
| Ga0062387_1001110711 | 3300004091 | Bog Forest Soil | MDAAVSPFGLALNPGFVSLAALPPGTSGRVIGVGSGSASPLSA |
| Ga0066678_105839202 | 3300005181 | Soil | MDAVAAPEGLALDPGFVSLAALPPGTTGRVVSVGSAAAALS |
| Ga0066388_1082222912 | 3300005332 | Tropical Forest Soil | MDAVAAPPGIGLEPGFVSLAALPAGAKGCVIGVGSSANPLS |
| Ga0070710_107418422 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | MDAVNSPDGVRCVPGFVSLAAMPPGTKGSVVSVGSSVHPLSALERRLLEFGFV |
| Ga0070731_110438052 | 3300005538 | Surface Soil | MDAVAAPNGLALDPGFVSLAALPPGTTGKVVGVGSLSATLSA |
| Ga0066695_103208482 | 3300005553 | Soil | MDAVVAPEGFALDPGFVSLAALPPGTTARVVGVGSIASAL |
| Ga0066903_1049538341 | 3300005764 | Tropical Forest Soil | MDAVNSPEGVRCVPGFVSLAALPPGTKGSVVSVGSS |
| Ga0066903_1055799211 | 3300005764 | Tropical Forest Soil | MDAVTSPEGVLCAPGFVSLAALPPGTKGSVVSVGSSA |
| Ga0068858_1000683001 | 3300005842 | Switchgrass Rhizosphere | MDAVAAPAGLVLDPGFVSLAALPPGTSGRVVGVGNAAA |
| Ga0070766_109311992 | 3300005921 | Soil | MDAAATPAGLALDPGFVSLAALPPGTAGRVVAVGARTGVLSPLERRLLE |
| Ga0075018_103824271 | 3300006172 | Watersheds | MDAAATPAGVALDPGFVSLAALSPGAKGHVVGVGTANTSLSSLERRLLEFGFCS |
| Ga0099793_100078021 | 3300007258 | Vadose Zone Soil | MDAVVAPEGLALDPGFVSLAALPPGTTARVVGVGSIASALSALERRLLEFGF |
| Ga0099795_105453451 | 3300007788 | Vadose Zone Soil | MDAVVAPEGLALDPGFVSLAALPPGTTARVVGVGSIACA |
| Ga0105247_103977432 | 3300009101 | Switchgrass Rhizosphere | MDAVAAPAGLVLDPGFVSLAALPPGTSGRVVGVGNAA |
| Ga0066709_1033278171 | 3300009137 | Grasslands Soil | MDAVVAPEGFALEPGFVSLAALPPGTTARVVGVGSIASPLSALERRLLE |
| Ga0105248_107366991 | 3300009177 | Switchgrass Rhizosphere | MDAVAAPAGLVLDPGFVSLAALPPGTSGRVVGVGNA |
| Ga0126373_100515373 | 3300010048 | Tropical Forest Soil | MDASAAPYGLALNPALVSLAALAPGTAGRVVGVGSPSAPLSALERRL |
| Ga0134063_100489062 | 3300010335 | Grasslands Soil | MDAVVAPEGFALEPGFVSLAALPPGTTARVVGVGSIASALSALERRLL |
| Ga0126370_109541411 | 3300010358 | Tropical Forest Soil | MHAVAAPPGIGLEPGFVSLAALPAGAKGCVVGVGSSANPLSALERRLLEFGF |
| Ga0126376_123284092 | 3300010359 | Tropical Forest Soil | MDAVAAPPGIGLEPGFVSLAALPAGAKGCVVGVGSSANPLSALERR |
| Ga0126378_130682432 | 3300010361 | Tropical Forest Soil | MDAVAAPTGMRCAPGYMSLAALAPGMRASVVSVGSSASPISALERRLLELGFVHGEQ |
| Ga0126381_1034254932 | 3300010376 | Tropical Forest Soil | MDAVASPTGLALDPGFVSLAALPPGTAGRVVSVGAGAGALSPLERRLLEFGFVSG |
| Ga0134023_12858171 | 3300012385 | Grasslands Soil | MDAVAAPEGHALDPGFVSLAALPPGTTGRVVSVGSAAAAL |
| Ga0137398_105634801 | 3300012683 | Vadose Zone Soil | MDAVVAPEGLALDPGFVSLAALPPGTTARVVGVGSIASALSALE |
