NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F095842

Metagenome / Metatranscriptome Family F095842

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F095842
Family Type Metagenome / Metatranscriptome
Number of Sequences 105
Average Sequence Length 51 residues
Representative Sequence VTGWETSERVLESGGFESRQRVLVAEPVVEASEAGARTLGVTYWQAVDRF
Number of Associated Samples 90
Number of Associated Scaffolds 105

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 67.31 %
% of genes near scaffold ends (potentially truncated) 99.05 %
% of genes from short scaffolds (< 2000 bps) 91.43 %
Associated GOLD sequencing projects 88
AlphaFold2 3D model prediction No

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (79.048 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil
(16.191 % of family members)
Environment Ontology (ENVO) Unclassified
(32.381 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(49.524 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 0.00%    β-sheet: 46.00%    Coil/Unstructured: 54.00%
Feature Viewer
Powered by Feature Viewer


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 105 Family Scaffolds
PF03441FAD_binding_7 12.38
PF06114Peptidase_M78 10.48
PF17164DUF5122 3.81
PF00201UDPGT 1.90
PF04226Transgly_assoc 1.90
PF06966DUF1295 1.90
PF08327AHSA1 1.90
PF00005ABC_tran 1.90
PF00875DNA_photolyase 1.90
PF08240ADH_N 1.90
PF03807F420_oxidored 1.90
PF00501AMP-binding 0.95
PF13561adh_short_C2 0.95
PF13458Peripla_BP_6 0.95
PF03364Polyketide_cyc 0.95
PF12695Abhydrolase_5 0.95
PF12680SnoaL_2 0.95
PF01118Semialdhyde_dh 0.95
PF13602ADH_zinc_N_2 0.95
PF02469Fasciclin 0.95
PF01326PPDK_N 0.95
PF00027cNMP_binding 0.95
PF13466STAS_2 0.95
PF05088Bac_GDH 0.95
PF05974DUF892 0.95
PF07731Cu-oxidase_2 0.95
PF13460NAD_binding_10 0.95
PF10011DUF2254 0.95
PF07876Dabb 0.95
PF08338DUF1731 0.95
PF00480ROK 0.95
PF06723MreB_Mbl 0.95
PF00089Trypsin 0.95
PF02653BPD_transp_2 0.95
PF03073TspO_MBR 0.95
PF13191AAA_16 0.95

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 105 Family Scaffolds
COG0415Deoxyribodipyrimidine photolyaseReplication, recombination and repair [L] 14.29
COG1819UDP:flavonoid glycosyltransferase YjiC, YdhE familyCarbohydrate transport and metabolism [G] 3.81
COG1940Sugar kinase of the NBD/HSP70 family, may contain an N-terminal HTH domainTranscription [K] 1.90
COG2020Protein-S-isoprenylcysteine O-methyltransferase Ste14Posttranslational modification, protein turnover, chaperones [O] 1.90
COG2261Uncharacterized membrane protein YeaQ/YmgE, transglycosylase-associated protein familyGeneral function prediction only [R] 1.90
COG3752Steroid 5-alpha reductase family enzymeGeneral function prediction only [R] 1.90
COG0574Phosphoenolpyruvate synthase/pyruvate phosphate dikinaseCarbohydrate transport and metabolism [G] 0.95
COG1077Cell shape-determining ATPase MreB, actin-like superfamilyCell cycle control, cell division, chromosome partitioning [D] 0.95
COG1090NAD dependent epimerase/dehydratase family enzymeGeneral function prediction only [R] 0.95
COG2132Multicopper oxidase with three cupredoxin domains (includes cell division protein FtsP and spore coat protein CotA)Cell cycle control, cell division, chromosome partitioning [D] 0.95
COG2335Uncaracterized surface protein containing fasciclin (FAS1) repeatsGeneral function prediction only [R] 0.95
COG2902NAD-specific glutamate dehydrogenaseAmino acid transport and metabolism [E] 0.95
COG3476Tryptophan-rich sensory protein TspO/CrtK (mitochondrial benzodiazepine receptor homolog)Signal transduction mechanisms [T] 0.95
COG3685Ferritin-like metal-binding protein YciEInorganic ion transport and metabolism [P] 0.95


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms79.05 %
UnclassifiedrootN/A20.95 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000956|JGI10216J12902_100702171All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1529Open in IMG/M
3300000956|JGI10216J12902_101182459All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium601Open in IMG/M
3300000956|JGI10216J12902_110366688All Organisms → cellular organisms → Bacteria819Open in IMG/M
3300002239|JGI24034J26672_10090984All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium566Open in IMG/M
