


| Basic Information | |
|---|---|
| Family ID | F095988 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 105 |
| Average Sequence Length | 44 residues |
| Representative Sequence | VSNTPQPAQAGPVILEGKHDGIATLVMNRPDRLNALNNELAM |
| Number of Associated Samples | 93 |
| Number of Associated Scaffolds | 105 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 95.24 % |
| % of genes near scaffold ends (potentially truncated) | 96.19 % |
| % of genes from short scaffolds (< 2000 bps) | 82.86 % |
| Associated GOLD sequencing projects | 90 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.40 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (100.000 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (29.524 % of family members) |
| Environment Ontology (ENVO) | Unclassified (29.524 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (52.381 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Fibrous | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 32.86% β-sheet: 0.00% Coil/Unstructured: 67.14% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.40 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 105 Family Scaffolds |
|---|---|---|
| PF03167 | UDG | 80.95 |
| PF02423 | OCD_Mu_crystall | 5.71 |
| PF04542 | Sigma70_r2 | 3.81 |
| PF08281 | Sigma70_r4_2 | 2.86 |
| PF00378 | ECH_1 | 1.90 |
| PF00106 | adh_short | 0.95 |
| PF00171 | Aldedh | 0.95 |
| PF02780 | Transketolase_C | 0.95 |
| PF00350 | Dynamin_N | 0.95 |
| PF07681 | DoxX | 0.95 |
| COG ID | Name | Functional Category | % Frequency in 105 Family Scaffolds |
|---|---|---|---|
| COG0692 | Uracil-DNA glycosylase | Replication, recombination and repair [L] | 80.95 |
| COG1573 | Uracil-DNA glycosylase | Replication, recombination and repair [L] | 80.95 |
| COG3663 | G:T/U-mismatch repair DNA glycosylase | Replication, recombination and repair [L] | 80.95 |
| COG2423 | Ornithine cyclodeaminase/archaeal alanine dehydrogenase, mu-crystallin family | Amino acid transport and metabolism [E] | 5.71 |
| COG0568 | DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32) | Transcription [K] | 3.81 |
| COG1191 | DNA-directed RNA polymerase specialized sigma subunit | Transcription [K] | 3.81 |
| COG1595 | DNA-directed RNA polymerase specialized sigma subunit, sigma24 family | Transcription [K] | 3.81 |
| COG4941 | Predicted RNA polymerase sigma factor, contains C-terminal TPR domain | Transcription [K] | 3.81 |
| COG0014 | Gamma-glutamyl phosphate reductase | Amino acid transport and metabolism [E] | 0.95 |
| COG1012 | Acyl-CoA reductase or other NAD-dependent aldehyde dehydrogenase | Lipid transport and metabolism [I] | 0.95 |
| COG2259 | Uncharacterized membrane protein YphA, DoxX/SURF4 family | Function unknown [S] | 0.95 |
| COG4230 | Delta 1-pyrroline-5-carboxylate dehydrogenase | Amino acid transport and metabolism [E] | 0.95 |
| COG4270 | Uncharacterized membrane protein | Function unknown [S] | 0.95 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 100.00 % |
| Unclassified | root | N/A | 0.00 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001593|JGI12635J15846_10158118 | All Organisms → cellular organisms → Bacteria | 1545 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_100053109 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3694 | Open in IMG/M |
| 3300002561|JGI25384J37096_10007551 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4056 | Open in IMG/M |
| 3300002908|JGI25382J43887_10047381 | All Organisms → cellular organisms → Bacteria | 2337 | Open in IMG/M |
| 3300004119|Ga0058887_1452378 | All Organisms → cellular organisms → Bacteria | 749 | Open in IMG/M |
