NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F095853

Metagenome / Metatranscriptome Family F095853

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F095853
Family Type Metagenome / Metatranscriptome
Number of Sequences 105
Average Sequence Length 46 residues
Representative Sequence VILLALWRRGLLRRVDREKLRHFLGRHRDPLALSRRYPMWRIL
Number of Associated Samples 97
Number of Associated Scaffolds 105

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 80.95 %
% of genes near scaffold ends (potentially truncated) 99.05 %
% of genes from short scaffolds (< 2000 bps) 95.24 %
Associated GOLD sequencing projects 90
AlphaFold2 3D model prediction Yes
3D model pTM-score0.26

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (98.095 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil
(16.191 % of family members)
Environment Ontology (ENVO) Unclassified
(24.762 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(47.619 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 43.66%    β-sheet: 0.00%    Coil/Unstructured: 56.34%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.26
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 105 Family Scaffolds
PF12838Fer4_7 74.29
PF00037Fer4 10.48
PF02190LON_substr_bdg 9.52
PF03741TerC 0.95
PF00595PDZ 0.95
PF12007DUF3501 0.95
PF02754CCG 0.95
PF16881LIAS_N 0.95

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 105 Family Scaffolds
COG0247Fe-S cluster-containing oxidoreductase, includes glycolate oxidase subunit GlcFEnergy production and conversion [C] 0.95
COG0861Tellurite resistance membrane protein TerCInorganic ion transport and metabolism [P] 0.95
COG2048Heterodisulfide reductase, subunit BEnergy production and conversion [C] 0.95

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms98.10 %
UnclassifiedrootN/A1.90 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000891|JGI10214J12806_11573042All Organisms → cellular organisms → Bacteria734Open in IMG/M
3300004479|Ga0062595_101395420All Organisms → cellular organisms → Bacteria638Open in IMG/M
3300004643|Ga0062591_100705907All Organisms → cellular organisms → Bacteria913Open in IMG/M
3300004643|Ga0062591_100909920All Organisms → cellular organisms → Bacteria826Open in IMG/M
3300005167|Ga0066672_10177810All Organisms → cellular organisms → Bacteria1347Open in IMG/M
3300005172|Ga0066683_10214604All Organisms → cellular organisms → Bacteria1189Open in IMG/M
3300005177|Ga0066690_10215255All Organisms → cellular organisms → Bacteria1282Open in IMG/M
3300005180|Ga0066685_10857514All Organisms → cellular organisms → Bacteria610Open in IMG/M
3300005206|Ga0068995_10143743All Organisms → cellular organisms → Bacteria515Open in IMG/M
3300005328|Ga0070676_11419729All Organisms → cellular organisms → Bacteria533Open in IMG/M
3300005331|Ga0070670_100626651All Organisms → cellular organisms → Bacteria964Open in IMG/M
3300005332|Ga0066388_101415674All Organisms → cellular organisms → Bacteria1209Open in IMG/M
3300005332|Ga0066388_102837806All Organisms → cellular organisms → Bacteria885Open in IMG/M
3300005332|Ga0066388_104460380All Organisms → cellular organisms → Bacteria713Open in IMG/M
3300005440|Ga0070705_100948925All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria695Open in IMG/M
3300005455|Ga0070663_100632711All Organisms → cellular organisms → Bacteria903Open in IMG/M
3300005543|Ga0070672_101183231All Organisms → cellular organisms → Bacteria681Open in IMG/M
3300005552|Ga0066701_10185532All Organisms → cellular organisms → Bacteria1269Open in IMG/M
3300005553|Ga0066695_10235569All Organisms → cellular organisms → Bacteria1154Open in IMG/M
3300005568|Ga0066703_10828669All Organisms → cellular organisms → Bacteria528Open in IMG/M
3300005713|Ga0066905_100128961All Organisms → cellular organisms → Bacteria1781Open in IMG/M
3300005713|Ga0066905_100418764All Organisms → cellular organisms → Bacteria1092Open in IMG/M
3300005718|Ga0068866_11106521All Organisms → cellular organisms → Bacteria568Open in IMG/M