3300003203|JGI25406J46586_10231484All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium541Open in IMG/M
3300004157|Ga0062590_100782577All Organisms → cellular organisms → Bacteria874Open in IMG/M
3300004157|Ga0062590_101922499Not Available611Open in IMG/M
3300005093|Ga0062594_100061812All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1999Open in IMG/M
3300005337|Ga0070682_101552977All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium571Open in IMG/M
3300005341|Ga0070691_10187123All Organisms → cellular organisms → Bacteria1081Open in IMG/M
3300005365|Ga0070688_100073063All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2199Open in IMG/M
3300005436|Ga0070713_101118421All Organisms → cellular organisms → Bacteria762Open in IMG/M
3300005439|Ga0070711_100147945All Organisms → cellular organisms → Bacteria1768Open in IMG/M
3300005440|Ga0070705_101236512All Organisms → cellular organisms → Bacteria617Open in IMG/M
3300005441|Ga0070700_100996255Not Available689Open in IMG/M
3300005466|Ga0070685_11366194Not Available543Open in IMG/M
3300005539|Ga0068853_101532335All Organisms → cellular organisms → Bacteria646Open in IMG/M
3300005764|Ga0066903_107733765Not Available553Open in IMG/M
3300005843|Ga0068860_100397110All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1364Open in IMG/M
3300005883|Ga0075299_1046215All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia507Open in IMG/M
3300006031|Ga0066651_10714907All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium539Open in IMG/M
3300006175|Ga0070712_101201306All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium660Open in IMG/M
3300006581|Ga0074048_13188850All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria895Open in IMG/M
3300006581|Ga0074048_13290662All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium567Open in IMG/M
3300006605|Ga0074057_11885216All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium574Open in IMG/M
3300006606|Ga0074062_12824367All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium601Open in IMG/M
3300006755|Ga0079222_11435881All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria641Open in IMG/M
3300006806|Ga0079220_10956601All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Hydrogenophaga → unclassified Hydrogenophaga → Hydrogenophaga sp. T4673Open in IMG/M
3300007076|Ga0075435_101670905All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium559Open in IMG/M
3300009148|Ga0105243_11926016All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae624Open in IMG/M
3300009156|Ga0111538_13502266All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium545Open in IMG/M
3300009156|Ga0111538_13770858All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium525Open in IMG/M
3300009156|Ga0111538_13872517All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium518Open in IMG/M
3300009162|Ga0075423_13156152All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium505Open in IMG/M
3300009177|Ga0105248_11020738All Organisms → cellular organisms → Bacteria934Open in IMG/M
3300009553|Ga0105249_12103615All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium637Open in IMG/M
3300009840|Ga0126313_10727406Not Available805Open in IMG/M
3300010154|Ga0127503_10643976All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1651Open in IMG/M
3300010227|Ga0136219_1019184All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium752Open in IMG/M
3300010373|Ga0134128_11021945Not Available913Open in IMG/M
3300010373|Ga0134128_11603393Not Available716Open in IMG/M
3300010399|Ga0134127_12273891All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium621Open in IMG/M
3300010399|Ga0134127_12855854All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium562Open in IMG/M
3300012091|Ga0136625_1253566Not Available594Open in IMG/M
3300012884|Ga0157300_1021017All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium864Open in IMG/M
3300012898|Ga0157293_10069123All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium837Open in IMG/M
3300012906|Ga0157295_10170940All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium669Open in IMG/M
3300012910|Ga0157308_10042325All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1147Open in IMG/M
3300012911|Ga0157301_10446330All Organisms → cellular organisms → Bacteria512Open in IMG/M