| 3300005174|Ga0066680_10607384 | All Organisms → cellular organisms → Bacteria | 684 | Open in IMG/M |
| 3300005180|Ga0066685_10218774 | All Organisms → cellular organisms → Bacteria | 1309 | Open in IMG/M |
| 3300005332|Ga0066388_103551811 | All Organisms → cellular organisms → Bacteria | 796 | Open in IMG/M |
| 3300005541|Ga0070733_10727933 | All Organisms → cellular organisms → Bacteria | 666 | Open in IMG/M |
| 3300005541|Ga0070733_11108078 | All Organisms → cellular organisms → Bacteria | 531 | Open in IMG/M |
| 3300005552|Ga0066701_10147660 | All Organisms → cellular organisms → Bacteria | 1414 | Open in IMG/M |
| 3300005610|Ga0070763_10845455 | All Organisms → cellular organisms → Bacteria | 542 | Open in IMG/M |
| 3300006034|Ga0066656_10504179 | All Organisms → cellular organisms → Bacteria | 789 | Open in IMG/M |
| 3300006046|Ga0066652_100069287 | All Organisms → cellular organisms → Bacteria | 2740 | Open in IMG/M |
| 3300006052|Ga0075029_100044318 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2561 | Open in IMG/M |
| 3300006059|Ga0075017_100179447 | All Organisms → cellular organisms → Bacteria | 1522 | Open in IMG/M |
| 3300006162|Ga0075030_100121861 | All Organisms → cellular organisms → Bacteria | 2119 | Open in IMG/M |
| 3300006172|Ga0075018_10475816 | All Organisms → cellular organisms → Bacteria | 647 | Open in IMG/M |
| 3300006755|Ga0079222_10058467 | All Organisms → cellular organisms → Bacteria | 1832 | Open in IMG/M |
| 3300006797|Ga0066659_10527139 | All Organisms → cellular organisms → Bacteria | 951 | Open in IMG/M |
| 3300006797|Ga0066659_11601442 | All Organisms → cellular organisms → Bacteria | 547 | Open in IMG/M |
| 3300006800|Ga0066660_10000084 | All Organisms → cellular organisms → Bacteria | 22998 | Open in IMG/M |
| 3300006800|Ga0066660_10233686 | All Organisms → cellular organisms → Bacteria | 1426 | Open in IMG/M |
| 3300006954|Ga0079219_10591073 | All Organisms → cellular organisms → Bacteria | 809 | Open in IMG/M |
| 3300006954|Ga0079219_11118233 | All Organisms → cellular organisms → Bacteria | 671 | Open in IMG/M |
| 3300007265|Ga0099794_10009557 | All Organisms → cellular organisms → Bacteria | 4084 | Open in IMG/M |
| 3300009012|Ga0066710_103592764 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 585 | Open in IMG/M |
| 3300009089|Ga0099828_10031095 | All Organisms → cellular organisms → Bacteria | 4297 | Open in IMG/M |
| 3300009090|Ga0099827_10822507 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 804 | Open in IMG/M |
| 3300009792|Ga0126374_10085530 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1740 | Open in IMG/M |
| 3300010322|Ga0134084_10252645 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 637 | Open in IMG/M |
| 3300010325|Ga0134064_10038900 | All Organisms → cellular organisms → Bacteria | 1425 | Open in IMG/M |
| 3300010358|Ga0126370_11159897 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 716 | Open in IMG/M |
| 3300010358|Ga0126370_11973456 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 570 | Open in IMG/M |
| 3300010361|Ga0126378_10041313 | All Organisms → cellular organisms → Bacteria | 4228 | Open in IMG/M |
| 3300010361|Ga0126378_11491012 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 767 | Open in IMG/M |
| 3300010366|Ga0126379_11482078 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 784 | Open in IMG/M |
| 3300010376|Ga0126381_103357293 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 631 | Open in IMG/M |
| 3300011120|Ga0150983_13792194 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 874 | Open in IMG/M |