3300005842|Ga0068858_101065378All Organisms → cellular organisms → Bacteria793Open in IMG/M
3300006031|Ga0066651_10012629All Organisms → cellular organisms → Bacteria3468Open in IMG/M
3300006032|Ga0066696_10001704All Organisms → cellular organisms → Bacteria9521Open in IMG/M
3300006175|Ga0070712_100885930All Organisms → cellular organisms → Bacteria769Open in IMG/M
3300006797|Ga0066659_11217480Not Available629Open in IMG/M
3300006904|Ga0075424_100214350All Organisms → cellular organisms → Bacteria2046Open in IMG/M
3300006904|Ga0075424_101779424All Organisms → cellular organisms → Bacteria652Open in IMG/M
3300007076|Ga0075435_101553282All Organisms → cellular organisms → Bacteria580Open in IMG/M
3300009038|Ga0099829_11168305All Organisms → cellular organisms → Bacteria638Open in IMG/M
3300009038|Ga0099829_11292788All Organisms → cellular organisms → Bacteria603Open in IMG/M
3300009100|Ga0075418_12893738All Organisms → cellular organisms → Bacteria524Open in IMG/M
3300009177|Ga0105248_11710405All Organisms → cellular organisms → Bacteria713Open in IMG/M
3300010043|Ga0126380_10605219All Organisms → cellular organisms → Bacteria864Open in IMG/M
3300010142|Ga0127483_1177031All Organisms → cellular organisms → Bacteria677Open in IMG/M
3300010322|Ga0134084_10097641All Organisms → cellular organisms → Bacteria934Open in IMG/M
3300010322|Ga0134084_10121298All Organisms → cellular organisms → Bacteria854Open in IMG/M
3300010335|Ga0134063_10554104All Organisms → cellular organisms → Bacteria581Open in IMG/M
3300010398|Ga0126383_11206498All Organisms → cellular organisms → Bacteria846Open in IMG/M
3300010400|Ga0134122_10930497All Organisms → cellular organisms → Bacteria844Open in IMG/M
3300011429|Ga0137455_1042356All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria1276Open in IMG/M
3300012351|Ga0137386_10276136All Organisms → cellular organisms → Bacteria1209Open in IMG/M
3300012398|Ga0134051_1291237All Organisms → cellular organisms → Bacteria873Open in IMG/M
3300012929|Ga0137404_10505985All Organisms → cellular organisms → Bacteria1078Open in IMG/M
3300012958|Ga0164299_10614493All Organisms → cellular organisms → Bacteria745Open in IMG/M
3300012972|Ga0134077_10420413All Organisms → cellular organisms → Bacteria580Open in IMG/M
3300015240|Ga0182876_10035573All Organisms → cellular organisms → Bacteria688Open in IMG/M
3300015264|Ga0137403_11013108All Organisms → cellular organisms → Bacteria677Open in IMG/M
3300015374|Ga0132255_103934569All Organisms → cellular organisms → Bacteria631Open in IMG/M
3300016341|Ga0182035_10319205All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria1280Open in IMG/M
3300016422|Ga0182039_11862499All Organisms → cellular organisms → Bacteria552Open in IMG/M
3300016422|Ga0182039_11867256All Organisms → cellular organisms → Bacteria551Open in IMG/M
3300017792|Ga0163161_11286830All Organisms → cellular organisms → Bacteria635Open in IMG/M
3300017973|Ga0187780_11258971All Organisms → cellular organisms → Bacteria543Open in IMG/M
3300018060|Ga0187765_11236641All Organisms → cellular organisms → Bacteria526Open in IMG/M
3300018064|Ga0187773_10492720All Organisms → cellular organisms → Bacteria729Open in IMG/M
3300018431|Ga0066655_10217778All Organisms → cellular organisms → Bacteria1194Open in IMG/M
3300018468|Ga0066662_10954292All Organisms → cellular organisms → Bacteria846Open in IMG/M
(restricted) 3300024054|Ga0233425_10423954All Organisms → cellular organisms → Bacteria547Open in IMG/M
3300024330|Ga0137417_1297997All Organisms → cellular organisms → Bacteria578Open in IMG/M
3300025165|Ga0209108_10481284All Organisms → cellular organisms → Bacteria598Open in IMG/M
3300025899|Ga0207642_10861375All Organisms → cellular organisms → Bacteria579Open in IMG/M
3300025907|Ga0207645_10366867All Organisms → cellular organisms → Bacteria965Open in IMG/M
3300025910|Ga0207684_10437256All Organisms → cellular organisms → Bacteria1124Open in IMG/M
3300025920|Ga0207649_11684863All Organisms → cellular organisms → Bacteria502Open in IMG/M