3300012943|Ga0164241_10031495All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria4018Open in IMG/M
3300012951|Ga0164300_10912967Not Available556Open in IMG/M
3300012958|Ga0164299_10162226Not Available1250Open in IMG/M
3300012985|Ga0164308_10174668All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1613Open in IMG/M
3300012989|Ga0164305_12064200All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium522Open in IMG/M
3300013308|Ga0157375_13573777All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium517Open in IMG/M
3300014254|Ga0075312_1162627All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia501Open in IMG/M
3300014326|Ga0157380_11312343All Organisms → cellular organisms → Bacteria771Open in IMG/M
3300015077|Ga0173483_10402122All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium703Open in IMG/M
3300015371|Ga0132258_10787278All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2397Open in IMG/M
3300015371|Ga0132258_12453334All Organisms → cellular organisms → Bacteria1305Open in IMG/M
3300015371|Ga0132258_13989951All Organisms → cellular organisms → Bacteria1002Open in IMG/M
3300015372|Ga0132256_100987203Not Available958Open in IMG/M
3300015373|Ga0132257_103083184All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium607Open in IMG/M
3300015373|Ga0132257_104120330Not Available529Open in IMG/M
3300015374|Ga0132255_101101693All Organisms → cellular organisms → Bacteria1194Open in IMG/M
3300015374|Ga0132255_106335525All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium501Open in IMG/M
3300017965|Ga0190266_10383588All Organisms → cellular organisms → Bacteria → Terrabacteria group772Open in IMG/M
3300018055|Ga0184616_10186981All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium775Open in IMG/M
3300018072|Ga0184635_10080936All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1274Open in IMG/M
3300018073|Ga0184624_10023121Not Available2340Open in IMG/M
3300018469|Ga0190270_11336875Not Available760Open in IMG/M
3300018481|Ga0190271_12184927All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium660Open in IMG/M
3300018481|Ga0190271_12298658All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium644Open in IMG/M
3300022901|Ga0247788_1075574Not Available647Open in IMG/M
3300025899|Ga0207642_10525893All Organisms → cellular organisms → Bacteria727Open in IMG/M
3300025907|Ga0207645_11014563All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium562Open in IMG/M
3300025908|Ga0207643_11142405Not Available502Open in IMG/M
3300025912|Ga0207707_10194909All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1767Open in IMG/M
3300025913|Ga0207695_11001924All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium715Open in IMG/M
3300025917|Ga0207660_11054780All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria663Open in IMG/M
3300025925|Ga0207650_11489115Not Available575Open in IMG/M
3300025926|Ga0207659_11421989Not Available594Open in IMG/M
3300025927|Ga0207687_10574233All Organisms → cellular organisms → Bacteria948Open in IMG/M
3300025934|Ga0207686_10081568All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium2112Open in IMG/M
3300025934|Ga0207686_11748419All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium514Open in IMG/M
3300025935|Ga0207709_10617033All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria860Open in IMG/M
3300025940|Ga0207691_10009136All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria9512Open in IMG/M
3300026023|Ga0207677_10780046All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria854Open in IMG/M
3300026035|Ga0207703_11657641All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria615Open in IMG/M
3300026095|Ga0207676_10884618Not Available875Open in IMG/M
3300028379|Ga0268266_10444732All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1231Open in IMG/M
3300028596|Ga0247821_10463251All Organisms → cellular organisms → Bacteria801Open in IMG/M
3300028597|Ga0247820_10958409All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia609Open in IMG/M
3300030336|Ga0247826_10473773All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria941Open in IMG/M
3300031854|Ga0310904_10376816All Organisms → cellular organisms → Bacteria923Open in IMG/M