| 3300011120|Ga0150983_16127458 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 629 | Open in IMG/M |
| 3300011269|Ga0137392_11480838 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 538 | Open in IMG/M |
| 3300011270|Ga0137391_10115018 | All Organisms → cellular organisms → Bacteria | 2334 | Open in IMG/M |
| 3300011271|Ga0137393_10242211 | All Organisms → cellular organisms → Bacteria | 1529 | Open in IMG/M |
| 3300012189|Ga0137388_10011275 | All Organisms → cellular organisms → Bacteria | 6334 | Open in IMG/M |
| 3300012189|Ga0137388_10790106 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 880 | Open in IMG/M |
| 3300012203|Ga0137399_10660218 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 880 | Open in IMG/M |
| 3300012203|Ga0137399_11017054 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 698 | Open in IMG/M |
| 3300012205|Ga0137362_10486939 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1067 | Open in IMG/M |
| 3300012205|Ga0137362_11786378 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 502 | Open in IMG/M |
| 3300012206|Ga0137380_10026367 | All Organisms → cellular organisms → Bacteria | 5356 | Open in IMG/M |
| 3300012207|Ga0137381_10817726 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 807 | Open in IMG/M |
| 3300012356|Ga0137371_10433953 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1017 | Open in IMG/M |
| 3300012362|Ga0137361_11071560 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 726 | Open in IMG/M |
| 3300012582|Ga0137358_10601338 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 738 | Open in IMG/M |
| 3300012918|Ga0137396_10081827 | All Organisms → cellular organisms → Bacteria | 2276 | Open in IMG/M |
| 3300012918|Ga0137396_10288690 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1212 | Open in IMG/M |
| 3300012925|Ga0137419_10234893 | All Organisms → cellular organisms → Bacteria | 1374 | Open in IMG/M |
| 3300012929|Ga0137404_10368885 | All Organisms → cellular organisms → Bacteria | 1260 | Open in IMG/M |
| 3300012930|Ga0137407_10726472 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 936 | Open in IMG/M |
| 3300012971|Ga0126369_10480243 | All Organisms → cellular organisms → Bacteria | 1297 | Open in IMG/M |
| 3300015054|Ga0137420_1395366 | All Organisms → cellular organisms → Bacteria | 2774 | Open in IMG/M |
| 3300015242|Ga0137412_10781960 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 702 | Open in IMG/M |
| 3300015357|Ga0134072_10333366 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 577 | Open in IMG/M |
| 3300018482|Ga0066669_10837203 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 818 | Open in IMG/M |
| 3300020022|Ga0193733_1125059 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 708 | Open in IMG/M |
| 3300020170|Ga0179594_10342735 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 567 | Open in IMG/M |
| 3300020579|Ga0210407_10807742 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 723 | Open in IMG/M |
| 3300020582|Ga0210395_10353246 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1106 | Open in IMG/M |
| 3300020583|Ga0210401_10168526 | All Organisms → cellular organisms → Bacteria | 2044 | Open in IMG/M |
| 3300021086|Ga0179596_10249826 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 875 | Open in IMG/M |
| 3300021088|Ga0210404_10008736 | All Organisms → cellular organisms → Bacteria | 4103 | Open in IMG/M |
| 3300021088|Ga0210404_10174079 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1141 | Open in IMG/M |
| 3300021168|Ga0210406_10078343 | All Organisms → cellular organisms → Bacteria | 2831 | Open in IMG/M |