3300025933|Ga0207706_10384485Not Available1218Open in IMG/M
3300026067|Ga0207678_10703147All Organisms → cellular organisms → Bacteria890Open in IMG/M
3300026298|Ga0209236_1248812All Organisms → cellular organisms → Bacteria588Open in IMG/M
3300026306|Ga0209468_1201104All Organisms → cellular organisms → Bacteria505Open in IMG/M
3300026309|Ga0209055_1227965All Organisms → cellular organisms → Bacteria572Open in IMG/M
3300026310|Ga0209239_1261747All Organisms → cellular organisms → Bacteria596Open in IMG/M
3300026317|Ga0209154_1112069All Organisms → cellular organisms → Bacteria1157Open in IMG/M
3300026323|Ga0209472_1288382All Organisms → cellular organisms → Bacteria524Open in IMG/M
3300026326|Ga0209801_1290565All Organisms → cellular organisms → Bacteria587Open in IMG/M
3300026540|Ga0209376_1420539All Organisms → cellular organisms → Bacteria500Open in IMG/M
3300027886|Ga0209486_10839257All Organisms → cellular organisms → Bacteria604Open in IMG/M
3300027900|Ga0209253_10764134All Organisms → cellular organisms → Bacteria691Open in IMG/M
(restricted) 3300027995|Ga0233418_10179744All Organisms → cellular organisms → Bacteria688Open in IMG/M
3300030336|Ga0247826_10638986All Organisms → cellular organisms → Bacteria820Open in IMG/M
3300031368|Ga0307429_1119275All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium727Open in IMG/M
3300031543|Ga0318516_10182207All Organisms → cellular organisms → Bacteria1210Open in IMG/M
3300031640|Ga0318555_10346874All Organisms → cellular organisms → Bacteria804Open in IMG/M
3300031681|Ga0318572_10663852All Organisms → cellular organisms → Bacteria621Open in IMG/M
3300031682|Ga0318560_10819691All Organisms → cellular organisms → Bacteria502Open in IMG/M
3300031736|Ga0318501_10320437All Organisms → cellular organisms → Bacteria830Open in IMG/M
3300031751|Ga0318494_10722506All Organisms → cellular organisms → Bacteria583Open in IMG/M
3300031765|Ga0318554_10609924All Organisms → cellular organisms → Bacteria615Open in IMG/M
3300031770|Ga0318521_10820049All Organisms → cellular organisms → Bacteria567Open in IMG/M
3300031771|Ga0318546_10658909All Organisms → cellular organisms → Bacteria736Open in IMG/M
3300031782|Ga0318552_10359158All Organisms → cellular organisms → Bacteria742Open in IMG/M
3300031799|Ga0318565_10305626All Organisms → cellular organisms → Bacteria772Open in IMG/M
3300031897|Ga0318520_10860315All Organisms → cellular organisms → Bacteria570Open in IMG/M
3300031910|Ga0306923_10586377All Organisms → cellular organisms → Bacteria1253Open in IMG/M
3300031912|Ga0306921_11485189All Organisms → cellular organisms → Bacteria741Open in IMG/M
3300031954|Ga0306926_12516410All Organisms → cellular organisms → Bacteria564Open in IMG/M
3300032010|Ga0318569_10305296All Organisms → cellular organisms → Bacteria740Open in IMG/M
3300032035|Ga0310911_10899110All Organisms → cellular organisms → Bacteria511Open in IMG/M
3300032063|Ga0318504_10193957All Organisms → cellular organisms → Bacteria947Open in IMG/M
3300032075|Ga0310890_11856082All Organisms → cellular organisms → Bacteria502Open in IMG/M
3300032076|Ga0306924_11894062All Organisms → cellular organisms → Bacteria618Open in IMG/M
3300032090|Ga0318518_10048183All Organisms → cellular organisms → Bacteria2017Open in IMG/M
3300033487|Ga0316630_10030096All Organisms → cellular organisms → Bacteria3099Open in IMG/M
3300034151|Ga0364935_0321304All Organisms → cellular organisms → Bacteria513Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil16.19%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil15.24%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil6.67%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil5.71%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil5.71%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil4.76%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil3.81%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere3.81%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere3.81%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil2.86%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland2.86%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere2.86%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere2.86%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil1.90%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil1.90%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere1.90%