3300031908|Ga0310900_10458439All Organisms → cellular organisms → Bacteria982Open in IMG/M
3300031908|Ga0310900_11048349All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria672Open in IMG/M
3300031938|Ga0308175_100266609All Organisms → cellular organisms → Bacteria1728Open in IMG/M
3300031939|Ga0308174_10898345Not Available748Open in IMG/M
3300031996|Ga0308176_11834173All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium647Open in IMG/M
3300032770|Ga0335085_12134103Not Available565Open in IMG/M
3300032782|Ga0335082_10117865All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia2608Open in IMG/M
3300033475|Ga0310811_11096643All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium676Open in IMG/M
3300033550|Ga0247829_10111538All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2076Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil16.19%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil9.52%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere6.67%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere5.71%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere4.76%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere4.76%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil3.81%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil3.81%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil3.81%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment2.86%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil2.86%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere2.86%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere2.86%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere2.86%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere2.86%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil1.90%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil1.90%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere1.90%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere1.90%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere1.90%
SoilEnvironmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil0.95%
Polar Desert SandEnvironmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand0.95%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil0.95%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.95%
Natural And Restored WetlandsEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands0.95%
Rice Paddy SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil0.95%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil0.95%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere0.95%
Tabebuia Heterophylla RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere0.95%
Corn, Switchgrass And Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere0.95%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.95%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.95%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.95%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere0.95%
SoilEngineered → Lab Enrichment → Unclassified → Unclassified → Unclassified → Soil0.95%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000956Soil microbial communities from Great Prairies - Kansas, Native Prairie soilEnvironmentalOpen in IMG/M
3300002239Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2Host-AssociatedOpen in IMG/M
3300003203Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2Host-AssociatedOpen in IMG/M
3300004157Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2EnvironmentalOpen in IMG/M
3300005093Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All BlocksEnvironmentalOpen in IMG/M
3300005337Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaGEnvironmentalOpen in IMG/M
3300005341Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaGEnvironmentalOpen in IMG/M
3300005365Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaGEnvironmentalOpen in IMG/M
3300005436Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaGEnvironmentalOpen in IMG/M
3300005439Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaGEnvironmentalOpen in IMG/M
3300005440Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaGEnvironmentalOpen in IMG/M
3300005441Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaGEnvironmentalOpen in IMG/M