| 3300021171|Ga0210405_10689411 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 790 | Open in IMG/M |
| 3300021178|Ga0210408_11275860 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 558 | Open in IMG/M |
| 3300021401|Ga0210393_11406090 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 557 | Open in IMG/M |
| 3300021476|Ga0187846_10179688 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 890 | Open in IMG/M |
| 3300022531|Ga0242660_1121632 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 659 | Open in IMG/M |
| 3300025939|Ga0207665_10577866 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 876 | Open in IMG/M |
| 3300026496|Ga0257157_1086075 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 545 | Open in IMG/M |
| 3300026536|Ga0209058_1148502 | All Organisms → cellular organisms → Bacteria | 1106 | Open in IMG/M |
| 3300026552|Ga0209577_10355710 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1076 | Open in IMG/M |
| 3300027729|Ga0209248_10085463 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 955 | Open in IMG/M |
| 3300027846|Ga0209180_10120836 | All Organisms → cellular organisms → Bacteria | 1503 | Open in IMG/M |
| 3300027862|Ga0209701_10706985 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 519 | Open in IMG/M |
| 3300027882|Ga0209590_10140572 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1487 | Open in IMG/M |
| 3300027903|Ga0209488_11170473 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 520 | Open in IMG/M |
| 3300028047|Ga0209526_10158757 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1582 | Open in IMG/M |
| 3300028536|Ga0137415_10295052 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1425 | Open in IMG/M |
| 3300028906|Ga0308309_11518594 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 572 | Open in IMG/M |
| 3300030626|Ga0210291_10511428 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 749 | Open in IMG/M |
| 3300030813|Ga0265750_1068945 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 569 | Open in IMG/M |
| 3300030991|Ga0073994_12411087 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 633 | Open in IMG/M |
| 3300031231|Ga0170824_109886835 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1145 | Open in IMG/M |
| 3300031708|Ga0310686_106650605 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 773 | Open in IMG/M |
| 3300031720|Ga0307469_10808076 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 861 | Open in IMG/M |
| 3300031753|Ga0307477_10376711 | All Organisms → cellular organisms → Bacteria | 974 | Open in IMG/M |
| 3300031754|Ga0307475_11312026 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 560 | Open in IMG/M |
| 3300031860|Ga0318495_10349914 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 654 | Open in IMG/M |
| 3300031880|Ga0318544_10254976 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 679 | Open in IMG/M |
| 3300032001|Ga0306922_11420887 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 697 | Open in IMG/M |
| 3300032174|Ga0307470_11223183 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 611 | Open in IMG/M |
| 3300032180|Ga0307471_100513962 | All Organisms → cellular organisms → Bacteria | 1347 | Open in IMG/M |
| 3300032205|Ga0307472_102574868 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 518 | Open in IMG/M |