Freshwater Lake SedimentEnvironmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment0.95%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater0.95%
Microbial MatEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Microbial Mat0.95%
SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Sediment0.95%
Salt MarshEnvironmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh0.95%
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands0.95%
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil0.95%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.95%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.95%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil0.95%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil0.95%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil0.95%
SedimentEnvironmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment0.95%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.95%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.95%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.95%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.95%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere0.95%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000891Soil microbial communities from Great Prairies - Wisconsin, Continuous corn soilEnvironmentalOpen in IMG/M
3300004479Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAsEnvironmentalOpen in IMG/M
3300004643Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3EnvironmentalOpen in IMG/M
3300005167Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121EnvironmentalOpen in IMG/M
3300005172Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132EnvironmentalOpen in IMG/M
3300005177Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139EnvironmentalOpen in IMG/M
3300005180Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134EnvironmentalOpen in IMG/M
3300005206Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_ThreeSqB_D2EnvironmentalOpen in IMG/M
3300005328Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaGHost-AssociatedOpen in IMG/M
3300005331Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaGHost-AssociatedOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005440Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaGEnvironmentalOpen in IMG/M
3300005455Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaGHost-AssociatedOpen in IMG/M
3300005543Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaGHost-AssociatedOpen in IMG/M
3300005552Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150EnvironmentalOpen in IMG/M
3300005553Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144EnvironmentalOpen in IMG/M
3300005568Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152EnvironmentalOpen in IMG/M
3300005713Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2)EnvironmentalOpen in IMG/M
3300005718Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2Host-AssociatedOpen in IMG/M
3300005842Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2Host-AssociatedOpen in IMG/M
3300006031Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100EnvironmentalOpen in IMG/M
3300006032Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145EnvironmentalOpen in IMG/M
3300006175Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaGEnvironmentalOpen in IMG/M
3300006797Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108EnvironmentalOpen in IMG/M
3300006904Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3Host-AssociatedOpen in IMG/M
3300007076Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4Host-AssociatedOpen in IMG/M