| Ga0137396_110286091 | 3300012918 | Vadose Zone Soil | MDAVAAPEGLAFEPGFVSLAALPPGTTARVVGVGSIASALSALERRL |
| Ga0137416_114660112 | 3300012927 | Vadose Zone Soil | MDAVAAPEGLAFEPGFVSLAALPPGTTARVVGAGSIASALSALERR |
| Ga0137404_100594311 | 3300012929 | Vadose Zone Soil | MDAVAAPAGVALDPGFMSLSALPPGTCGRVVGVGSAEATMTALERRLLELGF |
| Ga0126369_121349371 | 3300012971 | Tropical Forest Soil | MRTVLIHNCIMDAVATPAGLALDPGFVSLAALPPGAAGRIVSVGAPASALSPLERR |
| Ga0134079_101629612 | 3300014166 | Grasslands Soil | MDAVVAPEGFALDPGFVSLAALPPGTTARVVGVGSIASALSALERRLL |
| Ga0157379_100420201 | 3300014968 | Switchgrass Rhizosphere | MDAVAAPAGLVLDPGFVSLAALPPGTSGRVVGVGNAAAVL |
| Ga0182036_104764941 | 3300016270 | Soil | MDAVISPKGVLCAPGFVSLAALPPGTKGSVVSVGSSATPLSALERRLL |
| Ga0182036_105368012 | 3300016270 | Soil | MDAVTVPEGLCCAPGFVSLAALPPGTRGSVVSVGSSAAPLSALERRLLEFGF |
| Ga0134074_11571581 | 3300017657 | Grasslands Soil | MDAVAAPEGLALDPGFVSLAALPPGTTGRVVSVGSAAAALSPLERRLLEF |
| Ga0187825_100658371 | 3300017930 | Freshwater Sediment | MDAVVTPAAVESGSVSLAALAPGTRGRVVGVGSSSRALSALERRLLE |
| Ga0187783_108057961 | 3300017970 | Tropical Peatland | MDAVAAPAGLALDPGFVSLAALPPGAAGRVVSVGTQTSSLS |
| Ga0187781_100584431 | 3300017972 | Tropical Peatland | MDASAAPVGLSLAPGFVSLAALPPGTRGAVVGVGSRSAPLSALERR |
| Ga0187782_100441971 | 3300017975 | Tropical Peatland | MDAVAAPAGLALDPGFVSLSALPPGAAGRVVSVGSPTSTLSPLERRLLEFGF |
| Ga0187766_102544141 | 3300018058 | Tropical Peatland | MDAVTTPEGLRCAPGFVSLAALPPGTRGCVVSVGSSATPLSALERRLLEFGF |
| Ga0187766_114837071 | 3300018058 | Tropical Peatland | MTMDAVAAPPGIGLDPSFVSLAALPAGAKGSVVGVGSSTSPLSALERRLLEFGFVN |
| Ga0187774_103848701 | 3300018089 | Tropical Peatland | MDAAATPAGLVLDPGFVSLAAMPPGTAGRVVCVGSP |
| Ga0210399_104155981 | 3300020581 | Soil | MDVAASPFSLELNPGFVSLATLSPGMGGRVIGVGSGSASPLSAL |
| Ga0210408_104148432 | 3300021178 | Soil | MDAVASPVGVSLEPGFVSLAALPPGTTGHVVSIGS |
| Ga0210408_114419971 | 3300021178 | Soil | MDAVVAPVGVALEPGFVSLAALPPGTSGRVVSVGG |
| Ga0210383_101519951 | 3300021407 | Soil | MDAVVAPVGVALEPGFVSLAALPPGTSGRVVSVGGAS |
| Ga0210383_117258971 | 3300021407 | Soil | MDAVASPSGLSLKPGFASLAALPPGTRGRVVSVGTASDTLSALERRLLEFG |
| Ga0210394_110862601 | 3300021420 | Soil | MDAAASPFGLELNPGFVSLATLSPGMGGRVVGVGSTSGSASPLSALERRLLEFGFVS |
| Ga0126371_119363422 | 3300021560 | Tropical Forest Soil | MDAVNSPEGMRCAPGFVSLAALPPGTRGSVVSVGSSTAPLSA |
| Ga0247669_10142401 | 3300024182 | Soil | MDAVATPAGPALESAFVSLAALPPGTRGCVVGVGSSTAPLSA |
| Ga0207642_100898572 | 3300025899 | Miscanthus Rhizosphere | MDAVAAPAGLVLDPGFVSLAALPPGTSGRVVGVGNAAAALSALERRLLEFG |