| 3300032261|Ga0306920_103884358 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 545 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 29.52% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 14.29% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 10.48% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 7.62% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 5.71% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 5.71% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 3.81% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 3.81% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.86% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 2.86% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 2.86% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.90% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.90% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.90% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.95% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.95% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.95% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 0.95% |
| Biofilm | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Biofilm | 0.95% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300002561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_40cm | Environmental | Open in IMG/M |
| 3300002908 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_40cm | Environmental | Open in IMG/M |
| 3300004119 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF210 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005174 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 | Environmental | Open in IMG/M |
| 3300005180 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
| 3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
| 3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
| 3300006034 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105 | Environmental | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
| 3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
| 3300006162 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 | Environmental | Open in IMG/M |
| 3300006172 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014 | Environmental | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300010322 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_0_1 metaG | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300015054 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015242 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015357 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_0_1 metaG | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300020022 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1s2 | Environmental | Open in IMG/M |
| 3300020170 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021086 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021476 | Biofilm microbial communities from the roof of an iron ore cave, State of Minas Gerais, Brazil - TC_06 Biofilm (v2) | Environmental | Open in IMG/M |
| 3300022531 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-28-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026496 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-69-A | Environmental | Open in IMG/M |
| 3300026536 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 (SPAdes) | Environmental | Open in IMG/M |
| 3300026552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes) | Environmental | Open in IMG/M |
| 3300027729 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027862 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300030626 | Metatranscriptome of forest soil microbial communities from Boreal Montmorency Forest, Quebec, Canada - FO410-VDE110SO (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030813 | Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSE1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030991 | Metatranscriptome of forest soil microbial communities from Montana, USA - Site 5 -Soil GP-1A (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031860 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f25 | Environmental | Open in IMG/M |