3300009038Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaGEnvironmentalOpen in IMG/M
3300009100Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2Host-AssociatedOpen in IMG/M
3300009177Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaGHost-AssociatedOpen in IMG/M
3300010043Tropical forest soil microbial communities from Panama - MetaG Plot_26EnvironmentalOpen in IMG/M
3300010142Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_40_2_4_1 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010322Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300010335Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015EnvironmentalOpen in IMG/M
3300010398Tropical forest soil microbial communities from Panama - MetaG Plot_35EnvironmentalOpen in IMG/M
3300010400Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2EnvironmentalOpen in IMG/M
3300011429Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT600_2EnvironmentalOpen in IMG/M
3300012351Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaGEnvironmentalOpen in IMG/M
3300012398Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_24_2 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012929Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012958Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MGEnvironmentalOpen in IMG/M
3300012972Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300015240Freshwater microbial mat microbial communities from Canadian High Arctic Lake 9K, Kuujjuarapik, Canada - Sample L9KcEnvironmentalOpen in IMG/M
3300015264Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300016341Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170EnvironmentalOpen in IMG/M
3300016422Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111EnvironmentalOpen in IMG/M
3300017792Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaGHost-AssociatedOpen in IMG/M
3300017973Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MGEnvironmentalOpen in IMG/M
3300018060Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MGEnvironmentalOpen in IMG/M
3300018064Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_10_MGEnvironmentalOpen in IMG/M
3300018431Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104EnvironmentalOpen in IMG/M
3300018468Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111EnvironmentalOpen in IMG/M
3300024054 (restricted)Freshwater microbial communities from Lake Towuti, South Sulawesi, Indonesia - Watercolumn_Towuti2014_140_MGEnvironmentalOpen in IMG/M
3300024330Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (PacBio error correction)EnvironmentalOpen in IMG/M
3300025165Soil microbial communities from Rifle, Colorado, USA - sediment 10ft 1EnvironmentalOpen in IMG/M
3300025899Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025907Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025910Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025920Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025933Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026067Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026298Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cm (SPAdes)EnvironmentalOpen in IMG/M
3300026306Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 (SPAdes)EnvironmentalOpen in IMG/M
3300026309Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 (SPAdes)EnvironmentalOpen in IMG/M
3300026310Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm (SPAdes)EnvironmentalOpen in IMG/M
3300026317Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 (SPAdes)EnvironmentalOpen in IMG/M
3300026323Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 (SPAdes)EnvironmentalOpen in IMG/M
3300026326Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 (SPAdes)EnvironmentalOpen in IMG/M
3300026540Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 (SPAdes)EnvironmentalOpen in IMG/M
3300027886Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost (SPAdes)EnvironmentalOpen in IMG/M