3300005466Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaGEnvironmentalOpen in IMG/M
3300005539Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2Host-AssociatedOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300005843Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2Host-AssociatedOpen in IMG/M
3300005883Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_25C_80N_302EnvironmentalOpen in IMG/M
3300006031Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100EnvironmentalOpen in IMG/M
3300006175Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaGEnvironmentalOpen in IMG/M
3300006581Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLPB (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006605Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHAB (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006606Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMA (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006755Agricultural soil microbial communities from Georgia to study Nitrogen management - GA PlitterEnvironmentalOpen in IMG/M
3300006806Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100EnvironmentalOpen in IMG/M
3300007076Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4Host-AssociatedOpen in IMG/M
3300009148Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaGHost-AssociatedOpen in IMG/M
3300009156Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009162Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2Host-AssociatedOpen in IMG/M
3300009177Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaGHost-AssociatedOpen in IMG/M
3300009553Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaGHost-AssociatedOpen in IMG/M
3300009840Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105AEnvironmentalOpen in IMG/M
3300010154Soil microbial communities from Willow Creek, Wisconsin, USA - WC-WI-TBF metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010227Soil microbial communities from Bangor area, North Wales, UK, treated with sorgoleone, replicate 2EngineeredOpen in IMG/M
3300010373Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4EnvironmentalOpen in IMG/M
3300010399Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3EnvironmentalOpen in IMG/M
3300012091Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ483 (23.06)EnvironmentalOpen in IMG/M
3300012884Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2EnvironmentalOpen in IMG/M
3300012898Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S194-509B-1EnvironmentalOpen in IMG/M
3300012906Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S212-509R-1EnvironmentalOpen in IMG/M
3300012910Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S198-509B-2EnvironmentalOpen in IMG/M
3300012911Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S088-202R-2EnvironmentalOpen in IMG/M
3300012943Backyard soil microbial communities from Emeryville, California, USA - Original compost - Back yard soil (BY)EnvironmentalOpen in IMG/M
3300012951Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MGEnvironmentalOpen in IMG/M
3300012958Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MGEnvironmentalOpen in IMG/M
3300012960Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MGEnvironmentalOpen in IMG/M
3300012985Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MGEnvironmentalOpen in IMG/M
3300012989Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MGEnvironmentalOpen in IMG/M
3300013308Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaGHost-AssociatedOpen in IMG/M
3300014254Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_CattailB_D2EnvironmentalOpen in IMG/M
3300014326Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaGHost-AssociatedOpen in IMG/M
3300015077Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S178-409R-2 (version 2)EnvironmentalOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300015373Combined assembly of cpr5 rhizosphereHost-AssociatedOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300017965Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 220 TEnvironmentalOpen in IMG/M
3300018055Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_90_coexEnvironmentalOpen in IMG/M
3300018072Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b2EnvironmentalOpen in IMG/M