| 3300031880 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f25 | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12635J15846_101581181 | 3300001593 | Forest Soil | VSNTPQPAQAGPVILEGKHDGIATLVMNRPDRLNALNNELAM |
| JGIcombinedJ26739_1000531091 | 3300002245 | Forest Soil | VSNTPQPAQAGPVILEGKHDGIATLVMNRPDRLNA |
| JGI25384J37096_100075515 | 3300002561 | Grasslands Soil | MSNAAQSVTASPVVLETRHEAIATIVLNRPDRLNALNAEITIAL |
| JGI25382J43887_100473815 | 3300002908 | Grasslands Soil | VSNSPQPAQAGAVVLEKKHEGIATLVMNRPDRLNALNNELASALXDXTRASPRW* |
| Ga0058887_14523781 | 3300004119 | Forest Soil | MSNTAQTAQASPVLLEAKQEGIATLVMNRPDRLNALNTELAVAVNEA |
| Ga0066680_106073841 | 3300005174 | Soil | VSNTPQPAETRPVILEGRHDGIATLVMNRPDRLNALNNELAMAVNDA |
| Ga0066685_102187743 | 3300005180 | Soil | VSNPPQPAQAGALILEQRHEGIAVLVMNRPDRLNALNNELASALN |
| Ga0066388_1035518111 | 3300005332 | Tropical Forest Soil | MSNSPQPVPASSVLLEARHDAIATLVMNRPDRLNALDTKLVTALND |
| Ga0070733_107279332 | 3300005541 | Surface Soil | MSNAPQAAPTVPVILEGRQDGIATLVMNRPDRLNALNGELSTA |
| Ga0070733_111080782 | 3300005541 | Surface Soil | MSNAAQTAPSGPVILENRHDGIAVLVMNRPDKLNALNSELS |
| Ga0066701_101476601 | 3300005552 | Soil | VSNPPQLAQAGALILEQRHEGIAVLVMNRPDRLNALNNELAS |
| Ga0070763_108454551 | 3300005610 | Soil | MSNTAQTVQAGPVLLEAKQEGIATLVMNRPDRLNALNTELAVAVNEALGRIAKD |
| Ga0066656_105041791 | 3300006034 | Soil | MSNAAQSVTASPVVLETRHEAIATIVLNRPDRLNALNAE |
| Ga0066652_1000692874 | 3300006046 | Soil | MNNSPQPAQAGPVLLEAKHDAVAVLIMNRPDRLNALN |
| Ga0075029_1000443181 | 3300006052 | Watersheds | MSNTAQTAQAGPGLLEARHEGIATLVMNRPDRLNALNN |
| Ga0075017_1001794473 | 3300006059 | Watersheds | MSNAPQTAPAGPVVLETRHDSIVVLTMNRPDRLNALNNELASALNDAL |
| Ga0075030_1001218611 | 3300006162 | Watersheds | MSNAPQTAPAGPVVLETRHDSIVVLTMNRPDRLNALNNELASALNDALARVAL |
| Ga0075018_104758161 | 3300006172 | Watersheds | MSNAAQPAPAGPVLLESKHEGIATLVMNRPDKLNALNNELAIA |
| Ga0079222_100584671 | 3300006755 | Agricultural Soil | MSNSPQPAQAGPVLLETKQDGITTLVMNRADRLNALNTKLIMALGSA |
| Ga0066659_105271392 | 3300006797 | Soil | MTTSALPAPAGPVLLESKHNGVATLVMNRPERLNALNTKLVMALAS |
| Ga0066659_116014422 | 3300006797 | Soil | VSNPPQPAQAGSIILEQRHEGIAILVMNRPDRLNALNNELAS |
| Ga0066660_1000008415 | 3300006800 | Soil | MSNSPQPATAAPVLLEAKHHGIAKLVMNRPDRLNALDTKLVMALDGTLSRIA* |
| Ga0066660_102336863 | 3300006800 | Soil | MSHSPQPAQAGPVLHEAKHDGVAVLIMNRPDRLNALNNELTTALND |
| Ga0079219_105910732 | 3300006954 | Agricultural Soil | MSNSPQPAQAGPVLLETKQDGITTLVMNRADRLNALNT |
| Ga0079219_111182332 | 3300006954 | Agricultural Soil | VSNTPQPAQAGPIILEGKREGIATLVMNRPDRLNALNNELAS |
| Ga0099794_100095571 | 3300007265 | Vadose Zone Soil | MSHTPQAAPSTPVLLEAKHDGIATLVMNSTDRMNALNNELG |
| Ga0066710_1035927641 | 3300009012 | Grasslands Soil | VSNTPQTEEAGPVILEGKHDGIATLVMNRPDRLNALNNELAMAVNDA |
| Ga0099828_100310956 | 3300009089 | Vadose Zone Soil | MSHSPQTVQPGPVLLEGKHDGIATLVMNRPDRMNALNNELALALNDALAR |
| Ga0099827_108225072 | 3300009090 | Vadose Zone Soil | MSNAPQPAQAGPVIVEAKHEGIATLVMNRPERLNALNNELAMAVNDALSRFAA |
| Ga0126374_100855303 | 3300009792 | Tropical Forest Soil | MSNSPQPAPASFVLLEARHDSIATLVMNRPDRLNALDTK |
| Ga0134084_102526452 | 3300010322 | Grasslands Soil | MSNSAQPAPAAPVLLEARHEGIATLVMNRPDRLNALNTKLI |
| Ga0134064_100389003 | 3300010325 | Grasslands Soil | VSNPPQPAQAGALILEQRHEGIAVLVMNRPDRLNALNNELASALNDALGRIAK |