3300027900Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - BRP12 BR (SPAdes)EnvironmentalOpen in IMG/M
3300027995 (restricted)Sediment microbial communities from Lake Towuti, South Sulawesi, Indonesia - Sediment_Towuti_2014_1_MGEnvironmentalOpen in IMG/M
3300030336Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day1EnvironmentalOpen in IMG/M
3300031368Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - WE1603-230EnvironmentalOpen in IMG/M
3300031543Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20EnvironmentalOpen in IMG/M
3300031640Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23EnvironmentalOpen in IMG/M
3300031681Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20EnvironmentalOpen in IMG/M
3300031682Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22EnvironmentalOpen in IMG/M
3300031736Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21EnvironmentalOpen in IMG/M
3300031751Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24EnvironmentalOpen in IMG/M
3300031765Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22EnvironmentalOpen in IMG/M
3300031770Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17EnvironmentalOpen in IMG/M
3300031771Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19EnvironmentalOpen in IMG/M
3300031782Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f20EnvironmentalOpen in IMG/M
3300031799Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f21EnvironmentalOpen in IMG/M
3300031897Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16EnvironmentalOpen in IMG/M
3300031910Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2)EnvironmentalOpen in IMG/M
3300031912Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2)EnvironmentalOpen in IMG/M
3300031954Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2)EnvironmentalOpen in IMG/M
3300032010Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f22EnvironmentalOpen in IMG/M
3300032035Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170EnvironmentalOpen in IMG/M
3300032063Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f17EnvironmentalOpen in IMG/M
3300032075Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3EnvironmentalOpen in IMG/M
3300032076Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2)EnvironmentalOpen in IMG/M
3300032090Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f22EnvironmentalOpen in IMG/M
3300033487Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_May_M1_C1_D6_AEnvironmentalOpen in IMG/M
3300034151Sediment microbial communities from East River floodplain, Colorado, United States - 2_s17EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
JGI10214J12806_1157304223300000891SoilMIFLALWRRGLFRRMDREKLRQFLGFSSDRLALSRRYPLWW
Ga0062595_10139542013300004479SoilVIFLALWRRGLLRRADREKLGYFLGTAGGPLALSRRYPLWRILRP
Ga0062591_10070590723300004643SoilVILWVLWRRGLLRRLDREKTAFFLGVGGDRLELSRRYPLWRRLGLLHMMVS
Ga0062591_10090992013300004643SoilVIFYALWRRGLLRRADREKLGYFLGVAGGPLTLSRRYPLWRILR
Ga0066672_1017781013300005167SoilMILLALWRRGLLRRLDREKLAHFIGWRPDPLALSRRYPMWRI
Ga0066683_1021460413300005172SoilVILVALWRRGLLERADREKLRHFLGLARDPLALSRRYPMWRILGPMRLLFSPRYAEAVA
Ga0066690_1021525533300005177SoilMILLALWRRGLLGRVDGEKLRYFLGRNADPLTLSRRYPLWR
Ga0066685_1085751423300005180SoilMILLALWRRGLLRRLDREKLAHFIGWRPDPLALSRRYPMWRIL
Ga0068995_1014374313300005206Natural And Restored WetlandsVIFLALWRRGLLRRADREKLGYFLGTAGGPLALSRHYPLWRILRPIRLLVSPRYAEAVA
Ga0070676_1141972913300005328Miscanthus RhizosphereVILWVLWRRGLLRRLDREKTAFFLGVGGDRLELSRRYPLWRRLGLLHMMVSPAYAAGVA
Ga0070670_10062665133300005331Switchgrass RhizosphereVILLALWRRGLLRRLDREKLRQFWGLRRDPLLLSRRYPMWRT
Ga0066388_10141567413300005332Tropical Forest SoilVILWALWRRGLLRRIDGEKIRFFLGLGGDPLFLSRRFPLWRRLGIARLLV
Ga0066388_10283780623300005332Tropical Forest SoilVILLALWRRGLLQRADREKIALFLGRARDPLQLSRRYPLWRSLGLLRL
Ga0066388_10446038013300005332Tropical Forest SoilVILLELWRRGLLARADREKLRHFVGLARDPLALSRRYPMWRIL
Ga0070705_10094892523300005440Corn, Switchgrass And Miscanthus RhizosphereMIFLALWRRGLLRRIDGEKLRQLLGFSSDRLALSRRYPLWWALGPFML