| Ga0207699_113934731 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | MDAIASPVGVSLEPGFVSLAALPPGTTGRVVSVGSREGTLSALERRLLEFG |
| Ga0207711_121240321 | 3300025941 | Switchgrass Rhizosphere | MDAVAAPAGLVLDPGFVSLAALPPGTSGRVVGVGNAAAVLS |
| Ga0209154_12607452 | 3300026317 | Soil | MDAVAAPEGLALDPGFVSLAALPPGTTGRVVSVGSAAAALSPL |
| Ga0209687_10526911 | 3300026322 | Soil | MDAVVAPEGFALEPGFVSLAALPPGTTARVVGVGSIASALSALERRLLEFG |
| Ga0257151_10072731 | 3300026341 | Soil | MDAVAAPEGLAFEPGFVSLAALPPGTTARVVGVGSIASALSALERRLLEFGFV |
| Ga0209117_10225151 | 3300027645 | Forest Soil | MDAVAAPEGLAFEPGFVSLAALPPGTTARVVGVGSIA |
| Ga0207862_10756132 | 3300027703 | Tropical Forest Soil | MDASAAPAGLGIEPGFVSLAALPAGTRGSVVGVGSSATALSALERRLL |
| Ga0209773_102421582 | 3300027829 | Bog Forest Soil | MDAAVSPFGLALNPGFVSLAALPPGTSGRVIGVGSG |
| Ga0209274_102617532 | 3300027853 | Soil | MDAVANPAGLALDPGFVSLAALPPGTCGRVVSVGARSGSLS |
| Ga0209380_100838502 | 3300027889 | Soil | MDAAATPAGLALDPGFVSLAALPPGTAGRVVAVGARTGVLSPLERRLL |
| Ga0209168_106008452 | 3300027986 | Surface Soil | MDAVATPAGIALDPGFVSLAALPPGAAGRVASVGARS |
| Ga0311339_101174733 | 3300029999 | Palsa | MDAVASPNGLSLKPGFVSLAALPPGTRGHVVSVGTQSDSLSALERRLLEF |
| Ga0302326_112858861 | 3300031525 | Palsa | MDAVASPNGLSLKPGFVSLAALPPGTRGHVVSVGTQSDSLS |
| Ga0302326_114450182 | 3300031525 | Palsa | MDAVAAPFGVSLAPGFVSLAALPPGTRGNVVGVGSNHGALSALERRLLEFGF |
| Ga0302326_135896501 | 3300031525 | Palsa | MDAVVAPAGLALDPGFVSLAALPPGTRGSVVGVGSST |
| Ga0318541_102029741 | 3300031545 | Soil | MDAVTVPEGLRCAPGFVSLAALPPGTRGLVVSVGASAAPLSALE |
| Ga0318541_106797961 | 3300031545 | Soil | MDAVTAPEGLRCAPGFVSLAALPPGTRGCVVSVGSSAAPLS |
| Ga0318573_105044862 | 3300031564 | Soil | MDAVTVPEGLRCAPGFVSLAALPPGTRGLVVSVGSSAAPLSS |
| Ga0318574_100680102 | 3300031680 | Soil | MDAVTSPKGVLCPPGFVSLAALPPGTKGSVVSVGSSAAPL |
| Ga0307474_114205341 | 3300031718 | Hardwood Forest Soil | MDAVAVPPGLALGPGFVSLAALPPGTRGSVVGVGSSTAPLSALER |
| Ga0306917_110675741 | 3300031719 | Soil | MDAVTAPEGLRCAPGFVSLAALPPGTRGCVVSVGSSAAPLSA |
| Ga0307469_123358662 | 3300031720 | Hardwood Forest Soil | MDAVATPAGAALESAFVSLAARPPGTRGSVVGVGSSTAPLSALERRL |
| Ga0306918_104326242 | 3300031744 | Soil | MDAVISPKGVLCAPGFVSLAALPPGTKGSVVSVGSSATPLSALERRLLEFGFVHGE |
| Ga0307477_104789112 | 3300031753 | Hardwood Forest Soil | MDAVVAPEGLALDPGFVSLAALPPGTTARVVGVGSIASALSALERRLLEFGFV |
| Ga0307477_106077352 | 3300031753 | Hardwood Forest Soil | MDAVAAPPGIGLDPSFVSLAALPAGAKGCVVGVGSSANPLSALERR |
| Ga0318526_101401701 | 3300031769 | Soil | MDAVTAPEGLRCAPGFVSLAALPPGTRGCVVSVGSSAAPLSALERRLL |