3300018073Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_b1EnvironmentalOpen in IMG/M
3300018469Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 TEnvironmentalOpen in IMG/M
3300018481Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 TEnvironmentalOpen in IMG/M
3300022901Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S156-409C-4EnvironmentalOpen in IMG/M
3300025899Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025907Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025908Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025912Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025913Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025917Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025925Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025926Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025927Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025934Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025935Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025940Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026023Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026035Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026095Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300028379Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300028596Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Glycerol_Day14EnvironmentalOpen in IMG/M
3300028597Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Glucose_Day14EnvironmentalOpen in IMG/M
3300030336Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day1EnvironmentalOpen in IMG/M
3300031854Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D1EnvironmentalOpen in IMG/M
3300031908Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D1EnvironmentalOpen in IMG/M
3300031938Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1EnvironmentalOpen in IMG/M
3300031939Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R2EnvironmentalOpen in IMG/M
3300031996Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2EnvironmentalOpen in IMG/M
3300032770Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5EnvironmentalOpen in IMG/M
3300032782Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1EnvironmentalOpen in IMG/M
3300033475Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YCEnvironmentalOpen in IMG/M
3300033550Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day4EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI10216J12902_10070217113300000956SoilMIGWETSERVLESGAFESRQRVLVPEPVVEASEAGARTLGVTYWQAVDRFTR
JGI10216J12902_10118245923300000956SoilVTGWETSERVLESGGFESRQRVLVAEPVVEASEAGARTLGVTYWQAVDRF
JGI10216J12902_11036668823300000956SoilMVGGVTGWETSERVLESGGFESRQRVLVAETVVEASEAGARTLGVTYWQAVDRFTRG
JGI24034J26672_1009098413300002239Corn, Switchgrass And Miscanthus RhizosphereMTGWETSERVLESGGFESRQRVLVAKPVVEASEAGARTLGVTYWQAV
JGI25406J46586_1023148413300003203Tabebuia Heterophylla RhizosphereVIGWETSERVLESGGFESRQRVLVAEPVVEASEAGARALGVTYWRAVDR
Ga0062590_10078257723300004157SoilLANGGGGVTGWETSERVLESGDFESRQRVLVAVPVVEASEAGARTLGVTYWQAV
Ga0062590_10192249913300004157SoilVTGWETSERVLESGGFESRQGVLVGEPVVEASEAGARTLGVTYW
Ga0062594_10006181213300005093SoilMTGWESTERVLDSGGFESRQRVLVPEPMVEASEAGARTLGVTYWQAVDRF
Ga0070682_10155297733300005337Corn RhizosphereMTGWETSERVLESGGFESRQRVLVAEPVVEASEAGARTLGVTYWQAVDRFTRSGIRA
Ga0070691_1018712323300005341Corn, Switchgrass And Miscanthus RhizosphereVSGWETSERVLESGGFESRQRMLVADPVVEASEAGARTLGVTYWQAVDRLTRG
Ga0070688_10007306313300005365Switchgrass RhizosphereMTGWETSERVLESGGFESRQRVLVAKPVVEASEAGARTLGVTYW
Ga0070713_10111842123300005436Corn, Switchgrass And Miscanthus RhizosphereVTGWETSERVLESGGFESRQRVLVAEPVVEASEAGARTLGVTYWQAVDRFTRG
Ga0070711_10014794543300005439Corn, Switchgrass And Miscanthus RhizosphereVTGWETSERVLESGAFESRQRLLVAEPVVEASEAGARTLGVTYWQAVDRFTRGGVR
Ga0070705_10123651213300005440Corn, Switchgrass And Miscanthus RhizosphereMAAEGLTGWETLERVLESGGFESRQRVLVAEPVVEASEAGARTLGVT
Ga0070700_10099625513300005441Corn, Switchgrass And Miscanthus RhizosphereVTGWETSERVLESGGFESRQRVLVVEPMVEASEAGARTLGVTYWQA
Ga0070685_1136619423300005466Switchgrass RhizosphereMTGWESTERVLDSGGFESRQRVLVPEPMVEASEAGARTLGVTYWQAVDRFTR
Ga0068853_10153233523300005539Corn RhizosphereMAAIDWETSERVLESGGFESRQRVLVAQPAVEASESGARTLGIVYWHAVDRVTRG