Ga0070663_10063271113300005455Corn RhizosphereVILLALWRRGLLRRADREKLGYFLGIAGGPLTLSRRYPLWRILRP
Ga0070672_10118323113300005543Miscanthus RhizosphereMIFLALWRRGLLRRIDGEKLRQFLGFGSDRLALSRRYPLWW
Ga0066701_1018553213300005552SoilVILLALWRRGLFRRLDGEKLRHFLGWHRDPLALSRRYPMWRIL
Ga0066695_1023556913300005553SoilVILLALWRRGLLRRVDREKLRHFLGRHRDPLALSRRYPMWRIL
Ga0066703_1082866913300005568SoilMILLALWRRGLLRRLDREKLAHFIGWRPDPLALSRRYPMWRILRIGRLLI
Ga0066905_10012896143300005713Tropical Forest SoilVIVWALWRRGLLRRIDGEKIRFFLGLGADPLYLSRRYPLWRRLGIARLL
Ga0066905_10041876413300005713Tropical Forest SoilVILLALWRRGLLGRLDGEKMRFFLGRSGDPLALSRRYPMWRILSAVRL
Ga0068866_1110652113300005718Miscanthus RhizosphereVIFLALWRRGLFRRADREKLGYFFGLSPDPLALSRRFPMWRILSVPR
Ga0068858_10106537813300005842Switchgrass RhizosphereVILLALWRRGLLRRADREKLGYFLGIAGGPLTLSRR
Ga0066651_1001262913300006031SoilMILLALWRRGLLRRLDREKLAHFIGWRPDPLALSRRYPMWRILRI
Ga0066696_1000170413300006032SoilVILLALWRRGLLRRVDREKLRHFLGRHRDPLALSRRYPMWRILDIGRLLV
Ga0070712_10088593023300006175Corn, Switchgrass And Miscanthus RhizosphereMILLALWRRGLLRRMDGEKLRQFLGFSQDRLALSRRYPMW
Ga0066659_1121748013300006797SoilVILILLWRRGLLRRAGREKLRHFVGLAHDPLALSRRYP
Ga0075424_10021435013300006904Populus RhizosphereMILLALWRRGLLARLDREKLRQFVGASRDRLALSRRYRLW
Ga0075424_10177942423300006904Populus RhizosphereVILLALWRRGLLGRIDREKLGYFLGIGGDPLALSRQYPMWRILGVLRLLVDPR
Ga0075435_10155328223300007076Populus RhizosphereVILVALWRRGLLRRADREKLRHFLGLVGDPLALSRQYPMWRIL
Ga0099829_1116830513300009038Vadose Zone SoilVILLTLWRRGLLGRIDREKLGHFLGFGGDALTLSRRYPMWR
Ga0099829_1129278823300009038Vadose Zone SoilVILLALWRRGLLRRLDGEKLRHFLGWHRDPLALSRRYPM
Ga0075418_1289373813300009100Populus RhizosphereVIFLALWRRGLLGRADREKILYFLGRGPGPLTLSRRFPMWRILGLGRLICSP
Ga0105248_1171040523300009177Switchgrass RhizosphereMIFLALWRRGLLRRIDGEKLRQFLGFGSDRLALSRRYP
Ga0126380_1060521913300010043Tropical Forest SoilVILLALWRRGLLARIDREKLDLFLGRARDPLQLSRRYPPWRRLG
Ga0127483_117703123300010142Grasslands SoilVILIALWRRGLLGRADREKLRHFLGLARDPLTLSRRYPMWRILS
Ga0134084_1009764113300010322Grasslands SoilVILVALWRRGLLERADREKLRHFLGLARDPLALSRRYPMW
Ga0134084_1012129813300010322Grasslands SoilVILLALWRRGLLRRVDREKLRHFLGRHRDPLALSRRYPMWRILDIG
Ga0134063_1055410413300010335Grasslands SoilVILLTLWRRGLLGRIDREKLVHFLGFSEDALALSRQYPM
Ga0126383_1120649813300010398Tropical Forest SoilVILLALWRRGLLGRIDREKFGYFLGVSGDALTLSRQYPMWRILGVLRLLV
Ga0134122_1093049713300010400Terrestrial SoilMIFLALWRRGLLRRIDGEKLRQFVGLSRDRLALSRRYPLW
Ga0137455_104235613300011429SoilVIFYALWRRGLLRRADREKLGYFLGVAGGPLTLSRRYPLWRIL
Ga0137386_1027613613300012351Vadose Zone SoilVILIALWRRGLLGRADREKLRHFLGLARDPLTLSRRYPMWRIL
Ga0134051_129123733300012398Grasslands SoilVILVALWRQGLLGRADREKVRHFLGLARDPLALSRRYPMWR
Ga0137404_1050598513300012929Vadose Zone SoilVILLALWRRGLLRRADREKLGHFFGASPDPLSLSRRY
Ga0164299_1061449323300012958SoilVILLALWRRGLLRRADREKLGHFFGRAPDPLTLSRRY
Ga0134077_1042041323300012972Grasslands SoilVILVALWRRGLLERADREKLRHFLGLARDPLALSRRYPMWRIL
Ga0182876_1003557323300015240Microbial MatVILWVLWRRGLLRRFDREKVGFFLGHGADRLDLSRRYPLWRRLGLWHMIRAPA
Ga0137403_1101310813300015264Vadose Zone SoilVILLALWRRRLLRRIDAEKLRHFLGRDPDPLTLSRRYPMW
Ga0132255_10393456923300015374Arabidopsis RhizosphereVILFALWRRGLLRRADGEKLRHFLGIAGDRLTLSRRYPMWRILGPFRL
Ga0182035_1031920513300016341SoilVILLALWRRGLLGRVDREKLDLFLGRARDPLQLSRRYPPWRRLGVLRLLLSPAYAAGVAR
Ga0182039_1186249913300016422SoilVILLALWRRGLLGRIDREKLDLFLGRGRDPLQLSRRY
Ga0182039_1186725613300016422SoilVILLALWRRGLLRRLDRDKVAYLLGRGADPLLLSRRYPLWRRLVT
Ga0163161_1128683023300017792Switchgrass RhizosphereMIFLALWRRGLLRRIDGEKLRQFLGFGSDRLALSRRDF
Ga0187780_1125897113300017973Tropical PeatlandMILLALWRRGLLRRLDGEKLRYLLGRADDPLLLSRRYPLWRRLVTLRALCS
Ga0187765_1123664113300018060Tropical PeatlandVILLALWRRGLLGRADREKLRHFLGIHADPLALSRRYPMWRILRPLRMLLSPRYAAAV
Ga0187773_1049272023300018064Tropical PeatlandVIFWALWRRGLVQRADGEKLRLFFGLVRDPLALSRRY
Ga0066655_1021777813300018431Grasslands SoilVILVALWRRGLLERADREKLRHFLGLARDPLALSRRYPMWRILGPMRLLF
Ga0066662_1095429213300018468Grasslands SoilMILLALWRRGLLRRLDREKLAHFIGWRPDPLALSRRYPMW