| Ga0126370_111598971 | 3300010358 | Tropical Forest Soil | MSNSPQPAQAGPVLLETKHDGITILVMNRPDRLNAL |
| Ga0126370_119734562 | 3300010358 | Tropical Forest Soil | MSNPPQPAQAGPVLLETKQEGITTLVMNRPDRLNALNNELATALND |
| Ga0126378_100413131 | 3300010361 | Tropical Forest Soil | MSNSPQPAQASPVLLETKHDGIATLVMNRPDRLNALNNEL |
| Ga0126378_114910122 | 3300010361 | Tropical Forest Soil | MSNAPQQAQAGPVLLETKHDGIASLVMNRPDRLNALNNELTTALNDA |
| Ga0126379_114820782 | 3300010366 | Tropical Forest Soil | MSNSPQPAQAGPVLHEARHDGVAVLVMSRPDRLNALNNELATALNDSLGRIAKDES |
| Ga0126381_1033572932 | 3300010376 | Tropical Forest Soil | MSNSPQPAQVSPVLLETKHDGIATMVMNRPDRLNALNN |
| Ga0150983_137921942 | 3300011120 | Forest Soil | MSNAAQTASAGPVILESQYDGIAVLMMNRPDKLNA |
| Ga0150983_161274581 | 3300011120 | Forest Soil | MSNTAQTAQAGPVLLEAKHEGIATLVMNRPDRLNA |
| Ga0137392_114808382 | 3300011269 | Vadose Zone Soil | MSNAPQTAPSGPLVLASQAEGITTLVLNRPERLNALNNELAMALND |
| Ga0137391_101150185 | 3300011270 | Vadose Zone Soil | VSNSAQTAQAGPVVLEAKHDGIATLVMNRPDRLNALNNELAMAVN |
| Ga0137393_102422111 | 3300011271 | Vadose Zone Soil | VSNTPQPAQAGPVILEGKHDGIATLVMNRPDRLNALNNELAMAVNDALGRIAE |
| Ga0137388_100112759 | 3300012189 | Vadose Zone Soil | MSNAPQPAPAGPIILEGKHDGIATLVMNRPDRLNALNIELGSALND |
| Ga0137388_107901061 | 3300012189 | Vadose Zone Soil | VSNTPQPAQAGPVILEGKHDGIATLVLNRPERLNALNNELASALNEALGRIA |
| Ga0137399_106602182 | 3300012203 | Vadose Zone Soil | VSNTPQPTQAGPVILEEKHDGIAALVMNRPDRLNALNNELAMA |
| Ga0137399_110170542 | 3300012203 | Vadose Zone Soil | VSNTPQTAQAGPVILEGKYDGIATLVMNRPDRLNALNNELAMAV |
| Ga0137362_104869391 | 3300012205 | Vadose Zone Soil | VSNTPQPAQAPVILEGKHDGIATLVLNRPERLNALNNELA |
| Ga0137362_117863782 | 3300012205 | Vadose Zone Soil | LSNTPQPAQAGPVILEGKHDGIATLVMNRPDRLNALNNELAMAV |
| Ga0137380_100263671 | 3300012206 | Vadose Zone Soil | MSHSPQAAQPGPVLLEGKHEGIATLVMNRPDRLNALNNELA |
| Ga0137381_108177261 | 3300012207 | Vadose Zone Soil | VSNTPQPAQAGPVLLERKHEGIAALVMNRPDRLNALNNELASALNEAL |
| Ga0137371_104339532 | 3300012356 | Vadose Zone Soil | VSNSPQPAQAGAVVLEKKHEGIATLVMNRPDRLNALNNELA |
| Ga0137361_110715601 | 3300012362 | Vadose Zone Soil | VSNTPQPAQAGPVILEGKHDGIATLVMNRPDRLNALNNELAMAVNDAL |
| Ga0137358_106013381 | 3300012582 | Vadose Zone Soil | VSNTPQLAPGGPVLLEAQHEGIATLVMNRPDRLNALNNELAIAVNDALGRLA |
| Ga0137396_100818271 | 3300012918 | Vadose Zone Soil | VSNSPQPAQAGAILLEAKHEGIATLVMNRPDRLNALNNELASALNEA |
| Ga0137396_102886901 | 3300012918 | Vadose Zone Soil | MSNSPQAVPSPPLVLEAKHDGIATLVMNRPDRMNA |
| Ga0137419_102348931 | 3300012925 | Vadose Zone Soil | VSNSPQPSQAAPVLQEAKHEGIATLVLNRPERLNALNNELASA |
| Ga0137404_103688853 | 3300012929 | Vadose Zone Soil | MSQTPQAAPSTPVLLEAKHDGIATLVMNRPDRMNALNNELGVAIDEALG |
| Ga0137407_107264723 | 3300012930 | Vadose Zone Soil | VSNTPQLAPSGPVILEGKHDGIATLVMNRPDRLNALNSELA |
| Ga0126369_104802433 | 3300012971 | Tropical Forest Soil | MSNSPQPAQAGPVLHQARQDGVAVLVMNRPDRLNALNNELGTALND |
| Ga0137420_13953664 | 3300015054 | Vadose Zone Soil | MSNSPQPAQAGPVLLEGKHEGIATLVMNRPDRLNALNNDWPRR* |
| Ga0137412_107819602 | 3300015242 | Vadose Zone Soil | LPVSNTPQPAETRPVILEGRHEGIATLVMNRPDRLNALNNELAMA |
| Ga0134072_103333662 | 3300015357 | Grasslands Soil | VSNTLQPAETRPVILERRHDGIATLVMNRPDRLNALN |
| Ga0066669_108372032 | 3300018482 | Grasslands Soil | VSNTLQPAETRPVILERRHDGIATLLMNRPDRLNALNNELAMAVNDVLVRLADDQS |
| Ga0193733_11250591 | 3300020022 | Soil | VSNTPQPAETRPVILEGRHDGIATLVMNRPDRLNALNN |
| Ga0179594_103427351 | 3300020170 | Vadose Zone Soil | VSNTPQLAPGGPVILEGKHDGIATLVMNRPDRLNALNSE |
| Ga0210407_108077422 | 3300020579 | Soil | MSNAAQSAQEGPVILERKYEGIATLVMNRPDRLNALNNELGIALNEALGRLAAD |
| Ga0210395_103532461 | 3300020582 | Soil | MSNAAQSAQEGPVILERKYEGIATLVMNRPDRLNALNNELGI |