Ga0066903_10773376523300005764Tropical Forest SoilLIGWETSERVLESGAFESRQRVLVAEAAVEASEAGARTLGITYWQAV
Ga0068860_10039711013300005843Switchgrass RhizosphereMTGWETSERVLESGGFESRQRVLVAEPVVEASAAGARTLGVTYWQAVDGF
Ga0075299_104621513300005883Rice Paddy SoilVTGWETSERVLESGGFESRQRVLVAEPAVEASEAGARTLGVTYWQAVDRFTR
Ga0066651_1071490713300006031SoilMAVDGVTGWETLERVLESGGFESRQRVLVAEPVAEASEAGARTLGVTYWQ
Ga0070712_10120130623300006175Corn, Switchgrass And Miscanthus RhizosphereMTGWETSERVLESGGFESRQRVLVAEPVVEASEAGARTLGVTYWQAVDRFTRGGVRASWT
Ga0074048_1318885023300006581SoilMTMAAVTGWETSERVLESGGFESRQRVLVTEPVVEASEAGARTLGVTYWQAVHDFT
Ga0074048_1329066213300006581SoilVTGWETSERVLESGGFESRQRVLVVEPVVEASEAGARTLGVTYWQAVD
Ga0074057_1188521613300006605SoilVTGWETSERVLESGGFESRQRVLVAEPVVEASEAGARTLGVTYWQ
Ga0074062_1282436733300006606SoilMTGWETSERVLESGGFESRQRVLVAEPVVEASEAGARTLGVTYWQAVDRFTRG
Ga0079222_1143588123300006755Agricultural SoilVTGWETSERVLESGRFESRQRVLVAEPVVEASEAGARSL
Ga0079220_1095660113300006806Agricultural SoilMTGWETSERVLESGGFESRQRVFVGEPVVEASEAGARTLGVTYWQAVDGFTRGF
Ga0075435_10167090513300007076Populus RhizosphereMGVDGVTGWATSERVLESGGFESRQRVLVAEPVVEASEAGARTLGVTYWQAVDRFTRG
Ga0105243_1192601623300009148Miscanthus RhizosphereMTGWETSERVLESGGFESRQRVLVPEPVVEASESGARTLGVTYWQAVDGFTRGAV
Ga0111538_1350226613300009156Populus RhizosphereVSGWETSERVLESGGFESRQRMLVPGPVVEASEAGARTLGVTY
Ga0111538_1377085823300009156Populus RhizosphereVTGWETSERLLESGGFESRQRVLVAEPVVEASEAGARTLGVTYWQAV
Ga0111538_1387251713300009156Populus RhizosphereLTGWETSERVLESGGFESRQRVLVVQPVVKASEAGARTLGVTYWQAVDRFTRGG
Ga0075423_1315615223300009162Populus RhizosphereVTGWETSERVLESGGFESRQRMLVADPVVEASEAGARTLGVTYWQAVDRL
Ga0105248_1102073813300009177Switchgrass RhizosphereVTGWETSELVLESGGFESRQRVLVAEPVVEASEAGARSLGVTYWQAVDRFT
Ga0105249_1210361513300009553Switchgrass RhizosphereVIGWETSERVFASGGFESRQRVLVAEPVVEASEAGARSLGVSYWQAV
Ga0126313_1072740613300009840Serpentine SoilMTEWQTSERVLESGAVESDQRVLMGEPAVEESAAGARVLGVTY
Ga0127503_1064397633300010154SoilVTGWETSERVRESGGFESRQRVLVAEPVVEASGAGARTLGVTYWQAVDRFTRGGVRASW
Ga0136219_101918423300010227SoilESGGFASRQRVLVREPVVEASEAGARTLGVTYWQAVDRVTRGVIRASWTGGGAS*
Ga0134128_1102194513300010373Terrestrial SoilMAAEGLTGWETLERVLESGGFESRQRVLVKEPVVEASEAGARTLGITYWRAVD
Ga0134128_1160339323300010373Terrestrial SoilVTGWETSERVLESGAFESRQRLLVAEPVVEASEAGARTLGVTYWQAV
Ga0134127_1227389113300010399Terrestrial SoilMTGWETSERVLESGGFESRQRVLVAEPVVEASEAGARTLGVTYWQAVDRFTRSGIRASW
Ga0134127_1285585413300010399Terrestrial SoilVTGWETSERVLESGGFESRQRVLVAEPVVEASEAGARTLGVTYWQAVDRFTRSGIRASW
Ga0136625_125356623300012091Polar Desert SandMKGWEANERVLESGGFESRHRVLVDDIVVEASEAGARVLGVTYWQAVDR
Ga0157300_102101713300012884SoilLTGWETSERVLESGGFESRQRVLVAEPVVEASEAGARTLGVTYWHAVDRFTRGGVR
Ga0157293_1006912313300012898SoilMAAEGLTGWETLERVLESGGFESRQRVLVAEPVVEASEAGARTLGVTY
Ga0157295_1017094033300012906SoilDYPSPMAAEGLTGWETLERVLESGGFESRQRVLVAEPVVEASEAGARTLGVTYWQAVDRFTRGFVRANWRAVEAS*
Ga0157308_1004232533300012910SoilVTGWETSEHVLESGGFESRQRVLVAEPVVEASEAGARTLGVTYWQAVDRFTRGGVRA
Ga0157301_1044633013300012911SoilVTGWETSERVLESGAFESRQRVLVGEPVVEASEAGARTLGVTYWQAVDRFTRGFVRA
Ga0164241_1003149513300012943SoilVTGWETSERVLESGGFESRQRVLVAEPVVEASEAGARTLGVTYWQAVDRFTRGGIRASWTGG
Ga0164300_1091296713300012951SoilVTGWETSERVLESGAFESRQRVLVGEPVVEASDAGARTLGVTYWQAVDR
Ga0164299_1016222633300012958SoilVTGWETSERVLESGAFESRQRVLVGEPVVESSEAGARTLGVTYWQ
Ga0164301_1063118013300012960SoilVLESGGFESRQRVLVAEPVVEASEAGARTLGVTYWQA
Ga0164308_1017466813300012985SoilMTGWETSERVLESGGFESRQRVLVAEPVVEASEAGARTLGVTY
Ga0164305_1206420013300012989SoilVTGWETSERVLESGGFESRQRVLVAEPVVEASEAGARTLGVTYWQAVDRFTRGGVR
Ga0157375_1357377723300013308Miscanthus RhizosphereMVVPLTGWETSERVLESGGFESRQRVLVAEPVVEASEAGARTLGVTYWQAVDRFTRGGVRAS
Ga0075312_116262713300014254Natural And Restored WetlandsVTGWETSERVLESGGFESRQRVLVAEPAVEASEAGARTLGVTYWQAVDRFTRGW
Ga0157380_1131234323300014326Switchgrass RhizosphereMDKHWLREWETSERLLESGGFESRQRVLVAEPAVEASDSGARWLGVTYWRAVAG
Ga0173483_1040212213300015077SoilMAAEGLTGWETLERVLESGGFESRQRVLVAQPVVEASEAGARTLGVTYWQAVDRFTR
Ga0132258_1078727813300015371Arabidopsis RhizosphereVTGWETSERVLESGAFESRQRVLAADPVVEASEAGARTLGVTYWQ
Ga0132258_1245333413300015371Arabidopsis RhizosphereMVVDGVTGWETSERVLESGGFESRQRVLVAEPVVEASEAGARTLGVTYWQAVDRFT