(restricted) Ga0233425_1042395413300024054FreshwaterMILLALWRRGLLGRAINAEKLRFFLGIGSDRLLLSRRYPLWRILHPVRLVVS
Ga0137417_129799713300024330Vadose Zone SoilVILIALWRRGLLGRADREKLRHFLGFARDPLTLSRRYPMWRILNPLRLLVRLAALRG
Ga0209108_1048128413300025165SoilVILLALWRRGLLRRADRDKLAYFLGLARDPLVLSRRYPMWRILGP
Ga0207642_1086137513300025899Miscanthus RhizosphereVIFLALWRRGLFRRADREKLGYFFGVSPDPLALSRRFPMWRILSVPRLLCSPTYAR
Ga0207645_1036686713300025907Miscanthus RhizosphereVILWVLWRRGLLRRLDREKTAFFLGVGGDRLELSRRYPLWRRVGL
Ga0207684_1043725613300025910Corn, Switchgrass And Miscanthus RhizosphereVILLALWRRGLLGRADREKLAHFLGFARDPLTLSRRYPM
Ga0207649_1168486313300025920Corn RhizosphereVIFLALWRRGLFRRADREKLGYFFGLSPDPLALSRRF
Ga0207706_1038448523300025933Corn RhizosphereVILVALWRRGLLRRLDREKLRQFWGLRRDPLLLSRRYPMWRTLGVVRL
Ga0207678_1070314723300026067Corn RhizosphereVILLALWRRGLLRRADREKLGYFLGIAGGPLTLSRRYPLW
Ga0209236_124881213300026298Grasslands SoilMILLALWRRGLLRRLDREKLAHFIGWRPDPLALSRRYPM
Ga0209468_120110413300026306SoilVILIALWRRGLLGRADREKLRHFLGLARDPLTLSRRYPMWRILRPLRLLVSPRYAAA
Ga0209055_122796513300026309SoilVILVALWRQGLLGRADREKVRHFLGLARDPLALSRRYPMWRI
Ga0209239_126174723300026310Grasslands SoilVILIALWRRGLLGRADREKLRHFLGLARDPLTLSRRYPMWRILG
Ga0209154_111206913300026317SoilVILVALWRQGLLGRADREKVRHFLGLARDPLALSRR
Ga0209472_128838213300026323SoilVILLALWRRGLFRRLDGEKLRHFLGWHRDPLALSRRYPMWR
Ga0209801_129056513300026326SoilMILLALWRRGLLRRLDREKLAHFIGWRPDPLALSRRYPMWRILRIGRLLVSPAHARAVAR
Ga0209376_142053923300026540SoilVILIALWRRGLLGRADREKLRHFLGLARDPLTLSRRYPMWRILRPVRLLVSPRY
Ga0209486_1083925723300027886Agricultural SoilVIVVALWRRGLFARLDADKLRQFAGLRRDPLALSRRYPMWRALGV
Ga0209253_1076413423300027900Freshwater Lake SedimentVILWVLWRRGLLQRFDREKVGFFLGWGADRLDLSRRYPLWRRL
(restricted) Ga0233418_1017974413300027995SedimentVILYALWRGGLLGRVNRENLRQFWGLRRDPLLLSRRYPMWRSLGFV
Ga0247826_1063898613300030336SoilVIFYALWRRGLLRRADREKLGYFLGVAGGPLTLSRRYPLWRILRPVRLLLSPRYAESVA
Ga0307429_111927513300031368Salt MarshVILWALWRRGLLGRVDREKMAFFLGLGRDPLLLSRRYPLWRILGRRGLLASPRR
Ga0318516_1018220713300031543SoilVILLALWRRGLLGRVDREKLDLFLGRARDPLQLSRRYPPWRRLGVLRLLLS
Ga0318555_1034687423300031640SoilVILLALWRRGLLRRLDRDKVAYLLGRGADPLLLSRRYPLWRRLVTLRALGS
Ga0318572_1066385213300031681SoilVILLALWRRGLLARIDREKLALFLGRARDPLQLSRRYPPWRRLGVFRLLLSPAYAATVDI
Ga0318560_1081969123300031682SoilVILLALWRRGLLGRIDREKLDLFLGRARDPLQLSRRYPLWRRLGIFRM
Ga0318501_1032043723300031736SoilVILLALWRRGLLGRIDREKLDLFLGRARDPLQLSRRYPLWRRLGIFRMLLSPAY
Ga0318494_1072250623300031751SoilVILLALWRRGLLGRVDREKLDLFLGRARDPLQLSRRYPPWRRLGVLR
Ga0318554_1060992413300031765SoilVILLALWRRGLLRRLDRDKVAYLLGRGADPLLLSRRYPLWRRLVTL
Ga0318521_1082004913300031770SoilVILLALWRRGLLGRIDREKLDLFLGRARDPLQLSRRYPLWRRLGIFRMLLSP
Ga0318546_1065890923300031771SoilVILLALWRRGLLGRVDREKLDLFLGRARDPLQLSRRYPPWRRLGLL
Ga0318552_1035915823300031782SoilVILLALWRRGLLRRLDRDKVAYLLGRGADPLLLSRRYPLWR
Ga0318565_1030562623300031799SoilVILLALWRRGLLGRVDREKLDLFLGRARDPLQLSRRYPP
Ga0318520_1086031523300031897SoilVILLALWRRGLLGRIDREKLDLFLGRARDPLQLSRRYPPWRRLGVLRLLLSPAY
Ga0306923_1058637733300031910SoilVILLALWRRGLLARIDREKLALFLGRARDPLQLSRRYPPWRRLGVFRLLLSP
Ga0306921_1148518913300031912SoilVILLALWRRGLLGRVDREKLDLFLGRARDPLQLSRRYPPWRRLGVLRL
Ga0306926_1251641023300031954SoilVILLALWRRGLLGRVDREKLDLFLGRARDPLQLSRRYPPWRRLGLLRLLLS
Ga0318569_1030529623300032010SoilVILLALWRRGLLGRVDREKLDLFLGRARDPLQLSRRYPPWRRLGVLRLLLSPAYAAGESR
Ga0310911_1089911013300032035SoilVILLALWRRGLLGRVDREKLDLFLGRARDPLQLSRRYPPWRRLGVFRLLLSPAYAA
Ga0318504_1019395713300032063SoilVILLALWRRGLLGRVDREKLDLFLGRARDPLQLSRRYPPWRRLGVLRLLLTPAYA
Ga0310890_1185608213300032075SoilVIFYALWRRGLLRRADREKLGYFLGVAGGPLTLSRRYPLWRILRPVRLLLSP
Ga0306924_1189406213300032076SoilVILLALWRRGLLGRVDREKLDLFLGRARDPLQLSRRYPPWRRLGVFRLLLS
Ga0318518_1004818353300032090SoilVILLALWRRGLLGRVDREKLDLFLGRARDPLQLSRRYPPWRRLGVLRLLLSPAY
Ga0316630_1003009653300033487SoilVILYALWRRGLLRRLDGERLRQFWGWRRDPLLLSRRYPMWRALGLARLLVSP
Ga0364935_0321304_2_1303300034151SedimentMILLALWRRGLLRRLDREKLRQFWGLRRDPLLLSRRYPMWRTL

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.