| Ga0210401_101685264 | 3300020583 | Soil | MSNAPQAAPSGPVILESKQDGIALLVMNRPDKLNALN |
| Ga0179596_102498261 | 3300021086 | Vadose Zone Soil | VSNSPQPAQAGPVILEGKHDGIATLVMNRPDRLNALNNE |
| Ga0210404_100087366 | 3300021088 | Soil | MSNTAQPAQAGPVLVEGKHDGIATLVMNRPDRLNALNTEL |
| Ga0210404_101740793 | 3300021088 | Soil | MSNSPQPAQAGPVLLEAKHEGIATLVLNRPDRLNALNNELASAL |
| Ga0210406_100783436 | 3300021168 | Soil | MSNATQTASTGPVMLESHHDGIAVLVMNRPDKLNALNSA |
| Ga0210405_106894111 | 3300021171 | Soil | MSNATQTAPAGPVVLETRHDTIAVLTMNRPDRLNALNNELASTLNDALA |
| Ga0210408_112758602 | 3300021178 | Soil | MSNSPRPAQAGAVLLEAKHEGIATLVLNRPERLNALNN |
| Ga0210393_114060902 | 3300021401 | Soil | MSNAAQTAPSGPVILENRHDGIAVLVMNRPDKLNALN |
| Ga0187846_101796882 | 3300021476 | Biofilm | MSHSPQTVPAGSVLLEAKHDGIATLVMNRPDRLNALNNELA |
| Ga0242660_11216322 | 3300022531 | Soil | VSNTPQTAQAGPVILEGKHDGIATLVMNRPDRLNALNNE |
| Ga0207665_105778661 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | VSNTPQPAETRPVILEGRHDGIATLVMNRPDRLNALNNELAMAVN |
| Ga0257157_10860752 | 3300026496 | Soil | VSNSPQPAQAAPVLQEAKHEGIATLVLNRPERLNALNNELASALNDALGRIAADD |
| Ga0209058_11485021 | 3300026536 | Soil | VSNTPQLAQAGPVILEGKHDGIATLVMNRPDRLNAL |
| Ga0209577_103557103 | 3300026552 | Soil | VSNSPQPAQAGAVVLEKKHEGIATLVMNRPDRLNALNN |
| Ga0209248_100854631 | 3300027729 | Bog Forest Soil | MSDAPQAAPSGPVILESKHDGIALLVMNRPDKLNALN |
| Ga0209180_101208363 | 3300027846 | Vadose Zone Soil | VSNSPQPAQAGPVILEGKHDGIATLVMNRPDRLNALNNELAMAVNDALGR |
| Ga0209701_107069851 | 3300027862 | Vadose Zone Soil | MSTPTQAASTGPIVLESRHDGIAILVLNRPDRLNALNNELA |
| Ga0209590_101405724 | 3300027882 | Vadose Zone Soil | VSNTPQTAEAGPVILEGKHDGIATLVMNRPDRLNALNNELAMAVNDALGRIAE |
| Ga0209488_111704731 | 3300027903 | Vadose Zone Soil | VSNTPQPAQAGPVILEGEHDGIATLVMNRPDRLNALNNELAMAVND |
| Ga0209526_101587572 | 3300028047 | Forest Soil | MSNATQPVEAGPLVLEDRRDGIATLVMNRPGRLNALNNELAIAINEALFA |
| Ga0137415_102950524 | 3300028536 | Vadose Zone Soil | VSNTPQPAQAGTIILEGKHDGIATLVLNRPDRLNALNNELATALNDALGRI |
| Ga0308309_115185942 | 3300028906 | Soil | MMSNAAQSAQEEPVILERKHEGIATLVMNRPDRLNALNNE |
| Ga0210291_105114282 | 3300030626 | Soil | MSNAAQAAPTGPVILESKHDSVVVLVMNRPDKLNA |
| Ga0265750_10689452 | 3300030813 | Soil | MSNASQAAPAGPVILEDKHDGIATLLLNRPDKLNALNSDLS |
| Ga0073994_124110871 | 3300030991 | Soil | VSNTPQPAQAGPVILEGKHDGIATLVMNRPDRLNALNNELAMAVNDALGRIAG |
| Ga0170824_1098868353 | 3300031231 | Forest Soil | MSNPAQAAAGPVLLEGKHDGIATLVMNRPDKLNALNSE |
| Ga0310686_1066506052 | 3300031708 | Soil | MSNAPQTAPAGPVLLEAKHGGIALLVLNRHDKLNALN |
| Ga0307469_108080761 | 3300031720 | Hardwood Forest Soil | VSNPPQPAQAGPVILEGKHDGIATLVMNRPDRLNALNNELAMAVNDALGRIAK |
| Ga0307477_103767111 | 3300031753 | Hardwood Forest Soil | VSHTPQAAQAGPLILETRHEGIVTLVMNRPDRLNALNNELAMAVNDALGR |
| Ga0307475_113120262 | 3300031754 | Hardwood Forest Soil | VSNTPQLAPGGPVLLEAQHEGIATLVMNRPDRLNALNNELAIAVNDAL |
| Ga0318495_103499142 | 3300031860 | Soil | MSNSPQPAPAPSVLLEARHDGVATLVMNRPDRLNALDTKLVTTLNDA |
| Ga0318544_102549761 | 3300031880 | Soil | MSNSPQPAPAPSVLLEARHDGVATLVMNRPDRLNALDTKLVTTLN |
| Ga0306922_114208872 | 3300032001 | Soil | MSDSPQPAQAGPVLLESRHDGIVTLVMNRPDRLNALNAKLVA |
| Ga0307470_112231831 | 3300032174 | Hardwood Forest Soil | MSNVPQPVQAASVLLEARHEGIATLVMNRPDRLNALDTK |
| Ga0307471_1005139623 | 3300032180 | Hardwood Forest Soil | VSNPPQPAQAGPVILEGKHDGIATLVMNRPDRLNALNNELAMAV |
| Ga0307472_1025748682 | 3300032205 | Hardwood Forest Soil | MSQTPQAAPSTPVVLETKHEGIATLVMNRPDRMNALNNELGVAMDEALGRI |
| Ga0306920_1038843582 | 3300032261 | Soil | MSNSPQPAQAGPVLLETRHEGITTLVMNRPDRLNALN |
| ⦗Top⦘ |