Ga0132258_1398995123300015371Arabidopsis RhizosphereLADGGSGVTGWETSERVLESGAFESRQRVLVAEPVVEASESGARALGVT
Ga0132256_10098720323300015372Arabidopsis RhizosphereMGWETSERVLESGGFESFQRVLVAEPVVEASEAGARTLGVTYWQAVDRVTH
Ga0132257_10308318413300015373Arabidopsis RhizosphereVTGWETSELVLESGGFESRQRVLVAEPVVEASEAGARSLGVTYWQAVDRFTR
Ga0132257_10412033013300015373Arabidopsis RhizosphereMTGWETSERVLESGGFESRQRVLVAEPVVEASEAGARTLGVT
Ga0132255_10110169333300015374Arabidopsis RhizosphereVSGWETSERVLESGGFESRQRMLVADPVVEASEAGARTLGVTYWQAVDRL
Ga0132255_10633552523300015374Arabidopsis RhizosphereVTGWETSELVLESGGFESRQRVLVAEPVVEASEAGARSRGVTYWQAVDRFTRG
Ga0190266_1038358813300017965SoilVTGWETSERVLESGGFESRQRVLVAEPVVEASEAGARTLG
Ga0184616_1018698113300018055Groundwater SedimentMTGWETSERVLESGAFESRQRVFVAEPAVEASEAGARTL
Ga0184635_1008093613300018072Groundwater SedimentMTGWETSERVLESGGFESRQRVLVAEPVVEASEAGARTLGVTYWQAV
Ga0184624_1002312113300018073Groundwater SedimentMTGWETSERVLESGGFESRQRVFVAEPVVEASEAGARTLGVTYWQAVDRFTRGG
Ga0190270_1133687513300018469SoilVTGWETSERLLESGGFESRQRVLVAEPVVEASEAGARTLG
Ga0190271_1218492713300018481SoilVTGWETSERVLESGGFESRQRVLVAEPVVEASEAGARTLGVAYWQAVDRFTRG
Ga0190271_1229865813300018481SoilVTGWETSERVLESGGFESRQRVLVAEPVVEASAAGARTLGVTYWQAVDRFTRGGVRASW
Ga0247788_107557423300022901SoilVTGWETSERVLESGGFESRQRVLVAEPVVEASEAGARTL
Ga0207642_1052589323300025899Miscanthus RhizosphereMTGWESTERVLDSGGFESRQRVLVPEPMVEASEAGARTLGVTYWQAVDRFTRGGVRASW
Ga0207645_1101456323300025907Miscanthus RhizosphereVSGWETSERVLESGGFESRQRMLVADPVVEASEAGARTLGVTYWQAVDRLTRGAVRASWTGD
Ga0207643_1114240513300025908Miscanthus RhizosphereMTGWESTERVLDSGGFESRQRVLVPEPMVEASEAGARTLGVTYWQAVDRFTRGG
Ga0207707_1019490913300025912Corn RhizosphereVSGWETSERVLESGRFESRQRVLVAEPVVEASEAGARSLGVTY
Ga0207695_1100192413300025913Corn RhizosphereMAAIDWETSERVLESGGFESRQRVLVAQPAVEASESGARTLGIV
Ga0207660_1105478023300025917Corn RhizosphereMTGWETSERVLESGGFESRQRVLVAEPVVEASEAGARTLGVTYWQA
Ga0207650_1148911523300025925Switchgrass RhizosphereVTGWETSERVLESGGFESRQRVLVPEPVVEASEAGARTLGVTYWQAVDR
Ga0207659_1142198913300025926Miscanthus RhizosphereMTGWESTERVLDSGGFESRQRVLVPEPMVEASEAGARTLGVTYWQAVDRFTRGGVR
Ga0207687_1057423313300025927Miscanthus RhizosphereMTGWESTERVLDSGGFESRQRVLVPEPMVEASEAGARTLGVTYWQAVDRFTRGGVRA
Ga0207686_1008156853300025934Miscanthus RhizosphereVTGWETSERVLESGAFESRQRALVAEPAVEASEAGARTLGVTYW
Ga0207686_1174841923300025934Miscanthus RhizosphereVTGWETSELVLESGGFESRQRVLVAEPVVEASEAGARSLGVTYWQAVDRFTRGGVRASWTGDGG
Ga0207709_1061703313300025935Miscanthus RhizosphereMTMAAGTGWETSERVLESGGFESRQRVLVTEPVVEASESGARTLGVTYWQSVDGFT
Ga0207691_10009136103300025940Miscanthus RhizosphereMTGWETSERVLESGGFESRQRVLVAEPVVEASEAGARTLGVTYWQAVDGFTRGGI
Ga0207677_1078004613300026023Miscanthus RhizosphereMTGWETSERVLESGGFESRQRVLVAEPVVEASEAGARTLGVTYWQAVDGFTRGGIRAS
Ga0207703_1165764113300026035Switchgrass RhizosphereMTGWETSERVLESGGFESRQRVLVAEPVVEASEAGAR
Ga0207676_1088461813300026095Switchgrass RhizosphereVTGWETSERVLESGGFESRQRVLVAEPVVEASEAGARTLGVTY
Ga0268266_1044473223300028379Switchgrass RhizosphereVTGWETSERVLESGGFESRQRVLVPEPVVEASEAGARTLGVTYWQAVEQLQVPP
Ga0247821_1046325113300028596SoilMTGWETTERLLDSGGFESRQSVLVPEPVVEASEAGARTLGVTYWHAVDRFTRGGVRASWK
Ga0247820_1095840913300028597SoilMTGWETSERVLESGGFESRQRVLVAEPVVEASEAGARTLGVTYWQAVDRLT
Ga0247826_1047377313300030336SoilMTGWETTERLLDSGGFESRQSVLVPEPVVEASEAGARTLGVTYWQAVDRFTRG
Ga0310904_1037681623300031854SoilVTGWETSERVCESGGFESRQRVLVAEPVVEASEAGARTLGVTYWQAVDRFTR
Ga0310900_1045843913300031908SoilVTGWETSERVLESGGFESRQRVLVPEPIVEASEAGARTLGVTYWQAV
Ga0310900_1104834923300031908SoilMTGWETSERVLESGGFESRQRVLVAEPVVEASEAGARTLGVTYW
Ga0308175_10026660943300031938SoilVTGWETSERVLESGGFESRQRVLVGEPVVEASEAGARTLGVAYWQAVDRFTRGLVRAS
Ga0308174_1089834513300031939SoilMTGWETSERVLESGAFESRQRVLVAEPVVEASVAGARSLGVTYWLAVDR
Ga0308176_1183417333300031996SoilMAVYGVTGWETSERVFESGGFESRQRVLVAKPLVEASEAGARTLGVTYWQAVDR
Ga0335085_1213410323300032770SoilVTGWETSERVLESGAFESRQQVLAPEPAVEASEAGARTLGITYWQAVDRFTRG
Ga0335082_1011786513300032782SoilVTGWESSERVLESGDFESRQRILVAEPAVEVSEAGARTLGITYWQAVDRFTRGGVR
Ga0310811_1109664323300033475SoilMAAEGLTGWETLERVLESGGFESRQRVLVAEPVVEASEAGARTLGVTYWQAVDRFTRSGVRASW
Ga0247829_1011153813300033550SoilMVVDGVTGWETSERVLESGGFESRQRVLVAEPVVEASEAGARTLGVTYWQAVDRFTRGGVRASSPPW


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.