| Ga0318566_100660101 | 3300031779 | Soil | MDAVTVPEGLCCAPGFVSLAALPPGTRGSVVSVGSSAAPLSALERRLLEFGFVHCE |
| Ga0318508_11280021 | 3300031780 | Soil | MDAVTTPEGLRCAPGFVSLAALPPGTRGSVVSVGSSAAPLSALERRLLEFG |
| Ga0318552_101182832 | 3300031782 | Soil | VDAVTVPEGLRCAPGFVSLAALPPGTRGCVVSVGSSAAPLSALERRLLEFGFVHG |
| Ga0318552_106675522 | 3300031782 | Soil | MDAVTSPKGVLCPPGFVSLAALPPGTKGSVVSVGSSAAPLSALE |
| Ga0318529_105688862 | 3300031792 | Soil | MDAVTTPEGLRCAPGFVSLAALPPGTRGYVVSVGSGAAPLSALE |
| Ga0318557_100751842 | 3300031795 | Soil | MDAVTAPEGLRCAPGFVSLAALPPGTRGCVVSVGSSAAPRSALERRLLG |
| Ga0318576_101842911 | 3300031796 | Soil | MDAVTVPEGLCCAPGFVSLAALPPGTRGSVVSVGSSAAPLSALERRLLEFG |
| Ga0307478_115319532 | 3300031823 | Hardwood Forest Soil | MDAVAAPEGLALDPGFVSLAALPPGTTGRVVSVGSATSALSALERRLLE |
| Ga0318517_103281421 | 3300031835 | Soil | MDAVTSPKGVLCPPGFVSLAALPPGTKGSVVSVGSSAAPLSA |
| Ga0306919_114650372 | 3300031879 | Soil | MDAVTVPEGLRCAPGFVSLAALPPGTRGSVVSVGSSAA |
| Ga0306925_104236691 | 3300031890 | Soil | MDAPAVPYGLALDPALVSLAALPPGTAGRVVGVGS |
| Ga0318522_103143571 | 3300031894 | Soil | MDAVTVPEGLRCAPGFVSLAALPPGTRGLVVSVGSSAAPLSSLERRLLEF |
| Ga0310909_102192952 | 3300031947 | Soil | MDAVTSPKGVLCPPGFVSLAALPPGTKGSVVSVGSSAAPLSALERRLLEFGF |
| Ga0318531_100049544 | 3300031981 | Soil | MDAVTVPEGLRCAPGFVSLAALPPGTRGLVVSVGSS |
| Ga0318569_104201072 | 3300032010 | Soil | MDAVTAPEGLRCAPGFVSLAALPPGTRGCVVSVGSSAAPLSALE |
| Ga0318570_101382061 | 3300032054 | Soil | MDAVTAPEGLRCAPGFVSLAALPPGTRGCVVSVGSSAAPLSALERRLLEFGFVH |
| Ga0318575_103885072 | 3300032055 | Soil | MDAVTAPEGLRCAPGFVSLAALPPGTRGCVVSVGSSAAPLSALERRL |
| Ga0318533_106247501 | 3300032059 | Soil | MDAVTAPEGLRCAPGFVSLAALPPGTRGCVVSVGSSAAPLSALERRLLEFGFVN |
| Ga0318553_101060721 | 3300032068 | Soil | MDAVTVPEGLRCAPGFVSLAALPPGTRGSVVSVGSSAAPLSALERRLLEFG |
| Ga0318553_101581222 | 3300032068 | Soil | MDAVISPKGVLCAPGFVSLAALPPGTKGSVVSVGSSATPLSALER |
| Ga0306924_112073712 | 3300032076 | Soil | MDAVAAPSGLALDPGYVSLAALPPGTRGCVVSVGSGTAAPLSALERRLLE |
| Ga0307470_103119141 | 3300032174 | Hardwood Forest Soil | MDAVATRAGLALDPGFVSLAALPPGTAGRVVSVGSPAGALSPLERRLL |
| Ga0335078_102750032 | 3300032805 | Soil | MDAAATPAGLTLDPGFVSLAALPPGTAGRVVGVGARAGILSPLERRLLE |
| Ga0335080_118510702 | 3300032828 | Soil | MDAASTPAGVALDPGFVSLAALSPGVKGHVVGVGTANTELSSL |
| Ga0335077_111862201 | 3300033158 | Soil | MDAVAAPAGLALDPGFVSLAALPPGAAGRVVSVGSSASALSPLERRLLEFGFVSG |
| Ga0316624_100095941 | 3300033486 | Soil | MDAVAAPSGLALDPGFVSLAALPPGTTGRVVGLSTSGGTL |
| ⦗Top⦘ |